RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAZ21432.1 pubi0 dxs GIB00256CH01 "1-D-deoxyxylulose
5-phosphate synthase"
         (637 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2apjA1 [c.23.10.7] PUTATIVE ESTERASE A:17 -- 260                      168   5e-45
1b0pA2 [c.36.1.12] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE) ...   162   3e-43
1ni4A [c.36.1.11] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA          160   2e-42
1dtwA [c.36.1.11] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE        152   4e-40
1dtwB1 [c.36.1.7] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE B...   148   7e-39
1l8aA1 [c.36.1.10] PYRUVATE DEHYDROGENASE E1 COMPONENT A:56 -- 470    147   1e-38
1ay0A2 [c.36.1.6] TRANSKETOLASE A:338 -- 534                          124   1e-31
1ay0A1 [c.36.1.10] TRANSKETOLASE A:3 -- 337                           122   4e-31
1um9A [c.36.1.11] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT              112   5e-28
2np5A2 [a.121.1.1] TRANSCRIPTIONAL REGULATOR A:78 -- 195              107   9e-27
1jscA2 [c.36.1.5] ACETOHYDROXY-ACID SYNTHASE A:83 -- 270              105   4e-26
1ozfA3 [c.36.1.9] ACETOLACTATE SYNTHASE, CATABOLIC A:367 -- 554        97   2e-23
1upaA3 [c.36.1.9] CARBOXYETHYLARGININE SYNTHASE A:375 -- 572           94   1e-22
1powA3 [c.36.1.9] PYRUVATE OXIDASE A:366 -- 593                        91   9e-22
2c31A2 [c.36.1.5] OXALYL-COA DECARBOXYLASE A:7 -- 194                  90   2e-21
1ay0A3 [c.48.1.1] TRANSKETOLASE A:535 -- 680                           88   9e-21
1dtwB2 [c.48.1.2] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE B...    87   1e-20
1csmA [a.130.1.2] CHORISMATE MUTASE                                    86   4e-20
2p8tA2 [d.74.4.2] HYPOTHETICAL PROTEIN PH0730 A:83 -- 199              84   2e-19
1zpdA3 [c.36.1.9] PYRUVATE DECARBOXYLASE A:363 -- 566                  84   2e-19
1c7sA2 [b.2.2.3] BETA-N-ACETYLHEXOSAMINIDASE A:28 -- 200               81   9e-19
1ovmA3 [c.36.1.9] INDOLE-3-PYRUVATE DECARBOXYLASE A:356 -- 551         80   3e-18
2c31A3 [c.36.1.9] OXALYL-COA DECARBOXYLASE A:370 -- 552                75   9e-17
1l8aA3 [c.48.1.1] PYRUVATE DEHYDROGENASE E1 COMPONENT A:701 -- 886     67   2e-14
1b0pA3 [c.48.1.3] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE) A...    62   8e-13
1bfdA3 [c.36.1.9] BENZOYLFORMATE DECARBOXYLASE A:342 -- 524            54   2e-10
1upaA2 [c.36.1.5] CARBOXYETHYLARGININE SYNTHASE A:12 -- 197            49   6e-09
3cr3C1 [c.54.1.2] PTS-DEPENDENT DIHYDROXYACETONE KINASE, C:3 -- 123    45   1e-07
1q18A2 [c.55.1.7] GLUCOKINASE A:112 -- 321                             36   5e-05

>2apjA1 [c.23.10.7] PUTATIVE ESTERASE A:17 -- 260
          Length = 244

 Score =  168 bits (427), Expect = 5e-45
 Identities = 30/239 (12%), Positives = 59/239 (24%), Gaps = 35/239 (14%)

Query: 248 VGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAEKASDHYHGVSKFNVVT 307
            G    H  +  +       +        I   +   +     E             V  
Sbjct: 21  GGVFKDHHNNRWVWDKILPPECA--PNSSILRLSADLRWEEAHEPLHVDIDTGKVCGV-- 76

Query: 308 GEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGMDIFAKDFPKRMFDVGI 367
                           FAN +    E DS V+G+     GGT +  + +     +++  +
Sbjct: 77  -----------GPGMAFANAVKNRLETDSAVIGLVPCASGGTAIKEWER--GSHLYERMV 123

Query: 368 AEQH----------AVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFII 417
                         AV +  G +          Y   + R    + HD+ + SLP+  + 
Sbjct: 124 KRTEESRKCGGEIKAVLWYQGESDVLDIHDAESYGNNMDRLIKNLRHDLNLPSLPIIQVA 183

Query: 418 -DRAGLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRY 475
               G              ++ +  +    +   SD   L                +  
Sbjct: 184 IASGGGYIDKVREAQLGLKLSNVVCVDAKGLPLKSDNLHLTTE-------AQVQLGLSL 235


