hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_22950.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAZ22111.1
Accession:      [none]
Description:    pubi0 AAZ22111.1 GIB00256CH01 "GXGXG motif-containing protein"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0046500  Alpha subunit of glutamate synthase, C-termi   123.0    9.9e-38   1
0047995  Alpha subunit of glutamate synthase, C-termi   125.1    1.4e-36   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0047995    1/1      53   247 ..     1   227 [.   125.1  1.4e-36
0046500    1/1      54   247 ..     1   227 [.   123.0  9.9e-38

Alignments of top-scoring domains:
0047995: domain 1 of 1, from 53 to 247: score 125.1, E = 1.4e-36
                   *->eldldldgllddellelileaiedlelvllnlkilntdrfvgarlsg
                      + +ld+++++  e +++i +++ ++                 +++++
  AAZ22111.1    53    RTELDVKDMTAPEANKEIDNLMSQGFG--------------TIVIKN 85   

                   eiakrygaaglpgtititleGsaGqslGaflakgltltveGdandyvGkg
                   + +k+ +++g+ +++++++eGs G ++G+  ++g t++++G +++ ++ +
  AAZ22111.1    86 PQGKHSLGVGILNKLNLIFEGSLG-YFGMGSCDGPTVRINGRVGWSCAEN 134  

                   msgGkivvlgnagdllgaeenviiGnvvlygatgGklfvrGnAGerfgvr
                   ++ Gk+v+ +nag+ +ga            + +gG l+++G++G+r+g+ 
  AAZ22111.1   135 LMAGKVVIEKNAGSCFGA------------AIRGGDLICKGSVGARTGID 172  

                   nsgativveG.vgdhlceymtgGtvvvlGdtgrnfgagmtgGviyvldev
                   ++g+ti+v+G++g +++++m+ G++++lGd+g n+g++m++G+i++ +++
  AAZ22111.1   173 MKGGTIIVGGdAGAFTGFMMQRGRIIILGDVGINLGDSMYDGTIFIGGKI 222  

                   gsllprlnlelvvllrvldeedlellkelleldldldglldrellellleaiekgekvlllldivnvdravgallsge
                       +ld+++++  e ++++ +++ +g + +++++++++++++g+++   
  AAZ22111.1    54    TELDVKDMTAPEANKEIDNLMSQGFG-TIVIKNPQGKHSLGVGI--- 96   

                   iakrygriglpddtititveGsaGqslGaflakgltleveGdAndyvGkg
                               + +++++eGs G ++G+  ++g t++++G +++ ++++
  AAZ22111.1    97 -----------LNKLNLIFEGSLG-YFGMGSCDGPTVRINGRVGWSCAEN 134  

                   msgGkivvlgnagdsfvalgnvivGnvalygatgGklfvrGnAGerfgvr
                   ++ Gk+v+ +nag+             ++++ +gG l+++G++G+r+g+ 
  AAZ22111.1   135 LMAGKVVIEKNAGS------------CFGAAIRGGDLICKGSVGARTGID 172  

                   nsgativveG.vgdhlceymtgGtvvvlGdtgrnfgagmtgGviyvlgev
                   ++g+ti+v+G++g +++++m+ G++++lGd+g n+g++m++G+i++ g++
  AAZ22111.1   173 MKGGTIIVGGdAGAFTGFMMQRGRIIILGDVGINLGDSMYDGTIFIGGKI 222  

                   gsllprlnlelvvllrvldeedlallkelle