hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_22943.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAZ21432.1
Accession:      [none]
Description:    pubi0 dxs GIB00256CH01 "1-D-deoxyxylulose 5-phosphate synthase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0050394  Thiamin diphosphate-binding fold (THDP-bindi   264.0    4.1e-85   1
0049136  Thiamin diphosphate-binding fold (THDP-bindi   225.6      1e-75   1
0042762  Thiamin diphosphate-binding fold (THDP-bindi   247.0    1.7e-72   1
0040412  Thiamin diphosphate-binding fold (THDP-bindi   249.2    3.7e-72   1
0036596  Thiamin diphosphate-binding fold (THDP-bindi   233.2      4e-72   1
0039197  Thiamin diphosphate-binding fold (THDP-bindi   250.1    1.4e-71   1
0044101  Thiamin diphosphate-binding fold (THDP-bindi   230.2    1.4e-68   1
0042761  Thiamin diphosphate-binding fold (THDP-bindi   212.2    3.5e-66   1
0042965  Thiamin diphosphate-binding fold (THDP-bindi   206.2      2e-62   1
0039198  Thiamin diphosphate-binding fold (THDP-bindi   211.5      5e-62   1
0041402  Thiamin diphosphate-binding fold (THDP-bindi   200.0    2.6e-60   1
0044102  Thiamin diphosphate-binding fold (THDP-bindi   204.0    5.1e-60   1
0049135  Thiamin diphosphate-binding fold (THDP-bindi   200.0    6.4e-59   1
0041403  Thiamin diphosphate-binding fold (THDP-bindi   192.1    4.2e-58   1
0050395  Thiamin diphosphate-binding fold (THDP-bindi   193.5    4.5e-58   1
0039059  Thiamin diphosphate-binding fold (THDP-bindi   184.7    5.6e-56   1
0044440  Thiamin diphosphate-binding fold (THDP-bindi   191.2    2.5e-55   1
0044439  Thiamin diphosphate-binding fold (THDP-bindi   182.7    6.3e-55   1
0051963  Thiamin diphosphate-binding fold (THDP-bindi   190.3      5e-53   1
0049028  Thiamin diphosphate-binding fold (THDP-bindi   174.9    5.7e-53   1
0040413  Thiamin diphosphate-binding fold (THDP-bindi   143.3    6.2e-46   1
0051271  Thiamin diphosphate-binding fold (THDP-bindi   106.5    2.5e-34   1
0036598  TK C-terminal domain-like                      119.3    1.5e-33   1
0044441  TK C-terminal domain-like                      114.9    1.9e-32   1
0039060  TK C-terminal domain-like                      113.6    2.9e-32   1
0042966  TK C-terminal domain-like                      113.0    5.3e-32   1
0041404  TK C-terminal domain-like                      110.5    2.2e-31   1
0050396  TK C-terminal domain-like                      108.7      1e-30   1
0042488  Thiamin diphosphate-binding fold (THDP-bindi    96.7      4e-29   1
0042045  Thiamin diphosphate-binding fold (THDP-bindi    87.5    1.1e-25   1
0048897  Thiamin diphosphate-binding fold (THDP-bindi    88.9    8.4e-25   1
0045130  Thiamin diphosphate-binding fold (THDP-bindi    78.9    4.2e-24   1
0039199  TK C-terminal domain-like                       75.9    2.5e-23   1
0042763  TK C-terminal domain-like                       78.4    6.3e-22   1
0052104  Thiamin diphosphate-binding fold (THDP-bindi    78.0    1.3e-21   1
0044103  TK C-terminal domain-like                       62.7    6.8e-19   1
0049968  Thiamin diphosphate-binding fold (THDP-bindi    64.9    1.5e-18   1
0040414  TK C-terminal domain-like                       61.6    7.7e-18   1
0041167  Thiamin diphosphate-binding fold (THDP-bindi    67.0      8e-18   1
0042102  Thiamin diphosphate-binding fold (THDP-bindi    53.8    7.4e-16   1
0045858  Thiamin diphosphate-binding fold (THDP-bindi    52.7    1.4e-15   1
0049137  TK C-terminal domain-like                       53.3    6.1e-15   1
0035298  TK C-terminal domain-like                       32.4    7.8e-09   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0050394    1/1       1   380 [.     1   365 []   264.0  4.1e-85
0040412    1/1       3   350 ..     1   415 []   249.2  3.7e-72
0049028    1/1      13   368 ..     1   407 []   174.9  5.7e-53
0039197    1/1      18   362 ..     1   338 []   250.1  1.4e-71
0044101    1/1      19   349 ..     1   335 []   230.2  1.4e-68
0042762    1/1      22   365 ..     1   331 []   247.0  1.7e-72
0049136    1/1      22   374 ..     1   336 []   225.6    1e-75
0036596    1/1      26   369 ..     1   394 []   233.2    4e-72
0048897    1/1      39   282 ..     1   183 []    88.9  8.4e-25
0044439    1/1      41   346 ..     1   362 []   182.7  6.3e-55
0052104    1/1      41   288 ..     1   183 []    78.0  1.3e-21
0049968    1/1      43   296 ..     1   198 []    64.9  1.5e-18
0042102    1/1      46   298 ..     1   192 []    53.8  7.4e-16
0042488    1/1      46   297 ..     1   196 []    96.7    4e-29
0045130    1/1      48   308 ..     1   204 []    78.9  4.2e-24
0051271    1/1      49   303 ..     1   208 []   106.5  2.5e-34
0041402    1/1      51   349 ..     1   362 []   200.0  2.6e-60
0041167    1/1      66   303 ..     1   227 []    67.0    8e-18
0042045    1/1      71   302 ..     1   196 []    87.5  1.1e-25
0045858    1/1      94   281 ..     1   284 [.    52.7  1.4e-15
0042761    1/1     289   484 ..     1   195 []   212.2  3.5e-66
0039198    1/1     293   479 ..     1   192 []   211.5    5e-62
0044102    1/1     293   479 ..     1   197 []   204.0  5.1e-60
0040413    1/1     296   484 ..     1   230 []   143.3  6.2e-46
0051963    1/1     299   478 ..     1   203 []   190.3    5e-53
0049135    1/1     305   479 ..     1   190 []   200.0  6.4e-59
0039059    1/1     311   490 ..     1   191 []   184.7  5.6e-56
0042965    1/1     314   505 ..     1   204 []   206.2    2e-62
0041403    1/1     315   496 ..     1   192 []   192.1  4.2e-58
0044440    1/1     316   490 ..     1   186 []   191.2  2.5e-55
0050395    1/1     316   496 ..     1   192 []   193.5  4.5e-58
0039199    1/1     481   625 ..     1   136 []    75.9  2.5e-23
0042763    1/1     484   626 ..     1   136 []    78.4  6.3e-22
0044103    1/1     485   626 ..     1   146 []    62.7  6.8e-19
0040414    1/1     486   626 ..     1   186 []    61.6  7.7e-18
0049137    1/1     487   626 ..     1   143 []    53.3  6.1e-15
0036598    1/1     489   626 ..     1   138 []   119.3  1.5e-33
0039060    1/1     489   626 ..     1   135 []   113.6  2.9e-32
0042966    1/1     489   626 ..     1   134 []   113.0  5.3e-32
0044441    1/1     489   626 ..     1   137 []   114.9  1.9e-32
0041404    1/1     491   626 ..     1   138 []   110.5  2.2e-31
0050396    1/1     495   626 ..     1   132 []   108.7    1e-30
0035298    1/1     499   579 ..     1    88 [.    32.4  7.8e-09

Alignments of top-scoring domains:
0050394: domain 1 of 1, from 1 to 380: score 264.0, E = 4.1e-85
                   *->reildllektycgsigvelmhildllgriwlpedleklskeellely
                                         m+ +++l+ i++p+dl+kls ++l e+ 
  AAZ21432.1     1    -------------------MQNYKFLKDINFPSDLRKLSENDLQEV- 27   

                   rlmllareleellldlvrqgkighlgsslGqealavllaaalr.prdriv
                        ++e+++ ++d+v + ++ghlg +lG+++l+v+l++++++p+dr++
  AAZ21432.1    28 -----SNEVRKEMIDAV-SETGGHLGAGLGVVELTVALHYVFDtPNDRLI 71   

                   l..gHrghllylllgl.dllkifrelggksgghpvsehlgvlfntghlgt
                   +++gH+ +++++l+g+++ +k++r+ +g+sg+ ++se+ +++f+ +h +t
  AAZ21432.1    72 WdvGHQTYPHKILTGRkSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSST 121  

                   glpvAvGmAlAlkllgkdvvvvaliGDGalseGvvhEAlnlAgllklpvl
                   +++ A+GmA A kl +k + ++a+iGDGa+s G+++EA+n Ag  k  ++
  AAZ21432.1   122 SISSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMI 171  

                   fvvedNgigistpvgrsrssedladr........................
                   ++++dN+++i  pvg++   ++la++ + +++    ++ + ++ +  +  
  AAZ21432.1   172 VILNDNDMSIAKPVGAM--RTYLAKLltgkiyfslretfklivsafskrf 219  

