RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAZ21667.1 pubi0 AAZ21667.1 GIB00256CH01 "arylesterase"
         (204 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1bwpA [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE               90   4e-21
3dt9A [x.x.x] BRAIN PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE         88   2e-20
1bwqA [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE               87   4e-20
1bwrA [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE               86   1e-19
3dc7A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323                 84   3e-19
3bzwA [x.x.x] PUTATIVE LIPASE                                          83   5e-19
3dt8A [x.x.x] BRAIN PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE         83   7e-19
3bzwF [x.x.x] PUTATIVE LIPASE                                          83   9e-19
3dciA [x.x.x] ARYLESTERASE                                             81   4e-18
3dc7B [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323                 80   5e-18
3bzwB [x.x.x] PUTATIVE LIPASE                                          79   9e-18
3dc7C [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323                 73   6e-16
1deoA [c.23.10] RHAMNOGALACTURONAN ACETYLESTERASE                      66   1e-13
3c1uA [x.x.x] RHAMNOGALACTURONAN ACETYLESTERASE                        65   1e-13

>1bwpA [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
          Length = 212

 Score = 90.4 bits (223), Expect = 4e-21
 Identities = 18/188 (9%), Positives = 56/188 (29%), Gaps = 20/188 (10%)

Query: 24  NVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWSLS 83
            V+  GDS +      +             +    L  ++  + G ++   L R+E    
Sbjct: 36  EVVFIGDSAVQLMHQCE----------IWRELFSPLHALNFGIGGDSTQHVLWRLENGEL 85

Query: 84  QPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPTTHGISYKK 143
           +     +++ +       G +  +    ++ I+Q    +  +  +  +            
Sbjct: 86  EHIRPKIVV-VWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPL 144

Query: 144 K------FDNIYPSLAQKYELNLIPF---LLEGVALKPELNQEDGMHPNEKGTIIISDTL 194
           +       + +  +LA     + +      +         +  D +H +  G   +   L
Sbjct: 145 REKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRAL 204

Query: 195 TKSIINFI 202
              ++  +
Sbjct: 205 HSLLLRLL 212


>3dt9A [x.x.x] BRAIN PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
          Length = 212

 Score = 88.0 bits (217), Expect = 2e-20
 Identities = 23/181 (12%), Positives = 62/181 (34%), Gaps = 22/181 (12%)

Query: 24  NVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWS-L 82
            V+  GDSL+      +             +    L  ++  + G ++   L R+E   L
Sbjct: 36  EVVFIGDSLVQLMHQSE----------IWRELFSPLHALNFGIGGDSTQHVLWRLENGEL 85

Query: 83  SQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKN--IEIILAGMIAPT---TH 137
                 ++++ +G N+   G +  +    ++ I+Q    +     +++ G++        
Sbjct: 86  EHIRPKIVVVWVGTNNH--GHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNP 143

Query: 138 GISYKKKFDNIYPSLAQKYE----LNLIPFLLEGVALKPELNQEDGMHPNEKGTIIISDT 193
                ++ + +  +    +     L+  P  +         +  D +H +  G   +   
Sbjct: 144 LREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRA 203

Query: 194 L 194
           L
Sbjct: 204 L 204


>1bwqA [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
          Length = 212

 Score = 87.0 bits (214), Expect = 4e-20
 Identities = 22/187 (11%), Positives = 58/187 (31%), Gaps = 18/187 (9%)

Query: 24  NVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWS-L 82
            V+  GDSL+      +             +    L  ++  + G ++   L R+E   L
Sbjct: 36  EVVFIGDSLVQLMHQCE----------IWRELFSPLHALNFGIGGDSTQHVLWRLENGEL 85

Query: 83  SQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPTTHGISYK 142
                 ++++ +G N+       +         +   +     +++ G++    H    +
Sbjct: 86  EHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLR 145

