RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAZ20908.1 pubi0 uvrC GIB00256CH01 "excinuclease ABC chain C"
         (611 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1xkpB1 [d.198.1.1] CHAPERONE PROTEIN SYCN B:2 -- 122                   93   3e-22
2p6rA2 [a.289.1.2] AFUHEL308 HELICASE A:489 -- 686                     76   5e-17
1oeyJ [d.15.2.2] NEUTROPHIL CYTOSOL FACTOR 4                           73   2e-16
2oceA1 [a.60.2.6] HYPOTHETICAL PROTEIN PA5201 A:474 -- 563             68   1e-14
2a1jB1 [a.60.2.5] DNA EXCISION REPAIR PROTEIN ERCC-1 B:219 -- 296      64   2e-13
1bqqT [b.40.3.1] METALLOPROTEINASE INHIBITOR 2                         62   6e-13
1z00B1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF B:823 -- 905             60   2e-12
1x2iA1 [a.60.2.5] HEF HELICASE/NUCLEASE A:2 -- 69                      57   2e-11
1kftA [a.60.2.3] EXCINUCLEASE ABC SUBUNIT C                            56   4e-11
1mu5A1 [a.156.1.3] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:229 ...    56   4e-11
2csbA4 [a.60.2.4] TOPOISOMERASE V A:465 -- 519                         56   4e-11
1ln0A [d.226.1.1] INTRON-ASSOCIATED ENDONUCLEASE 1                     56   4e-11
1bvsA2 [a.60.2.1] PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA) ...    54   1e-10
2a1jA1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF A:837 -- 898             54   2e-10
1c7yA2 [a.60.2.1] HOLLIDAY JUNCTION DNA HELICASE RUVA A:65 -- 150      52   5e-10
2duyA1 [a.60.2.7] COMPETENCE PROTEIN COMEA-RELATED PROTEIN A:11 ...    51   1e-09
1dgsA1 [a.60.2.2] DNA LIGASE A:401 -- 581                              46   4e-08
1u9lA [a.60.4.2] TRANSCRIPTION ELONGATION PROTEIN NUSA                 43   3e-07
2csbA3 [a.60.2.4] TOPOISOMERASE V A:410 -- 464                         42   6e-07
1pznA1 [a.60.4.1] DNA REPAIR AND RECOMBINATION PROTEIN RAD51 A:3...    42   7e-07
1bgxT1 [a.60.7.1] TAQ DNA POLYMERASE T:174 -- 289                      41   2e-06
1lb2B [a.60.3.1] DNA-DIRECTED RNA POLYMERASE ALPHA CHAIN               41   2e-06
2eduA1 [a.60.2.7] KINESIN-LIKE PROTEIN KIF22 A:8 -- 98                 40   3e-06
2bskA1 [g.83.1.1] MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCAS...    40   3e-06
2axtU1 [a.60.12.2] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN U:37 ...    38   1e-05
1exnA1 [a.60.7.1] 5'-EXONUCLEASE A:186 -- 290                          36   3e-05
2q0zX1 [a.289.1.1] PROTEIN PRO2281 X:33 -- 208                         36   3e-05
1qojA [a.2.9.1] UVRB                                                   35   9e-05

>1xkpB1 [d.198.1.1] CHAPERONE PROTEIN SYCN B:2 -- 122
          Length = 121

 Score = 93.0 bits (231), Expect = 3e-22
 Identities = 14/128 (10%), Positives = 32/128 (25%), Gaps = 21/128 (16%)

Query: 420 EGFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKG-- 477
           E  +    +   + T        + L ++   +     LE+         + +   +   
Sbjct: 4   EPIISHFCQDLGVPT----SSPLSPLIQLEMAQSGTLQLEQ-----HGATLTLWLARSLA 54

Query: 478 --QYSSAKEVLDEFGLH----DLPMIAIAKGKLRNSGDETFFYKGKS-FKFDKNDPTLFF 530
             +   A               LP+ A   G+ +      F    +              
Sbjct: 55  WHRCEDAMVXALTLTAAQXSGALPLRAGWLGESQL---VLFVSLDERSLTLPLLHQAFEQ 111

Query: 531 MQRLRDEA 538
           + RL+ E 
Sbjct: 112 LLRLQQEV 119


>2p6rA2 [a.289.1.2] AFUHEL308 HELICASE A:489 -- 686
          Length = 198

 Score = 75.6 bits (185), Expect = 5e-17
 Identities = 23/203 (11%), Positives = 52/203 (25%), Gaps = 14/203 (6%)

