hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_22944.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAZ21514.1
Accession:      [none]
Description:    pubi0 ycaD GIB00256CH01 "transporter"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0042501  MFS general substrate transporter              137.5    1.4e-44   1
0042480  MFS general substrate transporter              136.3    2.5e-43   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0042501    1/1       1   394 [.     1   447 []   137.5  1.4e-44
0042480    1/1       6   388 ..     1   417 []   136.3  2.5e-43

Alignments of top-scoring domains:
0042501: domain 1 of 1, from 1 to 394: score 137.5, E = 1.4e-44
                   *->Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpa
                      M++  ++                    ++lflg  + +++++  g +
  AAZ21514.1     1    MNKVLKN-------------------SWALFLGIGFLMMAYGFQGSL 28   

                   lpll.edlglsaaqaglllsafflgyalgallaGplaDrfGrrrvlllgl
                   l + + + ++s ++ g+++s +f+gy++ga+ +  l+ ++G+ rv+++ +
  AAZ21514.1    29 LGVRaVQEQFSLTATGFMMSGYFVGYFIGAMTISNLISKVGHIRVFAAFA 78   

                   llfalgslllalaallgpslalllllrflqGlgagglfpaalallaewfp
                    l +l+ l+ ++      +++++++lr+l+G+++ +++++a ++l +  +
  AAZ21514.1    79 SLASLVILVHSIF----INPYVWFILRVLTGISMVCIYTVAESWLNDRSS 124  

                   pkergralglfgaggglGgalgpllggllleldlgWrwafliaailalll
                    k+rg +l+++++  + ++ +g++l  +      +++   l+++i +l+ 
  AAZ21514.1   125 NKNRGSILSIYMVILYGSMGIGMFLLNFSRP--ENYQPFILVSIITSLA- 171  

                   alllllllpesprflllkglseeerkvlerrlkadaeakaasplsllell
                   ++ +ll+ + +p f                        k+ + ++l+el 
  AAZ21514.1   172 LIPILLTKKKPPTF------------------------KKIQGMPLKELY 197  

                   rnprflllllayfllflgfyglltflplylqevlglsasqaglllalfgl
                      +  + ++ +++++++  +l+t+l++y+ + +++++ q++l+++l+++
  AAZ21514.1   198 E--TSPFGMVSALFYGTIQSALFTLLAVYAAS-MNFTIFQISLVTFLLAI 244  

                   ggilgsllagrlsdrlpegrrrrllliglllaalgllllall........
                    g+++++ +g+lsd++  + rr++++i++++a l+ ll++l+  +++   
  AAZ21514.1   245 SGAISQYPIGKLSDKY--D-RRKVIIISTFGASLFALLAILSsgqmylpg 291  

                   .pgtslallllllfllgfglggafpllfalvaelfppelrgtasgllnla
                   + +ts ++++++l+l+++++  +f+l+ a++ ++ p+e+  +a + ++++
  AAZ21514.1   292 eLATSKVWFFIFLILFSICSLPMFSLICAHTNDYIPKEKFVAAGAGIQFT 341  

                   gnlggallgpllagllldatgyaaaflllaalallalllllllrretkgr
                   ++lg++  gp+l +++++  g +++f++l ++ +l +++ ++ +r +  +
  AAZ21514.1   342 FGLGAMS-GPFLCSIFMNIVGSNGFFVFLLFFHALIGVFGIYRMRVRETV 390  

                   sleeieeeekMkekrrrvllllflgyflsgldfgligpllplilkdflglsaaqigl
                            ++ ++lflg  + ++++g+ g ll + + +  ++s +++g+
  AAZ21514.1     6    ------KNSWALFLGIGFLMMAYGFQGSLLGVRAVQ-EQFSLTATGF 45   

                   lfsayllgaalgsplaGrlsDrfGrrkvlllglllfalgslllafaptys
                   ++s y++g+++g++ +  l+ ++G+ +v+ + + l +l +l+ +++    
  AAZ21514.1    46 MMSGYFVGYFIGAMTISNLISKVGHIRVFAAFASLASLVILVHSIF---- 91   

                   tslwlllllrflqGlgagglfpaalaliaelfppeerglaleygllsagg
                    +++++++lr+l+G+++ +++++a +++ + ++ ++rg +l  ++++++ 
  AAZ21514.1    92 INPYVWFILRVLTGISMVCIYTVAESWLNDRSSNKNRGSIL--SIYMVIL 139  

                   slGallgpllggllldlgwrlvfliaailalllllllllflpesprflaa
                   + ++ +g++l  +    +++   l+++i +l+l + +ll+ + +p     
  AAZ21514.1   140 YGSMGIGMFLLNFSRPENYQPFILVSIITSLAL-IPILLTKKKPPT---- 184  

                   kgkleeekkaslklslkellknprllllllavfllflgfyalltylplyl
                           k+   ++lkel    +  + ++ +++++++ +al+t+l++y+
  AAZ21514.1   185 -------FKKIQGMPLKELY--ETSPFGMVSALFYGTIQSALFTLLAVYA 225  

                   qslfevlglsasqaglllalfglggilgsllagrlsdrlgrrrllligll
                        +++++  q++l+++l+++ g+++++ +g+lsd+++rr++++i+++
  AAZ21514.1   226 ----ASMNFTIFQISLVTFLLAISGAISQYPIGKLSDKYDRRKVIIISTF 271  

                   llalgllllal...........apslwllllllillgfgfglafpllfal
                   ++ l+ ll +l   +++   + a+s ++++++lil+ ++   +f+l+ a+
  AAZ21514.1   272 GASLFALLAILssgqmylpgelATSKVWFFIFLILFSICSLPMFSLICAH 321  

                   lselfppelrgtalgllnllagslggalgpllagllldalgysaafllla
                     +++p+e+  +a + ++++ ++lg++ gp+l ++++++ g +++f++l+
  AAZ21514.1   322 TNDYIPKEKFVAAGAGIQFT-FGLGAMSGPFLCSIFMNIVGSNGFFVFLL 370  

                   alallallllllllretkgrsleeieeeeee