                   ....................aeafgipvi.rVdGhdveavyaalkeakey
                    +++ ++++    +++  + + ++g+ ++ ++dGhd+  ++  lk a++ 
  AAZ21432.1   220 svkagkaedflrsavtggtlFNSLGFYYVgPIDGHDLSTLIPILKNARDS 269  

                   aregggPvlieavtyrgkghseadddpskyhgkeeveiekk.........
                     +++gP++i+++t +gkg+s+a+  + +yhg+ ++++ ++++++  ++ 
  AAZ21432.1   270 --KHQGPIMIHIKTQKGKGYSYAEKASDHYHGVSKFNVVTGeqvksgtnl 317  

                   rdpierfakylleegllteeeleelleevaeeveeavaeaeampeptlle
                   + ++++fa++l+++               ae++ ++v +++amp +t+++
  AAZ21432.1   318 PAYTKVFANTLVKH---------------AERDSKVVGVTAAMPGGTGMD 352  

                   lfddvype..fdvgiaeqhavtlaaglAltpllntipspadllslsdlelldrlanairylaldmvlkanhvklg
                       +++l+ i++p dl++ls ++ l+++ n++r  ++d+v+++      
  AAZ21432.1     3    NYKFLKDINFPSDLRKLS-ENDLQEVSNEVRKEMIDAVSET------ 42   

                   lgGHpgsslgaaellavlfrvflrydpwlnrdrfvlskGHgspllYally
                    gGH+g+ lg++el+++l++vf     ++++dr+++++GH+    Y++++
  AAZ21432.1    43 -GGHLGAGLGVVELTVALHYVF-----DTPNDRLIWDVGHQT---YPHKI 83   

                   ltGrlseedLknfrqlsfgsglpghpepglmtpgvefttGslGqglsaAv
                   ltGr       ++++l++g+gl+g++++ + ++++ f+ ++ ++++s A+
  AAZ21432.1    84 LTGRK-----SKIKTLRQGNGLSGFTKRSE-SEYDPFGAAHSSTSISSAL 127  

                   GmAlalkylgarfnkdivdrrvyaliGDGeldeGvswealslaghlkldn
                   GmA a k+ ++        + ++a+iGDG+++ G+++ea+++ag  k  +
  AAZ21432.1   128 GMAEANKLSNK-------LNNIIAVIGDGAISAGMAYEAMNNAGASKT-K 169  

                   livilddNgisidgpvglalklledlekrfeaygwnvirviwgslwdall
                   +ivil+dN++si+ pvg    + ++l+k++++  +  +r           
  AAZ21432.1   170 MIVILNDNDMSIAKPVGA---MRTYLAKLLTGKIYFSLRE---------- 206  

                   agddlglllqlmaetldg.ayqllkalkgayvrellfeelgelkelvedl
                      +++l++  + + ++++a ++  +l++a++ ++lf+ lg         
  AAZ21432.1   207 ---TFKLIVSAFSKRFSVkAGKAEDFLRSAVTGGTLFNSLG--------- 244  

                   sdeliyllprdGhdleaiyaalkeakes.kgkPtlIiakTvkgkglplae
                      ++y++p+dGhdl  ++ +lk+a++s++ +P +I++kT kgkg+++ae
  AAZ21432.1   245 ---FYYVGPIDGHDLSTLIPILKNARDSkHQGPIMIHIKTQKGKGYSYAE 291  

                   gtanahgaplkldpeevkalrerlglplldfylpeelyayfgelseelke
                   +  + ++ + k+++ ++++++   +lp           ay+++++++l++
  AAZ21432.1   292 KASDHYHGVSKFNVVTGEQVKSGTNLP-----------AYTKVFANTLVK 330  

                   laeeweklvgalpaappglarelvpldlylglteadldrefdlggllglelltlreilallkktycg
                                                                     
  AAZ21432.1     -    ----------------------------------------------- -    

                   sigveymhildlegrwllerleslspeellellrlmlliralelrlvlla
                                            p +l++l +  l+   +e+r  ++ 
  AAZ21432.1    13 -------------------------PSDLRKLSENDLQEVSNEVRKEMID 37   

                   .gsgrgghllslagqeallvalalaln.pedpvigd..hRdrlvllghgs
                   ++s +gghl+  +g+++l+val++++++p+d +i+d+ h+ +++++++g+
  AAZ21432.1    38 aVSETGGHLGAGLGVVELTVALHYVFDtPNDRLIWDvgHQTYPHKILTGR 87   

                   pllyaflelrgkledlsggrdgsyhpghpelgvefttghlgtglpvAvGm
                     +  + +lr+     ++g++g+  ++++e++  f+ +h +t+++ A+Gm
  AAZ21432.1    88 --KSKIKTLRQ-----GNGLSGFTKRSESEYD-PFGAAHSSTSISSALGM 129  

                   alalkllgpdrvvvaviGDGalseGvvhEAlnlagllklpvlivvvdNgi
                   a a kl ++ + ++aviGDGa+s G+++EA+n+ag  k  ++++++dN++
  AAZ21432.1   130 AEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDM 179  

                   gistpvdlrssaye....................................
                   +i  pv+ ++ +y ++  + +++    ++ + ++ +  +   +++ ++++
  AAZ21432.1   180 SIAKPVG-AMRTYLaklltgkiyfslretfklivsafskrfsvkagkaed 228  

                   ......dlaarfeayGipvi.rvdGhDpeavyaalkeAleyarkgggPvl
                       +++   +f ++G+ ++ ++dGhD+  ++  lk+A++   k++gP++
  AAZ21432.1   229 flrsavTGGTLFNSLGFYYVgPIDGHDLSTLIPILKNARDS--KHQGPIM 276  

                   IeaktyrgkGhseadd.ptkyrgpeeveair.....krdpiplleevlie
                   I++kt +gkG+s a+ ++ +y+g+  ++ ++ +++++  ++p + +v+++
  AAZ21432.1   277 IHIKTQKGKGYSYAEKaSDHYHGVSKFNVVTgeqvkSGTNLPAYTKVFAN 326  

                   egvlteeelkeiekevraevee..avelaeelpellagllpdplelfedv
                     v  +e +++++  ++a+   + +  +a+++p++++++ ++        
  AAZ21432.1   327 TLVKHAERDSKVVGVTAAMPGGtgMDIFAKDFPKRMFDVGIA-------- 368  

                   yaelppvlleqleelkldllqlyrlanliRrlaldavslangGhpgsplgaagleavlvgvf
                      kl+   l+++ n++R  ++davs  +gGh+g+ lg+++l+++l++vf
  AAZ21432.1    18    KLSENDLQEVSNEVRKEMIDAVS-ETGGHLGAGLGVVELTVALHYVF 63   

                   laldpddpvwpnrdrfvlsvghgspllyallyltGrldlsledlktfrql
                            ++++dr++++vgh+    y++++ltGr     +++kt+rq 
  AAZ21432.1    64 ---------DTPNDRLIWDVGHQT---YPHKILTGR----KSKIKTLRQG 97   

                   gsglsghpergetpgvefttGplGqglpaAvGaAlaakllgalfnrplld
                   + glsg+ +r e++++ f++++ +++++ A+G+A a+kl ++        
  AAZ21432.1    98 N-GLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNK-------- 138  

                   lpdrvvvaliGDGalneGvslealnlAghlkldnlivivdnNgysidgpv
                      + ++a+iGDGa++ G+++ea+n+Ag+ k  ++ivi+++N++si+ pv
  AAZ21432.1   139 --LNNIIAVIGDGAISAGMAYEAMNNAGASKT-KMIVILNDNDMSIAKPV 185  

                   glql..ledlak......................................
                   g+++++l +l + +++    ++ + ++ +  +   +++ ++++    +++
  AAZ21432.1   186 GAMRtyLAKLLTgkiyfslretfklivsafskrfsvkagkaedflrsavt 235  