>1b0pA2 [c.36.1.12] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
           A:786 -- 1232
          Length = 447

 Score =  162 bits (411), Expect = 3e-43
 Identities = 36/401 (8%), Positives = 79/401 (19%), Gaps = 65/401 (16%)

Query: 53  VELTVALHYVFDTPNDRLIWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYD 112
            E    ++         L                +++    L   N      +  +    
Sbjct: 88  AEYGFGMNMSMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKK 147

Query: 113 PFGAAHSSTSISSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIV 172
                         LG   A        ++    GDG          +++  AS   + V
Sbjct: 148 LLA-----GQKDGLLGQIAAMSDLYTKKSVWIFGGDGWAYDIGYGG-LDHVLASGEDVNV 201

Query: 173 ILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAEDFLRS 232
            + D +      V +     +   T     +                      A      
Sbjct: 202 FVMDTE------VYSNTGGQSSKATPTGAVAKFA-------------------AAGKRTG 236

Query: 233 AVTGGTLFNSLGFYYVGPIDG-HDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYS--- 288
                 +  + G+ YV  +   +     + +LK A       P ++              
Sbjct: 237 KKDLARMVMTYGYVYVATVSMGYSKQQFLKVLKEAESFPG--PSLVIAYATCINQGLRKG 294

Query: 289 -----YAEKASDHYHGVSKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTA 343
                     +        F        +        +K    ++ +     ++   +  
Sbjct: 295 MGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPDGSVEEFLMAQNRFAVLDR 354

Query: 344 AMPGGTGM------------DIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIY 391
           + P                     +           A        +    EG +      
Sbjct: 355 SFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDD 414

Query: 392 STFLQRAYDQVVHDVAIQSLPVRFIIDRAGLVGADGSTHAG 432
           +  + R       D            +RAG     G     
Sbjct: 415 TPMMARPDSGEACD-----------QNRAGTSEQQGDLSKR 444


>1ni4A [c.36.1.11] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
          Length = 362

 Score =  160 bits (405), Expect = 2e-42
 Identities = 49/342 (14%), Positives = 88/342 (25%), Gaps = 20/342 (5%)

Query: 13  PSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRLI- 71
             D  K           E++ + +       G      G     V L    + P D LI 
Sbjct: 30  REDGLKYYRXXQTVRRXELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGIN-PTDHLIT 88

Query: 72  --WDVGHQTYPHKILTGRKSKIKTLRQGNGLS-GFTKRSESEYDPFGAAHSSTSISSALG 128
                G        +    +++   + G     G +    ++    G       +    G
Sbjct: 89  AYRAHGFTFTRGLSVREILAELTGRKGGCAKGKGGSXHXYAKNFYGGNGIVGAQVPLGAG 148

Query: 129 MAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAM 188
           +A A K + K    + + GDGA + G  +EA N A   K   I I  +N       V   
Sbjct: 149 IALACKYNGKDEVCLTLYGDGAANQGQIFEAYNXAALWKLPCIFICENNRYGXGTSVERA 208

Query: 189 RTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYV 248
                    G     LR               V+              G +   L  Y  
Sbjct: 209 AASTDYYKRGDFIPGLRV-------DGXDILCVREATRFAAAYCRSGKGPILXELQTYRY 261

Query: 249 GP---IDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAEKASDHYHGVSKFNV 305
                 D          ++  R      PI +          +  E+  +    V K   
Sbjct: 262 HGHSXSDPGVSYRTREEIQEVR--SKSDPIXLLKDRXVNSNLASVEELKEIDVEVRKEIE 319

Query: 306 VTGEQVKSGTNLPA---YTKVFANTLVKHAERDSKVVGVTAA 344
              +   +    P       ++++         ++ +   + 
Sbjct: 320 DAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSV 361


>1dtwA [c.36.1.11] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
          Length = 382

 Score =  152 bits (384), Expect = 4e-40
 Identities = 50/366 (13%), Positives = 92/366 (25%), Gaps = 41/366 (11%)

Query: 7   LKDINFPSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTP 66
                    + KL +  +  ++   R                  G     V      D  
Sbjct: 42  EDPHLPKEKVLKLYK-SMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALD-N 99

Query: 67  NDRLIWDVGHQT---YPHKILTGRKSKI---KTLRQGNGLSGFTKRSESEYDPFGAAHSS 120
            D +           Y    L    ++     +              +  +    ++  +
Sbjct: 100 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 159

Query: 121 TSISSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMS 180
           T I  A+G A A K +N    +I   G+GA S G A+   N A   +  +I    +N  +
Sbjct: 160 TQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 219