Query: 143 KKFDNIYPSLAQKYE-------LNLIPFLLEGVALKPELNQEDGMHPNEKGTIIISDTLT 195
           +K   +   +            L+  P  +         +  D  H +  G   +   L 
Sbjct: 146 EKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYAHLSRLGYTPVCRALH 205

Query: 196 KSIINFI 202
             ++  +
Sbjct: 206 SLLLRLL 212


>1bwrA [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
          Length = 212

 Score = 85.8 bits (211), Expect = 1e-19
 Identities = 21/187 (11%), Positives = 60/187 (32%), Gaps = 18/187 (9%)

Query: 24  NVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWSL- 82
            V+  GDSL+      +             +    L  ++  + G ++   L R+E    
Sbjct: 36  EVVFIGDSLVQLMHQCE----------IWRELFSPLHALNFGIGGDSTQHVLWRLENGEL 85

Query: 83  SQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPTTHGISYK 142
                 ++++ +G+N+       +         +   +     +++ G++    H    +
Sbjct: 86  EHIRPKIVVVWVGSNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLR 145

Query: 143 KKFDNIYPSL----AQKYELNLI---PFLLEGVALKPELNQEDGMHPNEKGTIIISDTLT 195
           +K   +   +    A     + +   P  +         +  D +H +  G   +   L 
Sbjct: 146 EKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALH 205

Query: 196 KSIINFI 202
             ++  +
Sbjct: 206 SLLLRLL 212


>3dc7A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323
          Length = 207

 Score = 84.3 bits (207), Expect = 3e-19
 Identities = 29/202 (14%), Positives = 55/202 (27%), Gaps = 27/202 (13%)

Query: 24  NVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRV-EWSL 82
                GDS+ A  GL    H   +L  + +         +  +SGST     +    +  
Sbjct: 6   RPAWLGDSITANNGLA-TVHYHDILAADWDV----ERSDNLGISGSTIGSRYDAAVRYQA 60

Query: 83  SQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAG----MIAPTTHG 138
              + D + +  G ND  R     +             L  ++          I+    G
Sbjct: 61  IPEDADFIAVFGGVNDYGRDQPLGQYGDCDTTFYGALLLTGLQTNWPTVPKLFISAIHIG 120

Query: 139 ISYKKKFDNIYPSLAQKYELN-----------------LIPFLLEGVALKPELNQEDGMH 181
             +   F  +   L  +                             +  +  +   D +H
Sbjct: 121 SDFGGSFSAVTNGLGYRQSDYEAAIAQTADYGVPHLSLYRDAGTFAIPAQAAIYSVDTLH 180

Query: 182 PNEKGTIIISDTLTKSIINFIK 203
           PN  G  +I+  L   + +   
Sbjct: 181 PNNAGHRVIARKLQSFLDSHFL 202


>3bzwA [x.x.x] PUTATIVE LIPASE
          Length = 240

 Score = 83.5 bits (205), Expect = 5e-19
 Identities = 25/231 (10%), Positives = 47/231 (20%), Gaps = 61/231 (26%)

Query: 25  VILFGDSLMAGYGL-PQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWSL- 82
           V   GDS+          K     L+  L  +          +SG        + E    
Sbjct: 11  VGYIGDSITDPNCYGDNIKKYWDFLKEWLGIT-----PFVYGISGRQWDDVPRQAEKLKK 65

Query: 83  SQPNIDLMILGLGANDMLRG------------------------------ISPIETEKNL 112
                   IL  G ND                                  ++       +
Sbjct: 66  EHGGEVDAILVFGTNDYNSSVPIGEWFTEQEEQVLSAHGEKKVTRKKRTPVTQDTYRGRI 125

Query: 113 EKIIQTAKLKNIEIILAGMIAPTTHGISYKK------------------KFDNIYPSLAQ 154
              I   K    +  +  +        ++                     +         
Sbjct: 126 NIGITQLKKLFPDKQIVLLTPLHRSLANFGDKNVQPDESYQNGCGEYIDAYVQAIKEAGN 185