                   ...rfeayGwnvi.rvdGhsldveavyaalkeaker.gdgPtlieakTyk
                     ++f ++G+ ++ ++dGh  d+  ++ +lk+a++++++gP++i++kT k
  AAZ21432.1   236 ggtLFNSLGFYYVgPIDGH--DLSTLIPILKNARDSkHQGPIMIHIKTQK 283  

                   gkghppae.gttkaHgvylgkeevealrkrlglptgeflvpdpilrlyky
                   gkg+++ae+++ ++Hgv             +++ tge++++   l++y++
  AAZ21432.1   284 GKGYSYAEkASDHYHGVSK-----------FNVVTGEQVKSGTNLPAYTK 322  

                   lleeglleeaeldellaaltaavpeava...faeelpepyedllelyrlalliRrlaldavslangGhlglylglaelaaalfavlr
                      ++   l+++ +++R  ++davs  +gGhlg+ lg++el++al++v++
  AAZ21432.1    19    LSENDLQEVSNEVRKEMIDAVSE-TGGHLGAGLGVVELTVALHYVFD 64   

                   ydpdnilwtyrdrfvlsaGhgspllyallyltGrdlsledlktfrqlgsg
                   +++d++        ++++Gh++   y++++ltGr    +++kt+rq +++
  AAZ21432.1    65 TPNDRL--------IWDVGHQT---YPHKILTGR---KSKIKTLRQGNGL 100  

                   lpghpepetpgvefttGplGqglsaAvGaAlalkllgalfnrglldlpdr
                   +++ +++e++++ f++++ ++++s A+G+A a+kl ++           +
  AAZ21432.1   101 SGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNK----------LN 140  

                   vvvafiGDGalseGvshealnlaghlklgnlifildnNgysisgpvglas
                    ++a+iGDGa+s G+++ea+n+ag+ k  ++i+il++N++si+ pvg+++
  AAZ21432.1   141 NIIAVIGDGAISAGMAYEAMNNAGASKT-KMIVILNDNDMSIAKPVGAMR 189  

                   ..ledlak.........................................r
                   ++l +l + +++    ++ + ++ +  +   +++ ++++    +++  ++
  AAZ21432.1   190 tyLAKLLTgkiyfslretfklivsafskrfsvkagkaedflrsavtggtL 239  

                   feayGwnvirviwdGhdveavyaalkeaker.gggPtlIeakTykgkghs
                   f ++G+ ++++i dGhd+  ++ +lk+a++++++gP++I++kT kgkg+s
  AAZ21432.1   240 FNSLGFYYVGPI-DGHDLSTLIPILKNARDSkHQGPIMIHIKTQKGKGYS 288  

                   ..leddakaHgvylgkeevealrkrlglppedlflvpddpiarlraylle
                   +++  ++++Hgv  +                       ++++  +     
  AAZ21432.1   289 yaEKASDHYHGVSKF-----------------------NVVTGEQVKSGT 315  

                   egllteeelgellaelaeevpeavaiaeamplpdeelyrlalliRrlaldavelangGhlggslgaaelfvalyagfeavn
                       +l+++ +++R  ++dav+ + gGhlg+ lg++el+val+++f    
  AAZ21432.1    22    NDLQEVSNEVRKEMIDAVSET-GGHLGAGLGVVELTVALHYVF---- 63   

                   vgapaalnrddfvlsvghgspllyahllltGrdlsaellgnfrqlgsglp
                        ++++d+++++vgh+    y+h++ltGr    + ++++rq + gl+
  AAZ21432.1    64 -----DTPNDRLIWDVGHQT---YPHKILTGR---KSKIKTLRQGN-GLS 101  

                   ghphrgetpgvefttgplGqglslAvGmAlaakllgalfnrplldlvdrv
                   g+ +r+e++++ f+ ++ ++++s A+GmA a kl ++           + 
  AAZ21432.1   102 GFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNK----------LNN 141  

                   vvafiGDGalseGvfhEalnlAgvlkldnlifvvdnNgysisgpvggqt.
                   ++a+iGDGa+s G+++Ea+n+Ag+ k  ++i+++++N++si+ pvg++ +
  AAZ21432.1   142 IIAVIGDGAISAGMAYEAMNNAGASKT-KMIVILNDNDMSIAKPVGAMRt 190  

                   .ledlaa.........................................rf
                   +l++l   +++    ++ + ++ +  +   +++ ++++    +++  ++f
  AAZ21432.1   191 yLAKLLTgkiyfslretfklivsafskrfsvkagkaedflrsavtggtLF 240  

                   eayGwnvirvvdGhDvlavyaalkeaker.gggPtlIeakTykgkglpla
                    ++G+ +++++dGhD+  ++  lk+a++++++gP++I++kT kgkg+++a
  AAZ21432.1   241 NSLGFYYVGPIDGHDLSTLIPILKNARDSkHQGPIMIHIKTQKGKGYSYA 290  

                   e.gtlkaHgv.pldpeeyralkevlgwplepdpiprlrkyllelgllgee
                   e+ + ++Hgv ++++ +++++k   +    p ++++++++l++       
  AAZ21432.1   291 EkASDHYHGVsKFNVVTGEQVKSGTN---LPAYTKVFANTLVK------- 330  

                   elaeldeelvaivaaape......faeelplplldeLlelyrlalliRrlaldavklangGhlgsflglaellvalyrgfeav
                        +l+++ +++R  ++dav+ + gGhlg+ lg++el+val+++f   
  AAZ21432.1    22    -NDLQEVSNEVRKEMIDAVSET-GGHLGAGLGVVELTVALHYVF--- 63   

                   dvgspaaldrddfvlsvGHgsyrlyalllltGrdlsleellgfrqlggls
                     ++p    +d+++++vGH++   y++++ltGr+   + ++++rq +gls
  AAZ21432.1    64 --DTP----NDRLIWDVGHQT---YPHKILTGRK---SKIKTLRQGNGLS 101  

                   gghpesghtpgvefttgplGtglpvAvGaAlalkllgelfnrglldlvdr
                    g+ ++ ++ ++ f+ ++ +t+++ A+G+A a+kl ++           +
  AAZ21432.1   102 -GFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNK----------LN 140  

                   vvvaliGDGalseGvvweAlnlagllklpnlifivdnNgysisgpvsral
                    ++a+iGDGa+s G+++eA+n ag+ k+  +i+i+++N++si+ pv+ a+
  AAZ21432.1   141 NIIAVIGDGAISAGMAYEAMNNAGASKTK-MIVILNDNDMSIAKPVG-AM 188  

                   sedladr...........................................
                    ++la++ + +++    ++ + ++ +  +   +++ ++++    +++  +
  AAZ21432.1   189 RTYLAKLltgkiyfslretfklivsafskrfsvkagkaedflrsavtggt 238  

                   .feayGwpvirvidGnlDveavyaalkealer.gggPvlieaktyrgkgh
                    f ++G+ ++++idG+ D+  ++  lk+a++ +++gP++i++kt +gkg+
  AAZ21432.1   239 lFNSLGFYYVGPIDGH-DLSTLIPILKNARDSkHQGPIMIHIKTQKGKGY 287  

                   s..eeddpkahrv.pldkeeiealrerdpllrlaeflipeglldeaeelk
                   s++e  + ++h+v ++++ + e++++  +l+  ++ ++++ l+++ae++ 
  AAZ21432.1   288 SyaEKASDHYHGVsKFNVVTGEQVKSGTNLP-AYTKVFANTLVKHAERDS 336  

                   eivaeaaaevee.aleaaeeplpdlaelledvyagalpalrrllidallkavsghpghllglagivevlfalhlvfdppnpdwls
                      ++  ++++ +++avs ++ghl+  +g+ve+++alh+vfd+pn d+l+
  AAZ21432.1    26    EVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPN-DRLI 71   

                   rdvllqlyrhmlltrrfeefltllqrqgkigrfvlsaGhealalyaalal
                   +dv++q y+h++lt+r  ++ tl+q +g++g+                  
  AAZ21432.1    72 WDVGHQTYPHKILTGRKSKIKTLRQGNGLSGF------------------ 103  

                   rgydvifptYRdhglllalgvdllkifrelggklpghpeggggsmhlgse
                                                        ++++        e
  AAZ21432.1   104 -------------------------------------TKRS--------E 108  

                   tpgvepttgplGtglpaAvGaAlAaklagpdrvvvaliGDGalseGmvhE
                   ++++ ++ ++ +t+++ A+G+A A kl ++ + ++a+iGDGa s Gm++E
  AAZ21432.1   109 SEYDPFGAAHSSTSISSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYE 158  

                   alnlagllklpvlfvvenNgyaistptglata..................
                   a+n ag+ k  +++++++N+++i+ p+g+++ + ++  + +++    ++ 
  AAZ21432.1   159 AMNNAGASKTKMIVILNDNDMSIAKPVGAMRTylaklltgkiyfslretf 208  