Query: 181 IAKPVGAMR--TYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAEDF---LRSAV- 234
           I+ P         +A    G    S+R               V            + A  
Sbjct: 220 ISTPTSEQYRGDGIAARGPGYGIMSIR---------------VDGNDVFAVYNATKEARR 264

Query: 235 -TGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAEKA 293
                    L       I  H  S           S ++ PI         +G+   E+ 
Sbjct: 265 RAVAENQPFLIEAMTYRIGHHSTSD--------DSSAYRHPISRLRHYLLSQGWWDEEQE 316

Query: 294 SDHYHGVSKF---NVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTG 350
                   +         E+         ++ V+     +  ++   +            
Sbjct: 317 KAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP 376

Query: 351 MDIFAK 356
           +D F K
Sbjct: 377 LDHFDK 382


>1dtwB1 [c.36.1.7] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE B:17
           -- 204
          Length = 188

 Score =  148 bits (374), Expect = 7e-39
 Identities = 29/186 (15%), Positives = 60/186 (32%), Gaps = 15/186 (8%)

Query: 318 PAYTKVFANTLVKHAERDSKVVGVTAAMPGGT----GMDIFAKDFPKRMFDVGIAEQHAV 373
               +   + L     +D   V     +  G      + +  K    R+F+  + EQ  V
Sbjct: 5   MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV 64

Query: 374 TFAAGLATEGYKPYV-AIYSTFLQRAYDQVVHDVA--------IQSLPVRFIIDRAGLVG 424
            F  G+A  G        ++ ++  A+DQ+V++ A        + +     I    G   
Sbjct: 65  GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWG-CV 123

Query: 425 ADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGNGIGVE 484
             G+ +       + +  P   V+ P    +   +  + +  +  PC    P+       
Sbjct: 124 GHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIE-DKNPCIFFEPKILYRAAA 182

Query: 485 LPSIDE 490
                E
Sbjct: 183 EEVPIE 188


>1l8aA1 [c.36.1.10] PYRUVATE DEHYDROGENASE E1 COMPONENT A:56 -- 470
          Length = 402

 Score =  147 bits (371), Expect = 1e-38
 Identities = 59/394 (14%), Positives = 108/394 (27%), Gaps = 56/394 (14%)

Query: 7   LKDINFPSDLRKLS--ENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVF- 63
            +   +P +L       + ++  +            E GGH+ +      +       F 
Sbjct: 11  EEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLELGGHMASFQSSATIYDVCFNHFF 70

Query: 64  ----DTPNDRLIWDVGHQT---YPHKILTGRKSK--IKTLRQGNGLSGF----TKRSESE 110
               +     L++  GH +   Y    L GR ++  +   RQ    +G       +   E
Sbjct: 71  RARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPHPKLMPE 130

Query: 111 YDPFGAAHSSTSISSALGMAEANKLSNKLNN-------IIAVIGDGAISAGMAYEAMNNA 163
           +  F           A+  A+  K              + A +GDG +    +  A+  A
Sbjct: 131 FWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESKGAITIA 190

Query: 164 GASKTKM-IVILNDNDMSIAKPVGAMRTY---LAKLLTGKIYFS--------LRETFKLI 211
              K    + ++N N   +  PV         L  +  G  +            E  +  
Sbjct: 191 TREKLDNLVFVINCNLQRLDGPVTGNGKIINELEGIFEGAGWNVIKVMWGSRWDELLRKD 250

Query: 212 VSA-------------FSKRFSVKAGKAEDFLRS---AVTGGTLFNSLGFYYVGPIDGHD 255
            S              +    S       +                +    +     GHD
Sbjct: 251 TSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFGKYPETAALVADWTDEQIWALNRGGHD 310

Query: 256 LSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAEKASDHYHGVSKFNVVTGEQVKSGT 315
              +    K A+++K     +I   T KG G   A       H   +FNV   +      
Sbjct: 311 PKKIYAAFKKAQETK-GKATVILAHTIKGYGMGDAAMD-GVRHIRDRFNVPVSDADIE-- 366

Query: 316 NLPAYTKVF-ANTLVKHAERDSKVVGVTAAMPGG 348
            LP  T    +        +  K+ G   +    
Sbjct: 367 KLPYITFPEGSEEHTYLHAQRQKLHGYLPSRQPN 400


>1ay0A2 [c.36.1.6] TRANSKETOLASE A:338 -- 534
          Length = 197

 Score =  124 bits (311), Expect = 1e-31
 Identities = 32/181 (17%), Positives = 56/181 (30%), Gaps = 13/181 (7%)

