RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAZ21456.1 pubi0 mucA GIB00256CH01 "hypothetical protein"
         (131 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1ay9A [b.87.1] UMUD PROTEIN                                            86   6e-20
3bdnA [x.x.x] LAMBDA REPRESSOR                                         48   1e-08
1b12B [b.87.1] SIGNAL PEPTIDASE I                                      38   1e-05

>1ay9A [b.87.1] UMUD PROTEIN
          Length = 108

 Score = 86.0 bits (213), Expect = 6e-20
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 2/107 (1%)

Query: 22  DYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGDLLVIDRSLKPKNFSTVVANVH 81
           DY+E+ +DLN  LI++  AT+ ++  G SM D GI DGDLL++D ++   +   V+A V 
Sbjct: 1   DYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVD 60

Query: 82  DELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIWGVVTYVIH 128
            E  VK     +    L   +      I I  E  + ++GVV +V+ 
Sbjct: 61  GEFTVKKLQL-RPTVQLIPMNSAYSP-ITISSEDTLDVFGVVIHVVK 105


>3bdnA [x.x.x] LAMBDA REPRESSOR
          Length = 234

 Score = 48.1 bits (113), Expect = 1e-08
 Identities = 13/79 (16%), Positives = 22/79 (27%), Gaps = 6/79 (7%)

Query: 51  MTDVGIYDGDLLVIDRSLKPKNFSTVVA-NVHDELVVKSFVRSKDGQFLTSGSKNIEDKI 109
            +     DG L+++D     +     +A    DE   K  +R     FL   +       
Sbjct: 155 GSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRGSGQVFLQPLNPQYPMI- 213

Query: 110 IIGDESEVFIWGVVTYVIH 128
                    + G V     
Sbjct: 214 ----PESCSVVGKVIASQW 228


>1b12B [b.87.1] SIGNAL PEPTIDASE I
          Length = 211

 Score = 38.1 bits (87), Expect = 1e-05
 Identities = 11/87 (12%), Positives = 26/87 (29%), Gaps = 4/87 (4%)

Query: 42  FIIRVQGKSMTDVGIYDGDLLVIDRSLKPKNFSTVVANVHDE---LVVKSFVRSKDGQFL 98
              ++   SM    +  GD +++++   PK    VV    ++     +K  V     +  
Sbjct: 4   EPFQIPSGSMMP-TLLIGDFILVEKFGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVT 62

Query: 99  TSGSKNIEDKIIIGDESEVFIWGVVTY 125
                          E+ + +      
Sbjct: 63  YDPVSKELTIQPGCCENALPVTYSNVE 89


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.323    0.139    0.408 

Gapped
Lambda     K      H
   0.267   0.0576    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 26,161,329
Number of extensions: 1621236
Number of successful extensions: 17820
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 7065
Number of HSP's successfully gapped: 303
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)