RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAZ21799.1 pubi0 AAZ21799.1 GIB00256CH01 "Protein of unknown
function (DUF502)"
         (204 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF04367 DUF502 "Protein of unknown function (DUF502)"                  89   5e-21

>PF04367 DUF502 "Protein of unknown function (DUF502)"
          Length = 108

 Score = 89.0 bits (220), Expect = 5e-21
 Identities = 48/99 (48%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 73  VVGGLSLTFIGKKFLQIIDDLFKRMPILRTIYSAIGQMTDSFRAQEGNK-KSVVLVEYPR 131
           +VG L+  F+G+  L + + L KR+P++R+IYS++ Q++++      N  K VVLVEYPR
Sbjct: 10  LVGLLASNFLGRSLLGLGERLLKRIPLVRSIYSSVKQISETLSGDSSNSFKKVVLVEYPR 69

Query: 132 KGSWAVGFATKENTGEIKAKININLVNVFVPTTPNPTSG 170
           KG +A+GF T    GE++A +   LV+VFVPTTPNPTSG
Sbjct: 70  KGVYAIGFVTGTVPGELQAGLGEELVSVFVPTTPNPTSG 108


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.315    0.135    0.369 

Gapped
Lambda     K      H
   0.267   0.0525    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 14,479,579
Number of extensions: 805155
Number of successful extensions: 112877
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2062
Number of HSP's successfully gapped: 300
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)