Query: 312 KSGTNLPAYTKVFANTLVKHAERDSKVVGVTA---------AMPGGTGMDI--FAKDFPK 360
            +  +  A  K+    L     +  +++G +A                      + ++  
Sbjct: 13  TAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSG 72

Query: 361 RMFDVGIAEQHAVTFAAGLATEGYKPYVAI--YSTFLQRAYDQVVHDVAIQSLPVRFIID 418
           R    GI E        G++  G         +  F+  A   V          +     
Sbjct: 73  RYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATH 132

Query: 419 RAGLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRG 478
            +  VG DG TH     + +  +LPN  V  P+D  E+      S+   + P  I   R 
Sbjct: 133 DSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQ 192

Query: 479 N 479
           N
Sbjct: 193 N 193


>1ay0A1 [c.36.1.10] TRANSKETOLASE A:3 -- 337
          Length = 335

 Score =  122 bits (307), Expect = 4e-31
 Identities = 64/310 (20%), Positives = 101/310 (32%), Gaps = 78/310 (25%)

Query: 14  SDLRKLSENDLQEVSNEVRKEMIDAVSET-GGHLGAGLGVVELTVALHYVF--------D 64
           +D+ KL+ +        +R   +D VS+   GH GA LG+      L             
Sbjct: 3   TDIDKLAVS-------TIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDW 55

Query: 65  TPNDRLIWDVGHQT---YPHKILTGRKSK---IKTLRQGNGLSGFTKRSESEYDPFGAAH 118
              DR +   GH     Y    LTG       +K  RQ    +      E          
Sbjct: 56  INRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGP 115

Query: 119 SSTSISSALGMAEANKLSNKLNN----------IIAVIGDGAISAGMAYEAMNNAGASK- 167
               IS+A+GMA A        N              +GDG +  G++ EA + AG  K 
Sbjct: 116 LGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKL 175

Query: 168 TKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAE 227
             +I I +DN ++I                                             E
Sbjct: 176 GNLIAIYDDNKITIDGATSISFD------------------------------------E 199

Query: 228 DFLRSAVTGGTLFNSLGFYYVGPIDGH-DLSTLIPILKNARDSKHQGPIMIHIKTQKGKG 286
           D  +        + + G+  +   +G+ DL+ +   +  A+ SK + P +I + T  G G
Sbjct: 200 DVAK-------RYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDK-PTLIKMTTTIGYG 251

Query: 287 YSYAEKASDH 296
             +A   S  
Sbjct: 252 SLHAGSHSVA 261


>1um9A [c.36.1.11] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
          Length = 331

 Score =  112 bits (280), Expect = 5e-28
 Identities = 36/249 (14%), Positives = 65/249 (26%), Gaps = 21/249 (8%)

Query: 13  PSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRLIW 72
              LR+L  + L        +  I   +     +    G     VA+ +      D +  
Sbjct: 30  GEKLRRLYRDML-AARMLDERYTILIRTGKTSFIAPAAGHEAAQVAIAHAIRPGFDWVFP 88

Query: 73  DVGH-------QTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISS 125
                           ++L    +      +G  +               A+  ++ +  
Sbjct: 89  YYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKA-LNFFTVASPIASHVPP 147

Query: 126 ALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPV 185
           A G A + KL       +   GDGA S G  Y  +N A       + I  +N  +IA   
Sbjct: 148 AAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFPTIADKA 207

Query: 186 GAMRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGF 245
            A        + G    +     K  V                    ++    ++     
Sbjct: 208 HAFGIPGYL-VDGMDVLASYYVVKEAVERA-----------RRGEGPSLVELRVYRYGPH 255

Query: 246 YYVGPIDGH 254
               PI   
Sbjct: 256 RKKDPIPRF 264


>2np5A2 [a.121.1.1] TRANSCRIPTIONAL REGULATOR A:78 -- 195
          Length = 118

 Score =  107 bits (270), Expect = 9e-27
 Identities = 14/118 (11%), Positives = 30/118 (25%), Gaps = 10/118 (8%)

Query: 435 DITYLSTLPNFIVMAPSDEAELVKM---TNTSMTINNKPCAIRYPRGNGIGVELPSIDEN 491
            +    +      + P DEA   +       ++     P      R     +        
Sbjct: 7   ALFAAXS-----QLLPLDEARSREAHVXAAFAVRAATSPSLAEIRRKTLFTIRTGLSAVL 61

Query: 492 IEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELIL 549
           I IG          +     G  L+    + A    + +    +D +    L    ++
Sbjct: 62  IGIGTPEAETRAALLLATVDGLALDAIG-SPALYPPEYL-EHALDIQIGXILQGADVV 117


