RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAZ20910.1 pubi0 ilvE GIB00256CH01 "branched-chain amino acid
aminotransferase"
         (293 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01063 Aminotran_4 "Aminotransferase class IV"                       117   3e-29

>PF01063 Aminotran_4 "Aminotransferase class IV"
          Length = 220

 Score =  117 bits (293), Expect = 3e-29
 Identities = 74/217 (34%), Positives = 117/217 (53%), Gaps = 7/217 (3%)

Query: 50  FKLEEHTSRLFYSAKRMGIKIPYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAIS 109
           ++L+EH  RL  SAKR+ +  P+ EEE+  A +++++   +  GY+RP + RG   + +S
Sbjct: 1   YRLDEHLERLLRSAKRLLLP-PFDEEELLEALRELLAANPLGSGYIRPLLSRGGGGLGVS 59

Query: 110 AQQTKIHVAIATWEWGSYFDPKLKIEGIKLNISNWRRPAPNTIPWDTKASGLYMICTLSK 169
                +        + +     +K+    L  S+ RR AP  +    K  G Y     ++
Sbjct: 60  PPAEALFTVSPVGSYAALGSKPVKL----LLSSDVRRAAPGGLLGGAKTGGRYANVLAAQ 115

Query: 170 HEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTP-IPDSFLDGITRRTVIEIAK 228
            EA+  GY + L+LD +G V E + +N+F   K+GE+ TP +    L GITR++++E+A+
Sbjct: 116 REAKAAGYDEVLLLDEDGYVTEGSISNLFIV-KDGELVTPPLSSGILPGITRQSLLELAR 174

Query: 229 SKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCI 265
             GI+V ER I   EL      FLT TAA VTPV  I
Sbjct: 175 DLGIEVEERDITVEELYEADEVFLTNTAAGVTPVGSI 211


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.315    0.132    0.378 

Gapped
Lambda     K      H
   0.267   0.0530    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 16,399,536
Number of extensions: 920902
Number of successful extensions: 124338
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2513
Number of HSP's successfully gapped: 216
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)