RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAZ22111.1 pubi0 AAZ22111.1 GIB00256CH01 "GXGXG
motif-containing protein"
         (284 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01493 GXGXG "GXGXG motif"                                            50   3e-09

>PF01493 GXGXG "GXGXG motif"
          Length = 195

 Score = 50.4 bits (120), Expect = 3e-09
 Identities = 37/113 (32%), Positives = 52/113 (46%), Gaps = 12/113 (10%)

Query: 111 FGMGSCDGPTVRINGRVGWSCAENLMAGKVVIEKNAGSCFGAAIRG------------GD 158
           FG     G T+ + G       + +  GK+V+  NAG    A + G            G 
Sbjct: 44  FGAFLAGGLTIEVEGDANDYVGKGMSGGKIVVRGNAGDGGKAEVNGIVGNTCLYGATGGK 103

Query: 159 LICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILGDVGINLGDSM 211
           L  +G+ G R G+   G TI+V G+AG   G  M  GR+++LGD G N G  M
Sbjct: 104 LFVRGNAGERFGVRNSGATIVVEGNAGDHGGEYMTGGRVVVLGDTGRNFGAGM 156



 Score = 48.1 bits (114), Expect = 2e-08
 Identities = 32/88 (36%), Positives = 44/88 (50%)

Query: 117 DGPTVRINGRVGWSCAENLMAGKVVIEKNAGSCFGAAIRGGDLICKGSVGARTGIDMKGG 176
           DG    +NG VG +C      GK+ +  NAG  FG    G  ++ +G+ G   G  M GG
Sbjct: 81  DGGKAEVNGIVGNTCLYGATGGKLFVRGNAGERFGVRNSGATIVVEGNAGDHGGEYMTGG 140

Query: 177 TIIVGGDAGAFTGFMMQRGRIIILGDVG 204
            ++V GD G   G  M  G I + G+VG
Sbjct: 141 RVVVLGDTGRNFGAGMSGGVIYVRGEVG 168


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.313    0.135    0.447 

Gapped
Lambda     K      H
   0.267   0.0516    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 18,095,643
Number of extensions: 1046076
Number of successful extensions: 133214
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2045
Number of HSP's successfully gapped: 218
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.4 bits)