>1jscA2 [c.36.1.5] ACETOHYDROXY-ACID SYNTHASE A:83 -- 270
          Length = 188

 Score =  105 bits (264), Expect = 4e-26
 Identities = 24/182 (13%), Positives = 52/182 (28%), Gaps = 12/182 (6%)

Query: 319 AYTKVFANTLVKHAERDSKVVGVTAAMPGGTGMDIF--AKDFPKRMFDVGIAEQHAVTFA 376
              ++F   + +               PGG  + ++    +  K  F +   EQ A   A
Sbjct: 11  TGGQIFNEMMSRQNVD------TVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMA 64

Query: 377 AGLATEGYKPYVAIYSTFLQRAYDQ-VVHDVAIQSLPVRFIIDRAGLVGADGSTHAGSFD 435
            G A    KP V + ++          + D     +P+     +             +  
Sbjct: 65  EGYARASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADV 124

Query: 436 ITYLSTLPNFIVMAPSDE---AELVKMTNTSMTINNKPCAIRYPRGNGIGVELPSIDENI 492
           +    +   + VM  S E     + +    + +    P  +  P+     +    I    
Sbjct: 125 VGISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKDVTAAILRNPIPTKT 184

Query: 493 EI 494
            +
Sbjct: 185 TL 186


>1ozfA3 [c.36.1.9] ACETOLACTATE SYNTHASE, CATABOLIC A:367 -- 554
          Length = 188

 Score = 97.2 bits (241), Expect = 2e-23
 Identities = 27/226 (11%), Positives = 52/226 (23%), Gaps = 48/226 (21%)

Query: 68  DRLIWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSAL 127
            R++  +         LT       +         +T R+       G      ++  A+
Sbjct: 8   LRIVRAMQDIVNSDVTLTVDMG---SFHIWIARYLYTFRARQVMISNGQQTMGVALPWAI 64

Query: 128 GMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKM-IVILNDNDMSIAKPVG 186
           G      L N    +++V GDG      +   +  A   K  +  +I  DN  ++     
Sbjct: 65  GAW----LVNPERKVVSVSGDG--GFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQE 118

Query: 187 AMRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFY 246
             +                                     +                  +
Sbjct: 119 EKK------------------------------------YQRLSGVEFGPMDFKAYAESF 142

Query: 247 YVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAEK 292
                       L P L+ A D    GP ++ I            +
Sbjct: 143 GAKGFAVESAEALEPTLRAAMDVD--GPAVVAIPVDYRDNPLLMGQ 186


>1upaA3 [c.36.1.9] CARBOXYETHYLARGININE SYNTHASE A:375 -- 572
          Length = 198

 Score = 94.4 bits (234), Expect = 1e-22
 Identities = 21/244 (8%), Positives = 49/244 (20%), Gaps = 61/244 (25%)

Query: 50  LGVVELTVALHYVFDTPNDRLIW-DVG-HQTYPHKILTGRKSKIKTLRQGNGLSGFTKRS 107
             V++    +      P +  I  D+G  + Y                            
Sbjct: 11  HQVIDSXNTVXEEAAEPGEGTIVSDIGFFRHYGVLFARAD-------------------- 50

Query: 108 ESEYDPFGAAHSSTSISSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASK 167
             +   F  +   +S    +  A   + +        + GDG          +       
Sbjct: 51  --QPFGFLTSAGCSSFGYGIPAAIGAQXARPDQPTFLIAGDG--GFHSNSSDLETIARLN 106

Query: 168 TKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAE 227
             ++ ++ +ND +    +     +                 K     F            
Sbjct: 107 LPIVTVVVNNDTNGLIELYQNIGHHRSHDP---------AVKFGGVDFVALA-------- 149

Query: 228 DFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGY 287
                               V      +   L+  L+   +     P +I +        
Sbjct: 150 ----------------EANGVDATRATNREELLAALRKGAE--LGRPFLIEVPVNYDFQP 191

Query: 288 SYAE 291
               
Sbjct: 192 GGFG 195


>1powA3 [c.36.1.9] PYRUVATE OXIDASE A:366 -- 593
          Length = 228

 Score = 91.4 bits (226), Expect = 9e-22
 Identities = 27/238 (11%), Positives = 53/238 (22%), Gaps = 44/238 (18%)

Query: 68  DRLIWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSAL 127
            +++  V     P  I +        +            S         A     I  A+
Sbjct: 9   YQVLRAVNKIAEPDAIYSIDVG---DINLNANRHLKLTPSNRHITSNLFATMGVGIPGAI 65

Query: 128 GMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGA 187
                  L+     +  + GDG   A M  + +         +I ++  N          
Sbjct: 66  AAK----LNYPERQVFNLAGDGG--ASMTMQDLATQVQYHLPVINVVFTNCQYGFIKDEQ 119