                   ........................sedlaaraeayGipgi.rVdGndvea
                   + ++ +  +   +++ ++++      +   ++ ++G+ ++ ++dG+d+  
  AAZ21432.1   209 klivsafskrfsvkagkaedflrsAVTGGTLFNSLGFYYVgPIDGHDLST 258  

                   lyaalkealerarsgggPvlIevvtyrgkghstad.dpskyhgkpevdee
                   l++ lk+a+++  +++gP++I+++t +gkg+s+a++ +++yhg+  ++++
  AAZ21432.1   259 LIPILKNARDS--KHQGPIMIHIKTQKGKGYSYAEkASDHYHGVSKFNVV 306  

                   rahrdpilrlrkylleeglldeeelfaieeevreeveeaveeaekapkps
                   +++                                     ++      p+
  AAZ21432.1   307 TGE-------------------------------------QVKSGTNLPA 319  

                   peelfddvyaelpellkeivailaalp.........egfperlfdvgiae
                   ++++f++++++++e + ++v+++aa+p  + +++ +++fp+r+fdvgiae
  AAZ21432.1   320 YTKVFANTLVKHAERDSKVVGVTAAMPggtgmdifaKDFPKRMFDVGIAE 369  

                   rpgllghlglglgpeavlvalaaalp.eddivvsdvgchqrwaarll
                        + +ghlg+glg+++++val++++++++d +++dvg hq +++++l
  AAZ21432.1    39    VSETGGHLGAGLGVVELTVALHYVFDtPNDRLIWDVG-HQTYPHKIL 84   

                   tgrgprtllnsg.lgsmGy..................glpaAlGaalaap
                   tgr+ +  ++++ +g  G+++  + +++   +++  ++++ AlG+a a++
  AAZ21432.1    85 TGRKSKIKTLRQgNGLSGFtkrseseydpfgaahsstSISSALGMAEANK 134  

                   ....drrvvaviGDGsf..lmgleelntaarynlpvvivvlnNggygitr
                     ++ + ++aviGDG++ ++m +e++n+a+  + ++++++++N+ ++i +
  AAZ21432.1   135 lsnkLNNIIAVIGDGAIsaGMAYEAMNNAGASKTKMIVILNDND-MSIAK 183  

                   glqeltggeglsgtdlpnpdfak...........................
                   ++  ++++   + t    +++ ++ + ++ +  +   +++ ++++    +
  AAZ21432.1   184 PVGAMRTYLAKLLTGKIYFSLREtfklivsafskrfsvkagkaedflrsa 233  

                   .....laeafGakgv.rvdgpd..eleealeeala..gdgpvlievltd<
                   ++  +l+ ++G+ +v ++dg+d   l+++l+ a++ +++gp++i+++t  
  AAZ21432.1   234 vtggtLFNSLGFYYVgPIDGHDlsTLIPILKNARDskHQGPIMIHIKTQ  282  

                   -*
                     
  AAZ21432.1     -    -    

0044439: domain 1 of 1, from 41 to 346: score 182.7, E = 6.3e-55
                   *->aysghlgaelgvvllt..lhlvfdpprpelsdeellqlyrhmlltrr
                       ++ghlga+lgvv+lt++lh+vfd+p+++l++++++q y+h++lt+r
  AAZ21432.1    41    ETGGHLGAGLGVVELTvaLHYVFDTPNDRLIWDVGHQTYPHKILTGR 87   

                   feefllllqrqgkrgffvlsaGhealavgaalalrggedvigmayRgrln
                     ++ +l+q +g+ gf+  s                              
  AAZ21432.1    88 KSKIKTLRQGNGLSGFTKRS------------------------------ 107  

                   vlalgvplleifaellgklpghpgggdvkmhlgseslgvlfntghlgtgl
                                                     es ++ f+ +h +t++
  AAZ21432.1   108 ----------------------------------ESEYDPFGAAHSSTSI 123  

                   pvAvGaAlAakllgkdrvvvaliGDGalseGvvhealnlaallglpvlfv
                   + A+G+A A kl +k + ++a+iGDGa+s G+++ea+n+a+  +  ++++
  AAZ21432.1   124 SSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVI 173  

                   vvNNqigistpvg.....................................
                   +++N+++i  pvg++ ++ ++  + +++    ++ + ++ +  +   +++
  AAZ21432.1   174 LNDNDMSIAKPVGamrtylaklltgkiyfslretfklivsafskrfsvka 223  

                   .....rqrstpdladraeafgipgi.rVdGnDveavyaalkeaverarag
                    ++++  rs+ +   ++ ++g+ ++ ++dG+D+  ++  lk a++   ++
  AAZ21432.1   224 gkaedFLRSAVTGGTLFNSLGFYYVgPIDGHDLSTLIPILKNARDS--KH 271  

                   ggPvlieavtyRgkghsead.dpskyrgkeeveiwkkkdpilrlrkylie
                   +gP++i+++t +gkg+s+a++ +  y+g+  ++++++             
  AAZ21432.1   272 QGPIMIHIKTQKGKGYSYAEkASDHYHGVSKFNVVTGE------------ 309  

                   egllseeeleelleevraeveeaveeaealpkpdleelfddvyaelapal
                                           ++      p ++ +f+++++++a+ +
  AAZ21432.1   310 ------------------------QVKSGTNLPAYTKVFANTLVKHAERD 335  

                   eeqvailaamltdggplspghvlralyelll...lpedaivvsdvgcsqrwgarllgf
                        gg+l++g  + +l  +l+++ +++++ +++dvg +q +++++l+ 
  AAZ21432.1    41    ETGGHLGAGLGVVELTVALHyvfDTPNDRLIWDVG-HQTYPHKILTG 86   

                   peprtflvsgglgimGy..................glpaAlGaala....
                   ++ +  +++ g+g  G+++  + +++   +++  ++++ AlG+a a++  
  AAZ21432.1    87 RKSKIKTLRQGNGLSGFtkrseseydpfgaahsstSISSALGMAEAnkls 136  

                   .pdrrvvaiiGDGsfqmgl.qe.lstaarlklpvlivvlnNggygitggq
                   ++ + ++a+iGDG+++ g+++e++++a+  k ++++++++N+ ++i +++
  AAZ21432.1   137 nKLNNIIAVIGDGAISAGMaYEaMNNAGASKTKMIVILNDND-MSIAKPV 185  

                   eraggrpsgtdlp..................................ppd
                    ++ ++++ +++++++    ++ + ++ +  +   +++ ++++     + 
  AAZ21432.1   186 GAMRTYLAKLLTGkiyfslretfklivsafskrfsvkagkaedflrsAVT 235  

                   faalaeafGapgv.rvdgpd..eleealeeala..gdgpvlievltdrgt
                      l+ ++G+ +v ++dg+d   l+++l+ a++ +++gp +i+++t +g+
  AAZ21432.1   236 GGTLFNSLGFYYVgPIDGHDlsTLIPILKNARDskHQGPIMIHIKTQKGK 285  

                   ghppprlcpglgpaavlralskalpelglledaivvsdvgcsqrwaaryl
                      +++l++glg+ ++  al+ ++++    +++ +++dvg +q + +++l
  AAZ21432.1    43    GGHLGAGLGVVELTVALHYVFDT----PNDRLIWDVG-HQTYPHKIL 84   

                   rfdkprtfltsgglgsmGy..................glpaAlGaalanp
                   + +k      + g+g  G+++  + +++   +++  ++++ AlG+a an+
  AAZ21432.1    85 TGRKSKIKTLRQGNGLSGFtkrseseydpfgaahsstSISSALGMAEANK 134  

                   ....drrvvaiiGDGsf..lmglqelataaryklpvlivvlnNgg.....
                     ++   ++a+iGDG++ ++m ++++++a+  k ++++++++N++ +++ 
  AAZ21432.1   135 lsnkLNNIIAVIGDGAIsaGMAYEAMNNAGASKTKMIVILNDNDMsiakp 184  

                   .ygitgqlqettaggrysttdllgn........................p
                   ++++ ++l +++ g+ y+ ++ + + ++ +  +   +++ ++++    ++
  AAZ21432.1   185 vGAMRTYLAKLLTGKIYFSLRETFKlivsafskrfsvkagkaedflrsaV 234  

                   dfaklaeafGakgv.rvd..dpeeleealkeal..asdgpvlievltdrg
                       l+ ++G+++v  +d +d++ l+++lk+a++ +++gp +i+++t +g
  AAZ21432.1   235 TGGTLFNSLGFYYVgPIDghDLSTLIPILKNARdsKHQGPIMIHIKTQKG 284  

                   ..ldplklrllllcpglgpqevlaalsealp.edaivvsdvGcsqlwaarylrlrg...
                      l++glg+ e++ al+ +++++++ +++dvG +q +++ +l+ r+ ++
  AAZ21432.1    46    LGAGLGVVELTVALHYVFDtPNDRLIWDVG-HQTYPHKILTGRKski 91   