Query: 155 KYELNLIPF------LLEGVALKPELNQEDGMHPNEKGTIIISDTLTKSII 199
            + + +I F       +E   +       D +HP+ KG            +
Sbjct: 186 IWGIPVIDFNAVTGNPVEEQLIYFYDAGYDRLHPDTKGQERARTLYQLLAL 236


>3dt8A [x.x.x] BRAIN PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
          Length = 211

 Score = 83.1 bits (204), Expect = 7e-19
 Identities = 19/187 (10%), Positives = 57/187 (30%), Gaps = 19/187 (10%)

Query: 24  NVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRV-EWSL 82
            V+  GD +   +     + L              L  ++  + G ++   L R+    L
Sbjct: 36  EVVFIGDLVQLMHQSEIWREL-----------FSPLHALNFGIGGDSTQHVLWRLENGEL 84

Query: 83  SQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPTTHGISYK 142
                 ++++ +G N+       +         +   +     +++ G++    H    +
Sbjct: 85  EHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLR 144

Query: 143 KKFDNIYPSL----AQKYELNLIP---FLLEGVALKPELNQEDGMHPNEKGTIIISDTLT 195
           +K   +   +    A     + +      +         +  D +H +  G   +   L 
Sbjct: 145 EKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALH 204

Query: 196 KSIINFI 202
             ++  +
Sbjct: 205 SLLLRLL 211


>3bzwF [x.x.x] PUTATIVE LIPASE
          Length = 235

 Score = 82.6 bits (203), Expect = 9e-19
 Identities = 26/229 (11%), Positives = 45/229 (19%), Gaps = 63/229 (27%)

Query: 25  VILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWSL-S 83
           V   GDS+         K     L+  L      +      +SG        + E     
Sbjct: 10  VGYIGDSITDPNN---IKKYWDFLKEWLG-----ITPFVYGISGRQWDDVPRQAEKLKKE 61

Query: 84  QPNIDLMILGLGANDMLRG------------------------------ISPIETEKNLE 113
                  IL  G ND                                  ++       + 
Sbjct: 62  HGGEVDAILVFGTNDYNSSVPIGEWFTEQEEQVLSAHGEKKVTRKKRTPVTQDTYRGRIN 121

Query: 114 KIIQTAKLKNIEIILAGMIAPTTHGI------------------SYKKKFDNIYPSLAQK 155
             I   K    +  +  +                           Y   +          
Sbjct: 122 IGITQLKKLFPDKQIVLLTPLHRSLANFGDKNVQPDESYQNGCGEYIDAYVQAIKEAGNI 181

Query: 156 YELNLIPF------LLEGVALKPELNQEDGMHPNEKGTIIISDTLTKSI 198
           + + +I F       +E   +       D +HP+ KG            
Sbjct: 182 WGIPVIDFNAVTGNPVEEQLIYFYDAGYDRLHPDTKGQERARTLYQLLA 230


>3dciA [x.x.x] ARYLESTERASE
          Length = 203

 Score = 80.6 bits (198), Expect = 4e-18
 Identities = 31/205 (15%), Positives = 58/205 (28%), Gaps = 39/205 (19%)

Query: 25  VILFGDSLMAGYGLPQEKH------LAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRV 78
           V+ FGDSL  G                 VL+  L        +    + G T+    +  
Sbjct: 3   VLAFGDSLTWGADPATGLRHPVEHRWPDVLEAELAG---KAKVHPEGLGGRTTCYDDHAG 59

Query: 79  EWSLSQPNI---------DLMILGLGANDMLRGI--------SPIETEKNLEKIIQTAKL 121
               +               +++ LG ND+            S     + +E  I   + 
Sbjct: 60  PACRNGARALEVALSCHPLDLVIILGTNDIKPVHGGRAEAAVSGRRLAQIVETFIYKPRE 119

Query: 122 KNIEIIL-------AGMIAPTTHGIS-YKKKFDNIYPSLAQKYELNLIPFLLEGVALKPE 173
              ++++       AG       G    + +   +Y  LA +   +              
Sbjct: 120 AVPKLLIVAPPPCVAGPGGEPAGGRDIEQSRLAPLYRKLAAELGHHFFDA-----GSVAS 174