Query: 188 MRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYY 247
             T                            F        DF +       + + +    
Sbjct: 120 EDTN------------------------QNDFIGVEFNDIDFSK-------IADGVHMQA 148

Query: 248 VGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAEKASDHYHGVSKFNV 305
                      L  + + A+      P++I       +    AEK        S  ++
Sbjct: 149 FRVNKIEQ---LPDVFEQAKAIAQHEPVLIDAVITGDRPL-PAEKLRLDSAMSSAADI 202


>2c31A2 [c.36.1.5] OXALYL-COA DECARBOXYLASE A:7 -- 194
          Length = 188

 Score = 90.1 bits (223), Expect = 2e-21
 Identities = 16/181 (8%), Positives = 39/181 (21%), Gaps = 8/181 (4%)

Query: 321 TKVFANTLVKHAERDSKVVGVTAAMPGGTGMDIF-AKDFPKRMFDVGIAEQHAVTFAAGL 379
                  ++  A + + +  +   + G    ++        + F     EQHA   A+  
Sbjct: 2   ELTDGFHVLIDALKMNDIDTM-YGVVGIPITNLARMWQDDGQRFYSFRHEQHAGYAASIA 60

Query: 380 ATEGYKPYVAIYS--TFLQRAYDQVVHDVAIQSLPVRFIIDRAG-LVGADGSTHAGSFDI 436
                KP V +             + H        +         +V      +     +
Sbjct: 61  GYIEGKPGVCLTVSAPGFLNGVTSLAHATTNCFPMILLSGSSEREIVDLQQGDYEEMDQM 120

Query: 437 TYLSTLPNFIVMA--PSDEAELVKMT-NTSMTINNKPCAIRYPRGNGIGVELPSIDENIE 493
                            D    +     T+++       +  P               + 
Sbjct: 121 NVARPHCKASFRINSIKDIPIGIARAVRTAVSGRPGGVYVDLPAKLFGQTISVEEANKLL 180

Query: 494 I 494
            
Sbjct: 181 F 181


>1ay0A3 [c.48.1.1] TRANSKETOLASE A:535 -- 680
          Length = 146

 Score = 88.1 bits (218), Expect = 9e-21
 Identities = 19/156 (12%), Positives = 52/156 (33%), Gaps = 19/156 (12%)

Query: 484 ELPSIDENIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPL 543
           E  SI+   + G          + +++ G+ +     AA  L  K I++ +V        
Sbjct: 1   EGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTF 60

Query: 544 DQELILKCAR---EHEAMITVEEGSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIE 600
           D++ +        ++  +++VE  +   +G +                       D F  
Sbjct: 61  DKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYA----------------HQSFGIDRFGA 104

Query: 601 QDSPKKMYDVAGLNASQISKKILDILFTKESIKVVK 636
                +++   G     ++++    +   +  K++ 
Sbjct: 105 SGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLIS 140


>1dtwB2 [c.48.1.2] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
           B:205 -- 342
          Length = 138

 Score = 87.3 bits (216), Expect = 1e-20
 Identities = 27/137 (19%), Positives = 54/137 (39%), Gaps = 6/137 (4%)

Query: 492 IEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNK-GIESTIVDARFAKPLDQELILK 550
           I + +  VIQEG  V +++ GT++   +  A+  K K G+   ++D R   P D + I K
Sbjct: 4   IPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICK 63

Query: 551 CAREHEAMITVEE-GSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIEQDSPKKMYD 609
              +   ++   E    GGF S + + + E+   +       +   D       P     
Sbjct: 64  SVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPF----PHIFEP 119

Query: 610 VAGLNASQISKKILDIL 626
               +  +    +  ++
Sbjct: 120 FYIPDKWKCYDALRKMI 136


>1csmA [a.130.1.2] CHORISMATE MUTASE
          Length = 253

 Score = 85.8 bits (212), Expect = 4e-20
 Identities = 18/107 (16%), Positives = 32/107 (29%), Gaps = 13/107 (12%)

Query: 4   YKFLKDINFPSDLR--KLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGV-----VELT 56
             FL  IN+P  L       N   ++     +++I  +S+  G      G      +E  
Sbjct: 92  KSFLPSINYPQILAPYAPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSVATRDIECL 151

Query: 57  VAL----HYVFDTPNDRLIWDVGHQTYPHKILTGRKSKIKTLRQGNG 99
            +L    H+       +   D     Y   I +     I      + 
Sbjct: 152 QSLSRRIHFGKFVAEAKFQSD--IPLYTKLIKSKDVEGIMKNITNSA 196