Query: 412 GAMITFGNEGFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLIL 471
           G +                 +  +    D   +         +         L+      
Sbjct: 5   GFIFHDVLSRMELSDIGALHLICR--TPDMERLTVRKTDSWVEEEAFRLRKELSYYPSDF 62

Query: 472 IDGGKGQYSSAKEVLDEFGLHDLPMIAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFM 531
                   S  K  L      +         K   +  +           +  +     M
Sbjct: 63  SVEYDWFLSEVKTALCLKDWIEEKDEDEICAKYGIAPGDLRRIV------ETAEWLSNAM 116

Query: 532 QRLRDEAHRFAITSHRAKRAKGITKSLLD--QIDGIGSIRKRALLNH-FGSARAVESASF 588
            R+ +E    +++    +   G+ + LL+  +I  IG +R R L N    +A  +     
Sbjct: 117 NRIAEEVGNTSVSGLTERIKHGVKEELLELVRIRHIGRVRARKLYNAGIRNAEDIVRHR- 175

Query: 589 DEIKSVEGVEEKVAKKIYNFFHE 611
              K    +   +A+++      
Sbjct: 176 --EKVASLIGRGIAERVVEGISV 196


>1oeyJ [d.15.2.2] NEUTROPHIL CYTOSOL FACTOR 4
          Length = 105

 Score = 73.4 bits (180), Expect = 2e-16
 Identities = 6/95 (6%), Positives = 27/95 (28%), Gaps = 5/95 (5%)

Query: 212 KNLSKQMEEASEKLDFERASIFRDRIKSLNIIQSSQRINEAN-LIDADVIAAYKESGKTC 270
           ++    +++ + + D     + +D ++        + I       + D++    +     
Sbjct: 12  EDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSD----E 67

Query: 271 IQVFFYRSKQNWGNQAYFPKHDPDQSLSEIMSSFL 305
                 R  +   +Q          +  +    + 
Sbjct: 68  DVALXVRQARGLPSQKRLFPWKLHITQKDNYRVYN 102


>2oceA1 [a.60.2.6] HYPOTHETICAL PROTEIN PA5201 A:474 -- 563
          Length = 90

 Score = 67.6 bits (165), Expect = 1e-14
 Identities = 15/87 (17%), Positives = 30/87 (34%), Gaps = 5/87 (5%)

Query: 528 LFFMQRLRDEAHRFAITSHRAKRAKGITKS---LLDQIDGIGSIRKRALLNHFGSARAVE 584
               Q     +    +          +  +   LL +I G+ S   + ++ H  +  A  
Sbjct: 3   HDVSQLKLARSLDAVVEDCVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAF- 61

Query: 585 SASFDEIKSVEGVEEKVAKKIYNFFHE 611
             + DE+K V  + EK  ++   F   
Sbjct: 62  -RTRDELKKVSRLGEKTFEQAAGFLRV 87


>2a1jB1 [a.60.2.5] DNA EXCISION REPAIR PROTEIN ERCC-1 B:219 -- 296
          Length = 78

 Score = 63.8 bits (155), Expect = 2e-13
 Identities = 12/70 (17%), Positives = 29/70 (41%)

Query: 542 AITSHRAKRAKGITKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKV 601
            +     +         L  +  +     + LL  FGS   + +AS +++    G+  + 
Sbjct: 4   LLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQK 63

Query: 602 AKKIYNFFHE 611
           A+++++  HE
Sbjct: 64  ARRLFDVLHE 73


>1bqqT [b.40.3.1] METALLOPROTEINASE INHIBITOR 2
          Length = 184

 Score = 62.0 bits (150), Expect = 6e-13
 Identities = 14/144 (9%), Positives = 35/144 (24%), Gaps = 14/144 (9%)

Query: 36  YVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKLEIXXXXXXXXXXXXXXXXIKKHKPK 95
            V +AK +  +      +        + +    K +I                       
Sbjct: 17  IVIRAKAVNKKEVDSGND--IYGNPIKRIQYEIK-QIKMFKGPDQDIEFIYTAPAAAVCG 73

Query: 96  FNILLKDDKSFPFVFISNKDQWAQVTKHRGKKDKEGFYFGPFASAGTANWTIKMLQKIFQ 155
            ++ +   K +  +     +    +            +  P+ +        K L   +Q
Sbjct: 74  VSLDIGGKKEY--LIAGKAEGNGNMHITLCD------FIVPWDTLSAT--QKKSLNHRYQ 123

Query: 156 IRVCDDSTFKNRKRPCILYQIKRC 179
              C+    +    PC +     C
Sbjct: 124 -MGCECKITRCPMIPCYISSPDEC 146


>1z00B1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF B:823 -- 905
          Length = 83

