RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAZ21520.1 pubi0 acrB GIB00256CH01 "probable integral membrane
protein"
         (794 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF03176 MMPL "MMPL family"                                             50   3e-09
PF04437 RINT1_TIP1 "RINT-1 / TIP-1 family"                             34   2e-04
PF00873 ACR_tran "AcrB/AcrD/AcrF family"                               32   9e-04

>PF03176 MMPL "MMPL family"
          Length = 284

 Score = 50.4 bits (120), Expect = 3e-09
 Identities = 28/86 (32%), Positives = 48/86 (55%)

Query: 703 VDNSIHYIYRFKEEFLKIKDYNKTLKVCHSTVGVAILNTSITIVFGFSILVFSKFIPTIY 762
           VD +I  + R++EE     D  + ++    T G AI   ++T+  GF+ L+FS       
Sbjct: 186 VDYAIFLVSRYREELAAGGDREEAVRRALRTTGRAITFAALTVAIGFAALLFSPIPFLRQ 245

Query: 763 FGVFTGLAMLLAMISVLTLLPSLILI 788
            G+   + +LLA + VLTLLP+L+++
Sbjct: 246 LGLALAIGVLLAALVVLTLLPALLVL 271



 Score = 49.2 bits (117), Expect = 6e-09
 Identities = 50/210 (23%), Positives = 101/210 (48%), Gaps = 25/210 (11%)

Query: 153 VISEDGKTSGIIVYIKKDELKDIENKSAQEIEEYKDTLKKKNHENITQIREVIKTYGDVG 212
           ++S+DGK + I V +  D   D   ++A+ ++  +D            + E +   G   
Sbjct: 50  LVSKDGKAALITVTLDGDPGSD---EAAEAVDAIRDA-----------VAEALPPAGVT- 94

Query: 213 KIYLGGIPMITDDMMSFIKSDIIVFGLGVLLFIIATLWFIFRKLIWIIVPISSCFFSVLI 272
            +Y+ G   I  D+   I+ D+++  L  LL I+  L  +FR L+  ++P+ +   S+L 
Sbjct: 95  -VYVTGPAAIAADLNDAIEDDLLLAELIALLLILLLLLLVFRSLVAPLLPLLTVLLSLLA 153

Query: 273 MTGLLGLLGWKVTVISSNF---IALMLILTMAMN--IHMSTRFL-QLREDFPNLDNLKII 326
             GL+ +L   + +  S+F   +A +L+L + ++  I + +R+  +L       + ++  
Sbjct: 154 ALGLVLVLAGGLGIGLSSFTPVLAFVLLLGLGVDYAIFLVSRYREELAAGGDREEAVRRA 213

Query: 327 IMTTSKMFWPIIYTVLTTICAFLSLVFSGI 356
           + TT +    I +  LT    F +L+FS I
Sbjct: 214 LRTTGR---AITFAALTVAIGFAALLFSPI 240


>PF04437 RINT1_TIP1 "RINT-1 / TIP-1 family"
          Length = 480

 Score = 33.9 bits (77), Expect = 2e-04
 Identities = 36/160 (22%), Positives = 71/160 (44%), Gaps = 11/160 (6%)

Query: 44  LLIEGDPDLEYLKEVTERYGSKEFLILTYSPNEGMVTESSIN-----NLLSLKYK-IQSL 97
           L +E +  LE  KE+     + E       P++   T+S+I        ++ +Y+ + SL
Sbjct: 138 LQVEKEFALERFKEILNAEDAWEIDYDDVDPDDLKPTKSAIRVVDLLETITERYRPLPSL 197

Query: 98  DWVHSVITLLDIPLLNNSEAPLQERLESFKTLKD-----EGVDTERGFNEILNSPVFRNF 152
                 +  + +PLL+     L  RLE++++L       EGV       +ILNS  +   
Sbjct: 198 SQRLRFLIDIQLPLLDQFHERLVSRLEAYESLTSTQASLEGVAGLERLCKILNSANYLES 257

Query: 153 VISEDGKTSGIIVYIKKDELKDIENKSAQEIEEYKDTLKK 192
           V+ E  +    +     + L D+ ++++ E   + +T+ K
Sbjct: 258 VLEEWSEDVFFLQNESGNSLTDVASRTSSEGSIFDETISK 297


>PF00873 ACR_tran "AcrB/AcrD/AcrF family"
          Length = 1014

 Score = 32.0 bits (72), Expect = 9e-04
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 20/146 (13%)

Query: 222 ITDDMMSFIKSDI--IVFGLGVLLFIIATLWFIFRK------LIWIIVPISSC-FFSVLI 272
           +T D   FI++ I  +V  L   + ++  + F+F        ++ + +P+S    F+V+ 
Sbjct: 316 VTYDQSEFIRASINEVVKTLLEAILLVVLVLFLFLGNWRATLIVALAIPLSLLGTFAVMY 375

Query: 273 MTGL-LGLLGWKVTVISSNFIALMLILTMAMNIHMSTRFLQLREDFPNLDNLKIIIMTTS 331
           + G  L LL     +++   +    I+ +  NIH   R L+       L  L+  I    
Sbjct: 376 LFGFSLNLLSLFALILAIGILVDDAIVVVE-NIH---RHLE-----EGLSPLEAAIKAAK 426

Query: 332 KMFWPIIYTVLTTICAFLSLVF-SGI 356
           ++  P+I + LTTI  FL L F SGI
Sbjct: 427 EVGGPVIASTLTTIAVFLPLAFLSGI 452


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.327    0.141    0.420 

Gapped
Lambda     K      H
   0.267   0.0547    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 16,460,157
Number of extensions: 911966
Number of successful extensions: 133255
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2788
Number of HSP's successfully gapped: 225
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)