>2p8tA2 [d.74.4.2] HYPOTHETICAL PROTEIN PH0730 A:83 -- 199
          Length = 117

 Score = 83.9 bits (207), Expect = 2e-19
 Identities = 14/115 (12%), Positives = 30/115 (26%), Gaps = 9/115 (7%)

Query: 430 HAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGNGIGV----EL 485
            +       +   P   ++  +                +   A+     +   V      
Sbjct: 2   FSEPIG-VSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFR 60

Query: 486 PSIDENIEIGKGRVIQEGKQVCILSIGTRLEEC----KIAAAELKNKGIESTIVD 536
           P  +   E+ K  V  E     I++      +        A  LK + I   I++
Sbjct: 61  PLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILE 115


>1zpdA3 [c.36.1.9] PYRUVATE DECARBOXYLASE A:363 -- 566
          Length = 204

 Score = 83.6 bits (206), Expect = 2e-19
 Identities = 27/233 (11%), Positives = 61/233 (26%), Gaps = 38/233 (16%)

Query: 75  GHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDP--FGAAHSSTSISSALGMAEA 132
                  + +    +   T+    G S F  +     +            I  ++  A  
Sbjct: 3   LVNAEIARQVEALLTPNTTVIAETGDSWFNAQRMKLPNGARVEYEMQWGHIGWSVPAAFG 62

Query: 133 NKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIV-ILNDNDMSIAKPVGAMRTY 191
             +       I ++GDG+    +  + +      K  +I+ ++N+   +I   +      
Sbjct: 63  YAVGAPERRNILMVGDGSF--QLTAQEVAQMVRLKLPVIIFLINNYGYTIEVMIH----- 115

Query: 192 LAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYVGPI 251
                   I       +  ++  F+      +G A+     A TGG L  ++        
Sbjct: 116 --DGPYNNIK---NWDYAGLMEVFNGNGGYDSGAAKGL--KAKTGGELAEAI-------- 160

Query: 252 DGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAEKASDHYHGVSKFN 304
                           +    GP +I     +        K        +   
Sbjct: 161 -----------KVALAN--TDGPTLIECFIGREDCTEELVKWGKRVAAANSRK 200


>1c7sA2 [b.2.2.3] BETA-N-ACETYLHEXOSAMINIDASE A:28 -- 200
          Length = 173

 Score = 81.4 bits (200), Expect = 9e-19
 Identities = 14/185 (7%), Positives = 42/185 (22%), Gaps = 26/185 (14%)

Query: 108 ESEYDPFGAAH------SSTSISS-ALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAM 160
           +   D             + +  +     A     ++    +  +  DG    G  +   
Sbjct: 2   QQLVDQLSQLKLNVKMLDNRAGENGVDCAALGADWASCNRVLFTLSNDGQAIDGKDWVIY 61

Query: 161 NNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFS 220
            ++     +  + ++++   IA   G +     KL     +        + +   ++ + 
Sbjct: 62  FHSP----RQTLRVDNDQFKIAHLTGDL----YKLEPTAKFSGFPAGKAVEIPVVAEYWQ 113

Query: 221 VKAGKAEDFLRSAVTGG------TLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGP 274
           +          +                    +V P  G                    P
Sbjct: 114 LFRNDFLPRWYATSGDAKPKMLANTDTENLDQFVAPFTGDQWKRTKDDKNILMT-----P 168

Query: 275 IMIHI 279
               +
Sbjct: 169 ASRFV 173


>1ovmA3 [c.36.1.9] INDOLE-3-PYRUVATE DECARBOXYLASE A:356 -- 551
          Length = 196

 Score = 79.8 bits (196), Expect = 3e-18
 Identities = 27/237 (11%), Positives = 56/237 (23%), Gaps = 49/237 (20%)

Query: 66  PNDRLIWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDP--FGAAHSSTSI 123
           P+  L      Q    + L         +    G S F            F       SI
Sbjct: 1   PDGSL-----TQENFWRTLQTFIRPGDIILADQGTSAFGAIDLRLPADVNFIVQPLWGSI 55

Query: 124 SSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKM-IVILNDNDMSIA 182
              L  A   + +     +I + GDG  +A +  + + +    K    I++LN+   ++ 
Sbjct: 56  GYTLAAAFGAQTACPNRRVIVLTGDG--AAQLTIQELGSMLRDKQHPIILVLNNEGYTVE 113

Query: 183 KPVGAMRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNS 242
           + +                                              +      +  +
Sbjct: 114 RAIHGAEQ------------------------------------RYNDIALWNWTHIPQA 137

Query: 243 LGFYYVGP-IDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAEKASDHYH 298
           L            +   L  +L+      H+   +I +   K          +    
Sbjct: 138 LSLDPQSECWRVSEAEQLADVLEKVA--HHERLSLIEVMLPKADIPPLLGALTKALE 192