 Score = 60.3 bits (146), Expect = 2e-12
 Identities = 16/70 (22%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 542 AITSHRAKRAKGITKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKV 601
           + T   +++     +  L ++ G+ +   R+L++H  +   + + S DE+ S+ G     
Sbjct: 2   SETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILG-NAAN 60

Query: 602 AKKIYNFFHE 611
           AK++Y+F H 
Sbjct: 61  AKQLYDFIHT 70


>1x2iA1 [a.60.2.5] HEF HELICASE/NUCLEASE A:2 -- 69
          Length = 68

 Score = 56.7 bits (137), Expect = 2e-11
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 6/70 (8%)

Query: 542 AITSHRAKRAKGITKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKV 601
           A+T    +R       +++ +  + +   R LL HFGS   V +AS  E+  VEG+ EK+
Sbjct: 1   ALTLAERQR------LIVEGLPHVSATLARRLLKHFGSVERVFTASVAELMKVEGIGEKI 54

Query: 602 AKKIYNFFHE 611
           AK+I      
Sbjct: 55  AKEIRRVITA 64


>1kftA [a.60.2.3] EXCINUCLEASE ABC SUBUNIT C
          Length = 56

 Score = 56.0 bits (135), Expect = 4e-11
 Identities = 18/54 (33%), Positives = 33/54 (61%)

Query: 557 SLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFH 610
           S L+ I+G+G  R++ LL + G  + + +AS +EI  V G+ + +A+KI+    
Sbjct: 2   SSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIFWSLK 55


>1mu5A1 [a.156.1.3] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:229 --
           306
          Length = 78

 Score = 56.0 bits (135), Expect = 4e-11
 Identities = 15/77 (19%), Positives = 29/77 (37%), Gaps = 6/77 (7%)

Query: 534 LRDEAHRFAITSHRAKRAKGITKSLLDQIDGIGSIRKRALLNHFG--SARAVESASFDEI 591
              +     I  +  KR   I + L+++   IG      +L   G    + V++ + +EI
Sbjct: 6   YGVDREEIKILINNLKRDYTIKEFLVNEFQSIGDTTADKILELAGLKPNKKVKNLTEEEI 65

Query: 592 KSVEGVEEKVAKKIYNF 608
             +        KK  +F
Sbjct: 66  TRLVE----TFKKYEDF 78


>2csbA4 [a.60.2.4] TOPOISOMERASE V A:465 -- 519
          Length = 55

 Score = 55.9 bits (135), Expect = 4e-11
 Identities = 12/52 (23%), Positives = 23/52 (44%), Gaps = 1/52 (1%)

Query: 557 SLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNF 608
           + L  I GI   R   LL  +G    V  A  +E++  +G+ +   +++   
Sbjct: 4   ASLISIRGIDRERAERLLKKYGGYSKVREAGVEELR-EDGLTDAQIRELKGL 54


>1ln0A [d.226.1.1] INTRON-ASSOCIATED ENDONUCLEASE 1
          Length = 92

 Score = 55.8 bits (134), Expect = 4e-11
 Identities = 14/91 (15%), Positives = 29/91 (31%), Gaps = 9/91 (9%)

Query: 22  PGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQT---------FKLEI 72
            G+Y++ +  +  +YVG AK+     K +  +      ++  L ++           +  
Sbjct: 2   SGIYQIKNTLNNKVYVGSAKDFEKAWKRHFKDLEKGCHSSIKLQRSFNKHGNVFECSILE 61

Query: 73  XXXXXXXXXXXXXXXXIKKHKPKFNILLKDD 103
                           IK+   K N     D
Sbjct: 62  EIPYEKDLIIERENFWIKELNSKINGYNIAD 92


>1bvsA2 [a.60.2.1] PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
           A:64 -- 134
          Length = 71

 Score = 54.1 bits (130), Expect = 1e-10
 Identities = 10/65 (15%), Positives = 22/65 (33%), Gaps = 3/65 (4%)

Query: 550 RAKGITKSLLDQIDGIGSIRKRALLNHFGS---ARAVESASFDEIKSVEGVEEKVAKKIY 606
                    L  + G+G     A L    +    +A+  +    +  V G+  + A++I 
Sbjct: 2   AENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIV 61

Query: 607 NFFHE 611
               +
Sbjct: 62  LELAD 66


>2a1jA1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF A:837 -- 898
          Length = 62