                   ...............prtfltsgglgtmGyglpaAlGaalanp....drr
                   ++  + +     ++   + ++++g ++  ++++ AlG+a an+  ++   
  AAZ21432.1    92 ktlrqgnglsgftkrSESEYDPFGAAHSSTSISSALGMAEANKlsnkLNN 141  

                   vvaiiGDGs..flmglqelatavrynlpviivvlnNggygmtrgqqeltg
                   ++a+iGDG++ ++m  +++++a   + ++i+++ +N++  +     + t+
  AAZ21432.1   142 IIAVIGDGAisAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTY 191  

                   g................................grygtdlpnpdfaalae
                    ++  + +++    ++ + ++ +  +   +++ +    +   +    l+ 
  AAZ21432.1   192 LaklltgkiyfslretfklivsafskrfsvkagKAEDFLRSAVTGGTLFN 241  

                   afGakgv.rvd..dpeeleealkeala..adgpvlievlvdpgtgvlplv
                   ++G+++v  +d +d+  l+++lk+a++ +++gp +i++++ +g g+ +++
  AAZ21432.1   242 SLGFYYVgPIDghDLSTLIPILKNARDskHQGPIMIHIKTQKGKGYSYAE 291  

                   plgkkidlggplgpaevlralaellp.ddaivvtdvGtsqfwaarll.......
                      lg +lg++e++ al+++++++++++++dvG +q + +++l+  + ++
  AAZ21432.1    46    LGAGLGVVELTVALHYVFDtPNDRLIWDVG-HQTYPHKILtgrkski 91   

                   ...........lpk.prslltsgglgsmGyglpaAlGaalalkllgpdrr
                   ++  + +    ++k  +s ++++g ++  ++++ AlG+a a kl ++ + 
  AAZ21432.1    92 ktlrqgnglsgFTKrSESEYDPFGAAHSSTSISSALGMAEANKLSNKLNN 141  

                   vvalvGDGsf..gmtlqelataaryglpviivvlnNggygiirqlqelty
                   ++a++GDG++ +gm +++++ a+  + ++i+++++N+ ++i +++  + +
  AAZ21432.1   142 IIAVIGDGAIsaGMAYEAMNNAGASKTKMIVILNDND-MSIAKPVGAMRT 190  

                   ggrdlpnpdfak....................................la
                   +   l +  ++    ++ + ++ +  +   +++ ++++    +++  +l+
  AAZ21432.1   191 YLAKLLTGKIYFslretfklivsafskrfsvkagkaedflrsavtggtLF 240  

                   eafGakgvltvrvedveeleaalkealeragdgpvlievvtdrgegvspl
                    ++G+++v++++++d+  l++ lk+a++ +++gp +i+++t +g+g+s++
  AAZ21432.1   241 NSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYA 290  

                   edagkyhsplgpqevlralaellp.ddaivvtdvGssqfwarylr.........
                       +lg++e++ al+ +++++++ +++dvG +q +++++++  + ++++
  AAZ21432.1    48    AGLGVVELTVALHYVFDtPNDRLIWDVG-HQTYPHKILtgrkskikt 93   

                   ..........lprprrfltsgglgtmGyglpaAlGaalaap....drrvv
                     + +     ++r ++ ++++g+++  ++++ AlG+a a++  ++ + ++
  AAZ21432.1    94 lrqgnglsgfTKRSESEYDPFGAAHSSTSISSALGMAEANKlsnkLNNII 143  

                   aivGDGsf..qmglqelataaryklpviivvlnNng..............
                   a++GDG++ ++m ++++++a+  k ++i+++++N++ +++ + ++ ++ +
  AAZ21432.1   144 AVIGDGAIsaGMAYEAMNNAGASKTKMIVILNDNDMsiakpvgamrtyla 193  

                   .......ygiirglqel...fyndlpnpdfak.............laeaf
                   +  + ++y   r   +l++  +  + ++   k+++    +++  +l+ ++
  AAZ21432.1   194 klltgkiYFSLRETFKLivsAFSKRFSVKAGKaedflrsavtggtLFNSL 243  

                   Ganyvaridghkgvrvdtpdeleealkeala.ksdgpvlievvtdrgdgv
                   G+ yv++idgh      +   l+++lk+a++ k+ gp +i+++t +g g+
  AAZ21432.1   244 GFYYVGPIDGH------DLSTLIPILKNARDsKHQGPIMIHIKTQKGKGY 287  

                   lplvplgyrlkeevlellaedeplgpaevlralaealp.edaivvsdvGcsqrwaaryltlrrprtfl
                       +lg++e++ al+++++++++ +++dvG +q +++++lt+r+    +
  AAZ21432.1    49    -GLGVVELTVALHYVFDtPNDRLIWDVG-HQTYPHKILTGRKSKIKT 93   

                   lsgglgtmGy..................glpaAlGaalalp....drrvv
                   l++g+g+ G+++  + +++   +++  ++++ AlG+a a++  ++   ++
  AAZ21432.1    94 LRQGNGLSGFtkrseseydpfgaahsstSISSALGMAEANKlsnkLNNII 143  

                   aviGDGsf..lmgleelntaarynlpvlivvlnNgg......ygitgglq
                   aviGDG++ ++m++e++n+a+  + ++++++++N++ +++ ++++ ++l+
  AAZ21432.1   144 AVIGDGAIsaGMAYEAMNNAGASKTKMIVILNDNDMsiakpvGAMRTYLA 193  

                   slttgygysgttlptgllllgllpdfak.................laeaf
                   +l tg+ y++++    l++  + ++f  ++ ++++    +++  +l+ ++
  AAZ21432.1   194 KLLTGKIYFSLRETFKLIVSAFSKRFSVkagkaedflrsavtggtLFNSL 243  

                   Gapgv.rvdgpd..eleealeealaa..dgpvlievltdrgtgvlplepl
                   G+++v ++dg+d   l+++l++a++++++gp +i+++t +g+g++++e++
  AAZ21432.1   244 GFYYVgPIDGHDlsTLIPILKNARDSkhQGPIMIHIKTQKGKGYSYAEKA 293  

                   gkrlkelvlelklagvveltvelirvldldgllwlksgheglsldvllqlyrhmlltrrfe
                      gvveltv+l++v+d        ++ ++l++dv++q y h++lt+r  
  AAZ21432.1    51    GVVELTVALHYVFD--------TPNDRLIWDVGHQTYPHKILTGRKS 89   

                   efltllqpggkirgffilseGhealavglalalrgedvlgmayRgrlnvl
                   ++ tl+q +g++                                      
  AAZ21432.1    90 KIKTLRQGNGLS-------------------------------------- 101  

                   algvplkeilaellglrtglskgggvpmhlgspgllgntghlgtglpvAv
                                           g+  + +s++++++ +h +t+++ A+
  AAZ21432.1   102 ------------------------GFTKRSESEYDPFGAAHSSTSISSAL 127  

                   GaalAakllgkdrvvvaliGDGalseGvvhEalnlaalyklpvlfvvvnN
                   G+a A kl +k + ++a+iGDGa+s G+++Ea+n+a+  k  +++++++N
  AAZ21432.1   128 GMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDN 177  

                   qigistpverssay....................................
                   +++i  pv+++ +y ++  + +++    ++ + ++ +  +   +++ +++
  AAZ21432.1   178 DMSIAKPVGAMRTYlaklltgkiyfslretfklivsafskrfsvkagkae 227  

                   ........ptllaeafgipgi.rVdGndveavyaalkealeyarkgggPv
                   +    +++ + l+ ++g+ ++ ++dG+d+  ++  lk+a++   k++gP+
  AAZ21432.1   228 dflrsavtGGTLFNSLGFYYVgPIDGHDLSTLIPILKNARDS--KHQGPI 275  

                   lievvtyrgkghsead.dpskyrpveeyeeirkhrdpilrlakylieegl
                   +i+++t +gkg+s+a++ ++ y++v  ++++++                 
  AAZ21432.1   276 MIHIKTQKGKGYSYAEkASDHYHGVSKFNVVTG----------------- 308  

                   lteeeleeilkevreeveeaveeaekspkpdlsdlfddvyaelaellkei
                                        ++      p ++++f+++++++ae++ ++
  AAZ21432.1   309 --------------------EQVKSGTNLPAYTKVFANTLVKHAERDSKV 338  

                   vailaampegfplrpplldpglgpqyvlkalsealpelpddaivvsdvGcsqfwaary
                      p ++ ++d+g ++ y +k+l+++ ++     ++  ++G+s+f     
  AAZ21432.1    66    PNDRLIWDVG-HQTYPHKILTGRKSK---IKTLRQGNGLSGF----- 103  

                   lrlrrprsfltsgglgtmGyglpaAlGaalarp....drrvvaiiGDGs.
                     ++r  s ++++g+++  ++++ AlG+a a++  ++   ++a+iGDG++
  AAZ21432.1   104 --TKRSESEYDPFGAAHSSTSISSALGMAEANKlsnkLNNIIAVIGDGAi 151  