Query: 174 LNQEDGMHPNEKGTIIISDTLTKSI 198
            +  DG+H +   T  I   L   +
Sbjct: 175 ASPVDGVHLDASATAAIGRALAAPV 199


>3dc7B [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323
          Length = 203

 Score = 80.1 bits (196), Expect = 5e-18
 Identities = 27/196 (13%), Positives = 52/196 (26%), Gaps = 27/196 (13%)

Query: 25  VILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWS-LS 83
               GDS+ A  GL    H   +L  + +         +  +SGST     +        
Sbjct: 7   PAWLGDSITANNGLA-TVHYHDILAADWDV----ERSDNLGISGSTIGSRYDAAVRYQAI 61

Query: 84  QPNIDLMILGLGANDMLRGISPIETEKNLEKIIQ-------TAKLKNIEIILAGMIAPTT 136
             + D + +  G ND  R     +                       +  +    I   +
Sbjct: 62  PEDADFIAVFGGVNDYGRDQPLGQYGDCDTTFYGALLLTGLQTNWPTVPKLFISAIHIGS 121

Query: 137 -HGISYKKKFDNIYPSLAQKYEL-------------NLIPFLLEGVALKPELNQEDGMHP 182
             G S+    + +    +                           +  +  +   D +HP
Sbjct: 122 DFGGSFSAVTNGLGYRQSDYEAAIAQTADYGVPHLSLYRDAGTFAIPAQAAIYSVDTLHP 181

Query: 183 NEKGTIIISDTLTKSI 198
           N  G  +I+  L   +
Sbjct: 182 NNAGHRVIARKLQSFL 197


>3bzwB [x.x.x] PUTATIVE LIPASE
          Length = 239

 Score = 79.3 bits (194), Expect = 9e-18
 Identities = 26/231 (11%), Positives = 46/231 (19%), Gaps = 61/231 (26%)

Query: 25  VILFGDSLMAGYGL-PQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWSL- 82
           V   GDS+          K     L+  L  +          +SG        + E    
Sbjct: 10  VGYIGDSITDPNCYGDNIKKYWDFLKEWLGIT-----PFVYGISGRQWDDVPRQAEKLKK 64

Query: 83  SQPNIDLMILGLGANDMLRG------------------------------ISPIETEKNL 112
                   IL  G ND                                  ++       +
Sbjct: 65  EHGGEVDAILVFGTNDYNSSVPIGEWFTEQEEQVLSAHGEKKVTRKKRTPVTQDTYRGRI 124

Query: 113 EKIIQTAKLKNIEIILAGMIAPTTHG------------------ISYKKKFDNIYPSLAQ 154
              I   K    +  +  +                           Y   +         
Sbjct: 125 NIGITQLKKLFPDKQIVLLTPLHRSLANFGDKNVQPDESYQNGCGEYIDAYVQAIKEAGN 184

Query: 155 KYELNLIPF------LLEGVALKPELNQEDGMHPNEKGTIIISDTLTKSII 199
            + + +I F       +E   +       D +HP+ KG            +
Sbjct: 185 IWGIPVIDFNAVTGNPVEEQLIYFYDAGYDRLHPDTKGQERARTLYQLLAL 235


>3dc7C [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323
          Length = 202

 Score = 73.2 bits (178), Expect = 6e-16
 Identities = 27/199 (13%), Positives = 57/199 (28%), Gaps = 27/199 (13%)

Query: 24  NVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWSL- 82
                GDS+ A  GL    H   +L  + +         +  +SGST     +       
Sbjct: 6   RPAWLGDSITANNGLA-TVHYHDILAADWDV----ERSDNLGISGSTIGSRYDAAVRYQA 60