 Score = 53.7 bits (129), Expect = 2e-10
 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 556 KSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE 611
           +  L ++ G+ +   R+L++H  +   + + S DE+ S+ G     AK++Y+F H 
Sbjct: 2   QDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGN-AANAKQLYDFIHT 56


>1c7yA2 [a.60.2.1] HOLLIDAY JUNCTION DNA HELICASE RUVA A:65 -- 150
          Length = 86

 Score = 52.3 bits (125), Expect = 5e-10
 Identities = 11/65 (16%), Positives = 26/65 (40%), Gaps = 3/65 (4%)

Query: 550 RAKGITKSLLDQIDGIGSIRKRALLNHF---GSARAVESASFDEIKSVEGVEEKVAKKIY 606
           + +      L + +G+G     A+L+         AVE      +  + G+ +K A+++ 
Sbjct: 2   KQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKTAERLI 61

Query: 607 NFFHE 611
               +
Sbjct: 62  VEMKD 66


>2duyA1 [a.60.2.7] COMPETENCE PROTEIN COMEA-RELATED PROTEIN A:11 --
           75
          Length = 65

 Score = 51.3 bits (123), Expect = 1e-09
 Identities = 8/52 (15%), Positives = 21/52 (40%), Gaps = 6/52 (11%)

Query: 559 LDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFH 610
           L  + GIG +  R ++     A        +++  V+G+     +++  +  
Sbjct: 19  LXALPGIGPVLARRIVEGRPYA------RVEDLLKVKGIGPATLERLRPYLR 64


>1dgsA1 [a.60.2.2] DNA LIGASE A:401 -- 581
          Length = 181

 Score = 45.8 bits (108), Expect = 4e-08
 Identities = 16/66 (24%), Positives = 26/66 (39%)

Query: 546 HRAKRAKGITKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKI 605
             +K            + G+G +  R L   FG+   +  AS +E+  VE V E  A+ I
Sbjct: 96  EESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLLEASLEELIEVEEVGELTARAI 155

Query: 606 YNFFHE 611
                +
Sbjct: 156 LETLKD 161



 Score = 41.6 bits (97), Expect = 8e-07
 Identities = 11/83 (13%), Positives = 25/83 (30%), Gaps = 6/83 (7%)

Query: 535 RDEAHRFAITS----HRAKRAKGITKSLLDQIDGIGSIRKRALLNHFG--SARAVESASF 588
           ++              R +  +         I+G+G      LL          +     
Sbjct: 15  KEGKVHRCPNPLCPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRK 74

Query: 589 DEIKSVEGVEEKVAKKIYNFFHE 611
           +++  +E + EK A+ +     E
Sbjct: 75  EDLLGLERMGEKSAQNLLRQIEE 97


>1u9lA [a.60.4.2] TRANSCRIPTION ELONGATION PROTEIN NUSA
          Length = 68

 Score = 42.9 bits (101), Expect = 3e-07
 Identities = 7/58 (12%), Positives = 17/58 (29%), Gaps = 1/58 (1%)

Query: 555 TKSLLDQIDGIGSIRKRALLNH-FGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE 611
                 +   I       L+   F +   +      E+  +EG++E   + +      
Sbjct: 4   AIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKN 61


>2csbA3 [a.60.2.4] TOPOISOMERASE V A:410 -- 464
          Length = 55

 Score = 42.1 bits (99), Expect = 6e-07
 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 557 SLLDQIDGIGSIRKRALLNHFGS----ARAVESASFDEIKSVEGVEEKVAKKI 605
           + L + +G+G      LL  FG+     +       +++ SVEGV E+V + +
Sbjct: 2   AELTKKEGVGRKTAERLLRAFGNPERVKQLAREFEIEKLASVEGVGERVLRSL 54


>1pznA1 [a.60.4.1] DNA REPAIR AND RECOMBINATION PROTEIN RAD51 A:35
           -- 95
          Length = 61

 Score = 41.8 bits (98), Expect = 7e-07
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%)

Query: 559 LDQIDGIGSIRKRALLN-HFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE 611
           ++ + G+G      L    + +  A+  AS  E+K V G+ E  A KI     +
Sbjct: 3   IEDLPGVGPATAEKLREAGYDTLEAIAVASPIELKEVAGISEGTALKIIQAARK 56


>1bgxT1 [a.60.7.1] TAQ DNA POLYMERASE T:174 -- 289
          Length = 116

 Score = 40.6 bits (95), Expect = 2e-06
 Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 553 GITKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE 611
           G     L  + GIG    R LL  +GS  A+       +K+++ ++  + +KI     +
Sbjct: 14  GDESDNLPGVKGIGEKTARKLLEEWGSLEAL-------LKNLDRLKPAIREKILAHMDD 65