                   .flmglqelatavrynlpviivvlnNggygmtrgqqsltygggasgtdlp
                    ++m ++++++a+  + ++i+++ +N+        +s++ ++ga+ t+l+
  AAZ21432.1   152 sAGMAYEAMNNAGASKTKMIVILNDND--------MSIAKPVGAMRTYLA 193  

                   npdfak.......................................laeaf
                   ++   k++    ++ + ++ +  +   +++ ++++    +++  +l+ ++
  AAZ21432.1   194 KLLTGKiyfslretfklivsafskrfsvkagkaedflrsavtggtLFNSL 243  

                   Gakgvrv...edpeeleealkeala..adgpvlievltdpgegvlplvpl
                   G+++v +++ +d++ l+++lk a++ +++gp++i+++t +g+g+ +++++
  AAZ21432.1   244 GFYYVGPidgHDLSTLIPILKNARDskHQGPIMIHIKTQKGKGYSYAEKA 293  

                   gkaleevvlfveeldpiklllealeleglldgdpltpayvlkalsellpddaivvtdvglsqfwarylrfpgprtfl
                       +d+ ++ y +k+l+++  +  ++++++gls+f      +++ ++ +
  AAZ21432.1    71    IWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGF------TKRSESEY 111  

                   tsgglgtmGyglpaAlGaalanp....drrvvaivGDGsf..gmtlqela
                   +++g+++  ++++ AlG+a an+  ++   ++a++GDG++ +gm +++++
  AAZ21432.1   112 DPFGAAHSSTSISSALGMAEANKlsnkLNNIIAVIGDGAIsaGMAYEAMN 161  

                   taaryglpviivvlnNggygitrqqqsltyp...................
                   +a+  + ++i+++++N++ ++ ++  ++ty ++  + +++    ++ + +
  AAZ21432.1   162 NAGASKTKMIVILNDNDMSIAKPVGAMRTYLaklltgkiyfslretfkli 211  

                   ................gndlpnpdfaklaeafGakyvalgirvetpdele
                   + +  +   +++ ++++ +   +    l+ ++G++yv+ +i+ +++  l+
  AAZ21432.1   212 vsafskrfsvkagkaeDFLRSAVTGGTLFNSLGFYYVG-PIDGHDLSTLI 260  

                   ealkeal..aadgpvlievltdkgdgvpplvdlgklvaelikvkenlldlltvkgsqllqpllefsGacagcgetpylklltqlfgdrl
                                                                     
  AAZ21432.1     -    ----------------------------------------------- -    

                   lianatGcssiyggslpttpytlnadgrgPawanslfedaaefglghrlc
                                                                     
  AAZ21432.1     - -------------------------------------------------- -    

                   pgcgrfailrlllkalrelgldlllaelpgklvgvstgi.cssrlppyln
                                               +++  g+s g+++ s+  +  +
  AAZ21432.1    94 ----------------------------LRQGNGLS-GFtKRSESEYDPF 114  

                   sllg..tlhgralgvalglklagpdlvvvvigGDGdaydiG..fealnha
                   ++ +  t+++ alg+a + kl ++   +++++GDG+  + G+++ea+n+a
  AAZ21432.1   115 GAAHssTSISSALGMAEANKLSNKLNNIIAVIGDGAI-SAGmaYEAMNNA 163  

                   arrnlnvvvlvlDNevYgnTGgQyspstplgavtkttpa...........
                   ++++ +++v+++DN         +s++ p+ga  +  +   + +++    
  AAZ21432.1   164 GASKTKMIVILNDND--------MSIAKPVGAMRTYLAKlltgkiyfslr 205  

                   ..................Gkier....kkdlaalalayGapyVarvsdga
                   ++ + ++ +  +   +++Gk e+     ++ + l+ ++G+ yV+ + dg+
  AAZ21432.1   206 etfklivsafskrfsvkaGKAEDflrsAVTGGTLFNSLGFYYVGPI-DGH 254  

                   dvlqllkalkeAr..egkGpsliealtlaeelpeklhavlpflletgkkv.......atrkafgeaLlalakkl
                      +ae+  +++h+v +f+++tg++v+  ++  a++k+f ++L++ a+++
  AAZ21432.1   289    YAEKASDHYHGVSKFNVVTGEQVksgtnlpAYTKVFANTLVKHAERD 335  

                   prlvgisaDlagstltllkgllafaedfpgryidvGiaEqgmvaiaaGla
                   +++vg++a+++g+t     g+++fa+dfp+r++dvGiaEq++v++aaGla
  AAZ21432.1   336 SKVVGVTAAMPGGT-----GMDIFAKDFPKRMFDVGIAEQHAVTFAAGLA 380  

                   lhggliPfvatfstFlqraydqi.rlaalqnlpvilvgthaGiglgedGp
                   + +g++P+va++stFlqraydq+++++a+q lpv++++++aG+ +g+dG 
  AAZ21432.1   381 T-EGYKPYVAIYSTFLQRAYDQVvHDVAIQSLPVRFIIDRAGL-VGADGS 428  

                   tHqgiedlallraiPnltvlrPadavelaaalelalerldgpvylrlsrq
                   tH g +d+ +l+++Pn++v++P+d++el+ +  + +++ + p+++r++r+
  AAZ21432.1   429 THAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRG 478  

                   nlpvlelpeklhavlpfllatg.......kklatrkafgeaLlalaeldprlv
                        +++h+v +f ++tg++++  ++ +a++k+f+++L+++ae+d+++v
  AAZ21432.1   293    ASDHYHGVSKFNVVTGeqvksgtNLPAYTKVFANTLVKHAERDSKVV 339  

                   gisADlagstglllkgsvdlfakdfpgryidvGiaEqamvaiaaGlalhg
                   g++A+++g+tg+      d+fakdfp+r++dvGiaEq++v++aaGla++g
  AAZ21432.1   340 GVTAAMPGGTGM------DIFAKDFPKRMFDVGIAEQHAVTFAAGLATEG 383  

                   egliPfvatfltFldraydqi.rlvalqnlpvifvlthdGigvgedGpTH
                     ++P+va+++tFl+raydq++++va+q lpv+f+++++G+ vg+dG TH
  AAZ21432.1   384 --YKPYVAIYSTFLQRAYDQVvHDVAIQSLPVRFIIDRAGL-VGADGSTH 430  

                   qpiedlallraiPnltvlrPadavetaaalklalestdgpvalrlsRqnl
                    + +d+ +l ++Pn++v++P+d++e++ +  + ++  ++p+a+r++R+n 
  AAZ21432.1   431 AGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGN- 479  

                   pvllPdlwhavlpfdlatgkkv.......atrkafgkaLaalakldprlv
                        d++h+v +f+++tg++v+  ++  a++k+f ++L++ a++d+++v
  AAZ21432.1   293    ASDHYHGVSKFNVVTGEQVksgtnlpAYTKVFANTLVKHAERDSKVV 339  

                   gisaDltgstltllkllvdikgldlfaeafpgryidvgiaEqamvaiaaG
                   g++a+++g+t           g+d+fa++fp+r++dvgiaEq++v++aaG
  AAZ21432.1   340 GVTAAMPGGT-----------GMDIFAKDFPKRMFDVGIAEQHAVTFAAG 378  

                   lalhGgrliPfvatyltFldraydqi.rlaalqnlpvilvlthdgigvge
                   la++G  ++P+va+y+tFl+raydq+++++a+q lpv+++++++g+ vg+
  AAZ21432.1   379 LATEG--YKPYVAIYSTFLQRAYDQVvHDVAIQSLPVRFIIDRAGL-VGA 425  

                   dGpTHqgiedlallraipnltvyrPadanelaaalklalestdgpvalrl
                   dG TH g +d+++l+++pn++v++P+d++el+ +  + ++  ++p+a+r+
  AAZ21432.1   426 DGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRY 475  

                   srqnlpqlkllsvPalklfagill.sgereisttmafvralvelardkelgkriv
                      ++++v ++++++g +++sg +  ++t++f + lv+ a+++   +++v
  AAZ21432.1   296    HYHGVSKFNVVTGEQVkSGTNLPAYTKVFANTLVKHAERD---SKVV 339  

                   pivpdlarttgleglfrqlGiysplgqlytpedldlllvyredfpgqile
                   ++++++ ++tg++++                         ++dfp+++++
  AAZ21432.1   340 GVTAAMPGGTGMDIF-------------------------AKDFPKRMFD 364  

                   lGiaEagavaalaalatsyslhgegliPfyilYsmFgfrrlgdliwaaad
                   +GiaE++av+++a+lat      eg++P++++Ys+F++r+++++++++a 
  AAZ21432.1   365 VGIAEQHAVTFAAGLAT------EGYKPYVAIYSTFLQRAYDQVVHDVAI 408  