Query: 83  SQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIE--------IILAGMIAP 134
              + D + +  G ND  R     +             L  ++        + ++ +   
Sbjct: 61  IPEDADFIAVFGGVNDYGRDQPLGQYGDCDTTFYGALLLTGLQTNWPTVPKLFISAIHIG 120

Query: 135 TTHGISYKKKFDNIYPSLAQKYEL-------------NLIPFLLEGVALKPELNQEDGMH 181
           +  G S+    + +    +                           +  +  +   D +H
Sbjct: 121 SDFGGSFSAVTNGLGYRQSDYEAAIAQTADYGVPHLSLYRDAGTFAIPAQAAIYSVDTLH 180

Query: 182 PNEKGTIIISDTLTKSIIN 200
           PN  G  +I+  L   + +
Sbjct: 181 PNNAGHRVIARKLQSFLDS 199


>1deoA [c.23.10] RHAMNOGALACTURONAN ACETYLESTERASE
          Length = 233

 Score = 65.8 bits (159), Expect = 1e-13
 Identities = 30/215 (13%), Positives = 61/215 (28%), Gaps = 46/215 (21%)

Query: 25  VILFGDSLMAGYGLPQEKH-LAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWS-- 81
           V L GDS MA  G     +     L + L+ +  +  +     +G ++        +   
Sbjct: 3   VYLAGDSTMAKNGGGSGTNGWGEYLASYLSATVVNDAV-----AGRSARSYTREGRFENI 57

Query: 82  -LSQPNIDLMILGLGANDMLRGIS-------------------------PIETEKNLEKI 115
                  D +I+  G ND     +                          +     LE  
Sbjct: 58  ADVVTAGDYVIVEFGHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGVNETILTFPAYLENA 117

Query: 116 IQTAKLKNIEIILAGM----IAPTTHGISYKKKFDNIYPSLAQKYELNLIPF-------- 163
            +    K  ++IL+         T   ++   +F       A+   +  +          
Sbjct: 118 AKLFTAKGAKVILSSQTPNNPWETGTFVNSPTRFVEYAELAAEVAGVEYVDHWSYVDSIY 177

Query: 164 LLEGVALKPELNQEDGMHPNEKGTIIISDTLTKSI 198
              G A        D  H +  G  ++++   K++
Sbjct: 178 ETLGNATVNSYFPIDHTHTSPAGAEVVAEAFLKAV 212


>3c1uA [x.x.x] RHAMNOGALACTURONAN ACETYLESTERASE
          Length = 231

 Score = 65.5 bits (158), Expect = 1e-13
 Identities = 29/212 (13%), Positives = 60/212 (28%), Gaps = 42/212 (19%)

Query: 25  VILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGSTSAGGLNRVEWS--- 81
           V L GDS MA  G     +           S     +++ +V+G ++        +    
Sbjct: 3   VYLAGDSTMAKNGGGSGTNG----WGEYLASYLSATVVNDAVAGRSARSYTREGRFENIA 58

Query: 82  LSQPNIDLMILGLGANDM-----------------------LRGISPIETEKNLEKIIQT 118
                 D +I+  G ND                            + +     LE   + 
Sbjct: 59  DVVTAGDYVIVEFGHNDGGSTDNGRTDCSGTGAEVCYSVYDGVNETILTFPAYLENAAKL 118

Query: 119 AKLKNIEIILAGM----IAPTTHGISYKKKFDNIYPSLAQKYELNLIPF--------LLE 166
              K  ++IL+         T   ++   +F       A+   +  +             
Sbjct: 119 FTAKGAKVILSSQTPNNPWETGTFVNSPTRFVEYAELAAEVAGVEYVDHWSYVDSIYETL 178

Query: 167 GVALKPELNQEDGMHPNEKGTIIISDTLTKSI 198
           G A        +  H +  G  ++++   K++
Sbjct: 179 GNATVNSYFPINHTHTSPAGAEVVAEAFLKAV 210


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0577    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 24,995,545
Number of extensions: 1484084
Number of successful extensions: 17640
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6968
Number of HSP's successfully gapped: 1007
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)