>1lb2B [a.60.3.1] DNA-DIRECTED RNA POLYMERASE ALPHA CHAIN
          Length = 72

 Score = 40.6 bits (95), Expect = 2e-06
 Identities = 4/56 (7%), Positives = 12/56 (21%), Gaps = 1/56 (1%)

Query: 557 SLLDQIDGIGSIRKRALLNH-FGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE 611
                   +       L          +   +  E+     + +K   +I +    
Sbjct: 5   LRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLAS 60


>2eduA1 [a.60.2.7] KINESIN-LIKE PROTEIN KIF22 A:8 -- 98
          Length = 91

 Score = 39.9 bits (93), Expect = 3e-06
 Identities = 7/69 (10%), Positives = 21/69 (30%), Gaps = 8/69 (11%)

Query: 539 HRFAITSHRAKRAKGITKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVE 598
            +     +            L  +  IG  + + ++           +  ++++ VEG+ 
Sbjct: 21  QKILDLLNEGSA------RDLRSLQRIGPKKAQLIVGWRELHGPF--SQVEDLERVEGIT 72

Query: 599 EKVAKKIYN 607
            K  +    
Sbjct: 73  GKQMESFLK 81


>2bskA1 [g.83.1.1] MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE
           A:13 -- 85
          Length = 73

 Score = 39.9 bits (93), Expect = 3e-06
 Identities = 9/70 (12%), Positives = 22/70 (31%), Gaps = 11/70 (15%)

Query: 157 RVCDDSTFKNRKRPCILYQIKRCSGPCVD-YIDKEDYKKSVDQAIQFVSGKSRDIQKNLS 215
             C     K+     +  +   CS  C+  Y+             Q +S + ++     +
Sbjct: 14  ETCFLDCVKDFTTREVKPEETTCSEHCLQKYLK----------MTQRISMRFQEYHIQQN 63

Query: 216 KQMEEASEKL 225
           + +   +  L
Sbjct: 64  EALAAKAGLL 73


>2axtU1 [a.60.12.2] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN U:37 --
           134
          Length = 98

 Score = 37.6 bits (87), Expect = 1e-05
 Identities = 8/80 (10%), Positives = 27/80 (33%), Gaps = 7/80 (8%)

Query: 532 QRLRDEAHRFAITSHRAKRAKGI-TKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDE 590
           + L +       T++  K        +   Q  G+     + ++ +          S ++
Sbjct: 1   EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYE------SVED 54

Query: 591 IKSVEGVEEKVAKKIYNFFH 610
           + ++ G+ E+  + +     
Sbjct: 55  VLNIPGLTERQKQILRENLE 74


>1exnA1 [a.60.7.1] 5'-EXONUCLEASE A:186 -- 290
          Length = 105

 Score = 36.3 bits (84), Expect = 3e-05
 Identities = 8/59 (13%), Positives = 19/59 (32%), Gaps = 2/59 (3%)

Query: 553 GITKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE 611
           G     +  ++GIG+ R   ++  FG+   +           +   + +       F  
Sbjct: 15  GDLGDNIRGVEGIGAKRGYNIIREFGNVLDI-IDQLPLPG-KQKYIQNLNASEELLFRN 71


>2q0zX1 [a.289.1.1] PROTEIN PRO2281 X:33 -- 208
          Length = 176

 Score = 36.3 bits (83), Expect = 3e-05
 Identities = 6/54 (11%), Positives = 17/54 (31%), Gaps = 1/54 (1%)

Query: 559 LDQIDGIGSIRKRALLNH-FGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE 611
           L Q+    S   +   +    S   +     +E  ++  + +     +  F + 
Sbjct: 121 LKQLPHFTSEHIKRCTDKGVESVFDIXEXEDEERNALLQLTDSQIADVARFCNR 174


>1qojA [a.2.9.1] UVRB
          Length = 46

 Score = 34.7 bits (80), Expect = 9e-05
 Identities = 8/27 (29%), Positives = 15/27 (55%)

Query: 214 LSKQMEEASEKLDFERASIFRDRIKSL 240
           L     + ++ L+FE A+  RD++  L
Sbjct: 12  LEGLXXQHAQNLEFEEAAQIRDQLHQL 38


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.315    0.132    0.378 

Gapped
Lambda     K      H
   0.267   0.0395    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 16,087,230
Number of extensions: 1185779
Number of successful extensions: 5859
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5369
Number of HSP's successfully gapped: 439
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)