                   qqargfllgataGrttLngeGpqHqdghslllaraiPnlvvydPafayEl
                   q +++++++++aG+++   +G +H + +++++++++Pn +v++P++  El
  AAZ21432.1   409 QSLPVRFIIDRAGLVG--ADGSTHAGSFDITYLSTLPNFIVMAPSDEAEL 456  

                   avilkdglrrmyaedqedvpyyltllnenllqpalvlkfiletrlklleegkkidyreafglalaelleedprvvllgeDv
                       v kf + t+ +++++++ ++y+++f+++l++ +e+d +vv +++++
  AAZ21432.1   299    GVSKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAM 345  

                   grgtvlkvtaglfdkfgpdrvfdtpiaEqgivgfaaGlAlaGlrPvveiq
                   + gt++    ++f+k +p+r+fd++iaEq++v+faaGlA++G++P+v+i 
  AAZ21432.1   346 PGGTGM----DIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAI- 390  

                   fsdflnrAfdqiindvallryrsggeqkvpvvlallpaglgg.dgpthhs
                   +s+fl+rA+dq+++dva+        q++pv +++++agl+g+dg th +
  AAZ21432.1   391 YSTFLQRAYDQVVHDVAI--------QSLPVRFIIDRAGLVGaDGSTHAG 432  

                   asdeallrlipglkvvaPsdpadakgllraairdd.gPvvvrepkglyrl
                    +d+ +l ++p+ +v+aPsd+a+++ +  + +  +++P+++r+p+g    
  AAZ21432.1   433 SFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINnKPCAIRYPRG---- 478  

                   klevselelelllpllelgdklatrkafgeaLlalakldpelvggsaDlagstgl
                      + +  ++++  + +a++k+f+++L++ a++d+++vg++a+++g+tg+
  AAZ21432.1   305    VVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGM 351  

                   llkglglldlfakefpgrfidvGiaEqamvaiaaGlalhggliPfvatfl
                           d+fak+fp+r++dvGiaEq++v++aaGla+ +g++P+va+++
  AAZ21432.1   352 --------DIFAKDFPKRMFDVGIAEQHAVTFAAGLAT-EGYKPYVAIYS 392  

                   tFldraydqirld.AlqnlpvifvlthdgigvgedGpTHqpiedlallra
                   tFl+raydq+++d+A+q lpv+f+++++g+ vg+dG TH + +d+ +l +
  AAZ21432.1   393 TFLQRAYDQVVHDvAIQSLPVRFIIDRAGL-VGADGSTHAGSFDITYLST 441  

                   iPnltvlrPadavelaaalklalelldgPvalrlsRqnlpvldrelekgkkltyreafglalaelleedprvvllgedvgrgtglfrvtvg
                       ++ ++ + y+++f+++l++ +e+d++vv +++++++gtg+     +
  AAZ21432.1   311    VKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGM-----D 352  

                   lfakfgpdrvfdtgiaEqaivgfAaGlAlaglrPvveaqfsdflnrAfDq
                   +fak +p+r+fd+giaEq++v+fAaGlA++g++P+v a++s+fl+rA+Dq
  AAZ21432.1   353 IFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYV-AIYSTFLQRAYDQ 401  

                   iindvallryrsggklnvplvl.rlpgglvgedGptHss.sdlalfrhlP
                   +++dva+        +++p+ ++++++glvg+dG tH + +d+ ++ +lP
  AAZ21432.1   402 VVHDVAI--------QSLPVRFiIDRAGLVGADGSTHAGsFDITYLSTLP 443  

                   glkvvaPsdpaeakgllraairdd.gPvvirepkgllrlvlevselekgkkltyreafgealaelleedprvvllgedvgrgtglfrvtvglfa
                       ++ + y+++f+++l++++e+d +vv +++++++gtg+     ++fa
  AAZ21432.1   314    GTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGM-----DIFA 355  

                   kfgpdrvfdtpiaEqgivgfaaGlAlaglrPvveiqfsdflnrAfdqivn
                   k +p+r+fd++iaEq++v+faaGlA++g++P+v+i +s+fl+rA+dq+v+
  AAZ21432.1   356 KDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAI-YSTFLQRAYDQVVH 404  

                   dvallryrsggqqnlpvvlrlphggl.ggdGptHss.sdlalfrhlpglk
                   dva+        q+lpv+++++++gl+g+dG tH + +d+ ++  lp+++
  AAZ21432.1   405 DVAI--------QSLPVRFIIDRAGLvGADGSTHAGsFDITYLSTLPNFI 446  

                   vvaPsdpadakgllraair.ddgPvvirepkgllrlkeevpeeeyllpig
                   v+aPsd+a+++ +  + + + ++P++ir+p+g++ ++ e+p+ ++ ++ig
  AAZ21432.1   447 VMAPSDEAELVKMTNTSMTiNNKPCAIRYPRGNGIGV-ELPSIDENIEIG 495  

                   kaevlregkdgkkltyreafgealaelleedprvvvlgedvgrggglfrvtvglfak
                      ++ ++y+++f+++l++ +e+d++vv +++++++g+g+     ++fak
  AAZ21432.1   315    TNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGM-----DIFAK 356  

                   fgpdRvidtpiaEqgivgfAaGlAlaGlrPvveaqfsdflqrafdqivnd
                    +p+R++d++iaEq++v+fAaGlA++G++P+v a++s+flqra+dq+v+d
  AAZ21432.1   357 DFPKRMFDVGIAEQHAVTFAAGLATEGYKPYV-AIYSTFLQRAYDQVVHD 405  

                   aallryrsggklnvpvvfrlpg.gavggdGptHsg.edlallraipglkv
                   +a+        +++pv f+++++g+vg+dG tH g +d+ +l  +p+++v
  AAZ21432.1   406 VAI--------QSLPVRFIIDRaGLVGADGSTHAGsFDITYLSTLPNFIV 447  

                   vaPsdpaeakglllaair.ddgPviirepkglyr.vvlevpeedftigl<
                   +aPsd+ae++ +  +++ + ++P++ir+p+g++  v l+  +e ++ig+ 
  AAZ21432.1   448 MAPSDEAELVKMTNTSMTiNNKPCAIRYPRGNGIgVELPSIDENIEIGK  496  

                   -*
                     
  AAZ21432.1     -    -    

0044440: domain 1 of 1, from 316 to 490: score 191.2, E = 2.5e-55
                   *->kkltyreafgealaelleedprvvllgedvgrgtglfrvtvglfakf
                      + ++y+++f+++l++ +e+d++vv +++++++gtg+     ++fak 
  AAZ21432.1   316    NLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGM-----DIFAKD 357  

                   gpdrvfdtpiaEqaivgfaaGlAlaGlrPvveaqfsdflnrAfDqivndv
                   +p+r+fd++iaEq++v+faaGlA++G++P+v a++s+fl+rA+Dq+v+dv
  AAZ21432.1   358 FPKRMFDVGIAEQHAVTFAAGLATEGYKPYV-AIYSTFLQRAYDQVVHDV 406  

                   ailryrsggnlpvplvlrlpggvggdgpthhsledeallrlipglkvvaP
                   ai+       lpv+++++++g+vg+dg th + +d+ +l  +p+++v+aP
  AAZ21432.1   407 AIQ------SLPVRFIIDRAGLVGADGSTHAGSFDITYLSTLPNFIVMAP 450  

                   sdpadakgllraaird.dgPvvirepkgllrlvlevselekkltyreafgealaelleedprvvvlgedvgegggvfrvtkglfakf
                      + ++y+++f+++l++ +e+d++vv +++++++g+g+     ++fak 
  AAZ21432.1   316    NLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGM-----DIFAKD 357  

                   gpdRvfdtpiaEqgivglAaGlAlaGlrPvveiqfsdfllrAfdqivnda
                   +p+R+fd++iaEq++v++AaGlA++G++P+v+i +s+fl+rA+dq+v+d+
  AAZ21432.1   358 FPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAI-YSTFLQRAYDQVVHDV 406  

                   aklryrsggqqnlpvvirlprgg..gadgathhsqsdeallrhipglkvv
                   a+        q+lpv+++++r+g +gadg th + +d+++l ++p+++v+
  AAZ21432.1   407 AI--------QSLPVRFIIDRAGlvGADGSTHAGSFDITYLSTLPNFIVM 448  

                   aPsdpadakgllraaird.dgPvvfrepkglyrlvlevvpleeftiglekgevegvakgayilkaavlregadvtliatGsevelaleAaelLak
                         e+++++ +++i+k++v+ eg++v ++++G+ +e++  Aa++L++
  AAZ21432.1   481    IGVELPSIDENIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKN 527  

                   egisvrvvslpslkpldeqtieyklevlpktvrlvvvvEagvtlgwlgyv
                   +gi+ ++v++++ kpld+++i   l+ ++++  ++++vE+g++ g++ +v
  AAZ21432.1   528 KGIESTIVDARFAKPLDQELI---LKCAREHE-AMITVEEGSIGGFGSHV 573  

