hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_22943.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAZ21413.1
Accession:      [none]
Description:    pubi0 AAZ21413.1 GIB00256CH01 "protein with conserved domain of unknown functio.."

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0040484  YebC-like                                      282.1    1.3e-88   1
0040186  YebC-like                                      287.1    5.2e-87   1
0041114  YebC-like                                      254.9    1.5e-73   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0040186    1/1       3   240 ..     1   244 []   287.1  5.2e-87
0040484    1/1       5   240 ..     1   243 []   282.1  1.3e-88
0041114    1/1      23   237 ..     1   220 []   254.9  1.5e-73

Alignments of top-scoring domains:
0040186: domain 1 of 1, from 3 to 240: score 287.1, E = 5.2e-87
                   *->GhskwanikhrkakqdakrgklftklakeitvAakeGgpdpelNprL
                      Ghskwa ikh+k+k+d++r+k+f+kl+kei vAak G+ dp++NprL
  AAZ21413.1     3    GHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRL 49   

                   rlaiekAkkanlPkdnIeraikkasggldgenleeiryegygpggvaliv
                   r ai++Ak+an+PkdnIerai+k+s + +++n+e++ryeg+gp+ +a+iv
  AAZ21413.1    50 RSAIQAAKSANMPKDNIERAIAKSSVN-SETNYENLRYEGFGPDKIAVIV 98   

                   ealTdnrnrtvadvraafsklggnlgesGsvsylFdrkGvivv..eglde
                   ealTdn+nrt+++vr++f k ggnlg++Gs+s++F+++G+i +++++++ 
  AAZ21413.1    99 EALTDNKNRTASNVRSIFVKSGGNLGTQGSASHNFNQLGIIKIdkKEISD 148  

                   dellelaleagaedvelledglievltdpedlsavkeaLeeaglevesae
                   ++++ela+e ga++  + +d+++e+ ++++++++vk+ Le+   ++ s+e
  AAZ21413.1   149 EQIFELAIESGADECIS-NDEFHEIQCPMSEIYNVKKNLEKTIANFISTE 197  

                   ltliPntlveldeedaekllklldaLedlddvqnvytnlelseelleel<
                   ++++P + v+++++++e+ l++l++Led+ddvq+vy+n+++++       
  AAZ21413.1   198 IEWVPLNSVDVEKDKVEAALEFLETLEDDDDVQSVYSNINFKN------  240  

                   -*
                     
  AAZ21413.1     -    -    

0040484: domain 1 of 1, from 5 to 240: score 282.1, E = 1.3e-88
                   *->skwanikhkkaaqdakrsklftklakeItvAakegggdpelNprLrl
                      skwa ikh k+++d++rsk+f+kl+keI vAak g+ dp++NprLr 
  AAZ21413.1     5    SKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRS 51   

                   aiekAkkanlPkdnIeraikkasggldgenleeiryegygpggvalivea
                   ai++Ak+an+PkdnIerai+k+s + +++n+e++ryeg+gp+ +a+ivea
  AAZ21413.1    52 AIQAAKSANMPKDNIERAIAKSSVN-SETNYENLRYEGFGPDKIAVIVEA 100  

                   lTdnrnrtvadvrsafsknggnlgesGsvsylFdrkGvivvekedldede
                   lTdn+nrt+++vrs+f k ggnlg++Gs+s++F+++G+i ++k++++ ++
  AAZ21413.1   101 LTDNKNRTASNVRSIFVKSGGNLGTQGSASHNFNQLGIIKIDKKEISDEQ 150  

                   lleaaleagaedveleeglievltdpedlgavkeaLeeagleiesaeltl
                   ++e+a+e ga++  + ++++e+ ++++++++vk+ Le+   ++ s+e+++
  AAZ21413.1   151 IFELAIESGADECISNDEFHEIQCPMSEIYNVKKNLEKTIANFISTEIEW 200  

                   iPntlvelsdeeqaekllklldaLedlddvqnvytnaelseelleeklftklakeitvAakeGgpdpelNprLrlaiekAkkanlPkdniera
                      k+f+kl+kei vAak G+ dp++NprLr ai++Ak+an+Pkdniera
  AAZ21413.1    23    KVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSANMPKDNIERA 69   

                   ikkasg.dgenleevryegygpggvalivealTdnrnrtaadvraafskn
                   i+k s ++++n+e++ryeg+gp+ +a+ivealTdn+nrta++vr++f k 
  AAZ21413.1    70 IAKSSVnSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKS 119  

                   gglnlgesgsvsylFdrkGvivvekkdleelgldedelleaaleagaedv
                   gg nlg++gs+s++F+++G+i ++kk     +++ ++++e+a+e ga++ 
  AAZ21413.1   120 GG-NLGTQGSASHNFNQLGIIKIDKK-----EISDEQIFELAIESGADEC 163  

                   eleegllevltepedlsavkeaLeeaglevesaellliPktlveldeeea
                   ++ ++++e+ ++++++++vk+ Le+   ++ s+e++++P + v+++++++
  AAZ21413.1   164 ISNDEFHEIQCPMSEIYNVKKNLEKTIANFISTEIEWVPLNSVDVEKDKV 213  

                   ekllklldaLedlddvqnvytnle