                   ............gleglvlgvdg.fgasgpadelleefgltaenivaavk
                   ++   ++ + ++gl+++++ ++++f++ ++++++++  gl+a +i ++++
  AAZ21432.1   574 enllsekgifdkGLKFRTMILPDiFIEQDSPKKMYDVAGLNASQISKKIL 623  

                   elevpeelegvakGayvlldaregadvtliatGsevelaleAaelLaae
                      e+p+ +e++++G+ +++   eg++v+++++G+ +e++  Aa +L+++
  AAZ21432.1   484    ELPSIDENIEIGKGRVI--QEGKQVCILSIGTRLEECKIAAAELKNK 528  

                   gikvrVvslpslkpfdeqtilysasvlpkktgrvvvveeavllgwlg...
                   gi+ ++v+ ++ kp+d+++il+ a    +++++ ++vee+++ g+  +++
  AAZ21432.1   529 GIESTIVDARFAKPLDQELILKCA----REHEAMITVEEGSIGGFGShve 574  

                   .........ylgapvlrvgidd.fgasapaeellelfgltaeniveavke
                   +   ++ +   g++++++ ++d+f++  +++ ++++ gl+a +i +++++
  AAZ21432.1   575 nllsekgifDKGLKFRTMILPDiFIEQDSPKKMYDVAGLNASQISKKILD 624  

                   llvpeeiegvpkGkyvlleregadvtlvAtGsevslAleAaelLakegi
                      +p+ +e++++Gk +++  eg++v+++++G+ ++++  Aa++L+++gi
  AAZ21432.1   485    LPSIDENIEIGKGRVI-QEGKQVCILSIGTRLEECKIAAAELKNKGI 530  

                   kvrVvslpslkpfdeq...........vvtyeesvlpgglglvvvealas
                   + ++v+ ++ kp+d++ + + + ++++ +t+ee+ + gg+g+ v   l++
  AAZ21432.1   531 ESTIVDARFAKPLDQElilkcareheaMITVEEGSI-GGFGSHVENLLSE 579  

                   agwdkyv...grvggidtfgasapadellklfgltaeniveavkellnkl
                    g+     + + ++++d+f++  +++++++  gl+a +i ++++++l   
  AAZ21432.1   580 KGIFDKGlkfRTMILPDIFIEQDSPKKMYDVAGLNASQISKKILDIL--- 626  

                   kedellelllealleegavegilkGaYvlreaegegpdvtLlasGsevrlaleAaelLak
                      ++ +  ++i+kG     ++ +eg++v +l+ G+ ++++  Aa  L++
  AAZ21432.1   486    PSIDENIEIGKG-----RVIQEGKQVCILSIGTRLEECKIAAAELKN 527  

                   eygidarVvsvpslklldrqglayeravllspekterlvtveellag..g
                   + gi++++v++++ k+ld++       +l  ++++e+++tvee+ +g  g
  AAZ21432.1   528 K-GIESTIVDARFAKPLDQEL------ILKCAREHEAMITVEEGSIGgfG 570  

                   pvvavtdaveavleqlwervpgldvvvlgtdgfGasdtreelrehfgvda
                   ++v   +  + + + ++++ ++     +  d f++ d+++++++ +g++a
  AAZ21432.1   571 SHVENLLSEKGIFDKGLKFRTM-----ILPDIFIEQDSPKKMYDVAGLNA 615  

                   eaivvaalklladegevdaevvaeaikkygldpdklnplllsslegvakGayvlldaegadvtlvatGsevslAleAaelL.eegikv
                      s +e++++G+ +++  eg +v +++ G+ ++++  Aa +L+++gi+ 
  AAZ21432.1   487    SIDENIEIGKGRVI-QEGKQVCILSIGTRLEECKIAAAELkNKGIES 532  

                   rVvsvpslepfdaqdeeyllsvlpagvpvvaveagvtlgwlgya......
                    +v++++ +p+d+   e++l+ ++++ ++++ve+g++ g+ +++++   +
  AAZ21432.1   533 TIVDARFAKPLDQ---ELILKCAREHEAMITVEEGSIGGFGSHVenllse 579  

                   ..........gavigidrFgasapadelyehfgltaeniveavlellkkl
                   + + ++  +   +i  d F +  +++++y+  gl+a +i +++l++l   
  AAZ21432.1   580 kgifdkglkfRTMILPDIFIEQDSPKKMYDVAGLNASQISKKILDIL--- 626  

                   kkkdllllgildddytlpigkaevlregadvtivayGsmvglaleaaellaeelgisaev
                      d+ ++igk++v++eg++v+i+++G+ +++++ aa++l+++ gi+ ++
  AAZ21432.1   489    DENIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNK-GIESTI 534  

                   idlrtlkPldeelilelvkktgrvvvveegsltgglgsevaallaeegfl
                   +d+r+ kPld elil+ +++++++++veegs +gg+gs+v +ll+e+g++
  AAZ21432.1   535 VDARFAKPLDQELILKCAREHEAMITVEEGS-IGGFGSHVENLLSEKGIF 583  

                   dldapvlrlglpdvfiphg....ledlygldaegiveavlellkfdytlpigkaevlregkdvtivayGsmvalaleAaeel...gisaevi
                      d+ ++igk++v++egk+v i+++G+ + ++  Aa+el+++gi+ +++
  AAZ21432.1   489    DENIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELknkGIESTIV 535  

                   dlrtlkPldeelilelvkktgrlvvveegaltgglgsevaallaeegfld
                   d+r+ kPld elil+ +++++++++veeg++ gg+gs+v +ll+e+g++d
  AAZ21432.1   536 DARFAKPLDQELILKCAREHEAMITVEEGSI-GGFGSHVENLLSEKGIFD 584  

                   ldapvlrlglpdvfipha...elldlygldaediveavlellgkdytlpigkaevlregkdvtivayGtmvalaleAaeel...gisaevi
                      d+ ++igk++v++egk+v+i+++Gt + +++ Aa+el+++gi+ +++
  AAZ21432.1   489    DENIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELknkGIESTIV 535  

                   dlrtlkPldeelilelvkktgrvvvveenaltgglgsevaellaeegfld
                   d+r+ kPld elil+ +++++++++vee++ +gg+gs+v +ll+e+g++d
  AAZ21432.1   536 DARFAKPLDQELILKCAREHEAMITVEEGS-IGGFGSHVENLLSEKGIFD 584  

                   ldapvlrlglpdvfiphg....leallgldaegiveavlellgkdytlpigkaevlregadvtlvayGsmvglaleAaelLaeegisvevi
                      d+ ++igk++v++eg++v+++++G+ +++++ Aa++L+++gi+ +++
  AAZ21432.1   489    DENIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIV 535  

                   dlrtlkPldeelilelvkktgrlvvveenvltgglgsevaellaeegfll
                   d+r+ kPld elil+ +++++++++vee+++ gg+gs+v  ll+e+g+++
  AAZ21432.1   536 DARFAKPLDQELILKCAREHEAMITVEEGSI-GGFGSHVENLLSEKGIFD 584  

                   ldapvlrlggpdvfiphg....ledlygldaegiveavkellgyllpigkaevlregadvtivayGsmvglaleAaellakeGisvevidl
                       ++igk++v++eg++v+i+++G+ +++++ Aa++l+++Gi+ +++d+
  AAZ21432.1   491    NIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDA 537  

                   rtlkPldeelilelvkktgrlvvveegvltgglgsevaaalaeegaflyl
                   r+ kPld elil+ +++++++++veeg++ gg+gs+v ++l+e g+f++ 
  AAZ21432.1   538 RFAKPLDQELILKCAREHEAMITVEEGSI-GGFGSHVENLLSEKGIFDK- 585  

                   lapvlrlggpdvfiphak..eledllgldaegiveavlellglGkaevlregadvtivayGsmvelaleAaeeleeegisaevidlrtlk
                      Gk++v++eg++v+i+++G+ +e++  Aa+el+++gi+ +++d+r+ k
  AAZ21432.1   495    GKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAK 541  

                   Pldeelilelvkktgrvvvveegvllgglgsevaallaeegflgldapvl
                   Pld elil+ +++++++++veeg++ gg+gs+v +ll+e+g+++ + +++
  AAZ21432.1   542 PLDQELILKCAREHEAMITVEEGSI-GGFGSHVENLLSEKGIFDKGLKFR 590  

                   rlglpdafiphg...ellelygldaegiveavkellgyglfeyygredadvvivamGstvgtaleavdllraeGikvgvldvrll
                           +  e++ v+i ++G+ ++ ++ a+ +l ++Gi+  ++d+r+ 
  AAZ21432.1   499    -----VIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFA 540  

                   rPfpeeallealpktvkkvvvlErnkeagglggplylevla