>2c31A3 [c.36.1.9] OXALYL-COA DECARBOXYLASE A:370 -- 552
          Length = 183

 Score = 74.7 bits (183), Expect = 9e-17
 Identities = 26/241 (10%), Positives = 50/241 (20%), Gaps = 61/241 (25%)

Query: 47  GAGLGVVELTVALHYVFDTPNDRLIWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKR 106
              +        +        D  + + G         T     +   R+          
Sbjct: 3   SGMMNYSNSLGVVRDFMLANPDISLVNEGAN---ALDNTRMIVDMLKPRKR--------- 50

Query: 107 SESEYDPFGAAHSSTSISSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGAS 166
                D          +   +  A           +IAV GD   + G +   +      
Sbjct: 51  ----LDSGTWGVMGIGMGYCVAAAAVTGK-----PVIAVEGDS--AFGFSGMELETICRY 99

Query: 167 KTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKA 226
              + VI+ +N           +  +       I  +     +                 
Sbjct: 100 NLPVTVIIMNNGGIYKGNEADPQPGV-------ISCTRLTRGRY------------DMMM 140

Query: 227 EDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKG 286
           E F              G       +    + L   L+ A  S    P +I+       G
Sbjct: 141 EAF--------------GGKGY-VANTP--AELKAALEEAVASG--KPCLINAMIDPDAG 181

Query: 287 Y 287
            
Sbjct: 182 V 182


>1l8aA3 [c.48.1.1] PYRUVATE DEHYDROGENASE E1 COMPONENT A:701 -- 886
          Length = 186

 Score = 67.1 bits (163), Expect = 2e-14
 Identities = 22/150 (14%), Positives = 47/150 (31%), Gaps = 17/150 (11%)

Query: 493 EIGKG-----RVIQEGKQVCILSIGTRLEECKIAAAELKN-KGIESTIVDARFAKPLDQE 546
            I KG      +     +V +L  G+ L   + AA  L    G+ S +        L ++
Sbjct: 8   GIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAEILAKDYGVGSDVYSVTSFTELARD 67

Query: 547 LILKCARE------HEAMITVEE----GSIGGFGSHVENLLSEKGIFDKGLKFRTMILPD 596
                            +  + +            +++    +   +     +R ++  D
Sbjct: 68  GQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPADDYR-VLGTD 126

Query: 597 IFIEQDSPKKMYDVAGLNASQISKKILDIL 626
            F   DS + +     ++AS +    L  L
Sbjct: 127 GFGRSDSRENLRHHFEVDASYVVVAALGEL 156


>1b0pA3 [c.48.1.3] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
           A:259 -- 415
          Length = 157

 Score = 61.5 bits (149), Expect = 8e-13
 Identities = 18/129 (13%), Positives = 37/129 (28%), Gaps = 3/129 (2%)

Query: 499 VIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELILKCAREHEAM 558
           V     +  I+S+G+  E  +     L  KG +  ++  R  +P   E           +
Sbjct: 6   VGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASAKV 65

Query: 559 ITVEE-GSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIEQDSPKKMYDVAGLNASQ 617
           ITV +     G       L       ++G     ++     +           +      
Sbjct: 66  ITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKS--VYDN 123

Query: 618 ISKKILDIL 626
           +S    +  
Sbjct: 124 MSGAKKNHF 132


>1bfdA3 [c.36.1.9] BENZOYLFORMATE DECARBOXYLASE A:342 -- 524
          Length = 183

 Score = 53.5 bits (128), Expect = 2e-10
 Identities = 31/195 (15%), Positives = 56/195 (28%), Gaps = 46/195 (23%)

Query: 91  IKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLNN----IIAVI 146
           I      +  +   +      +           +  LG A    +  +L      +IAVI
Sbjct: 30  IYLNESTSTTAQMWQ----RLNMRNPGSYYFCAAGGLGFALPAAIGVQLAEPERQVIAVI 85

Query: 147 GDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRE 206
           GDG+  A  +  A+  A       I ++ +N             + A +L  +    L  
Sbjct: 86  GDGS--ANYSISALWTAAQYNIPTIFVIMNNG------TYGALRWFAGVLEAENVPGLDV 137

Query: 207 TFKLIVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNA 266
                 +                         L    G   +      +L  L   L+ A
Sbjct: 138 PGIDFRA-------------------------LAKGYGVQAL---KADNLEQLKGSLQEA 169

Query: 267 RDSKHQGPIMIHIKT 281
             +K  GP++I + T
Sbjct: 170 LSAK--GPVLIEVST 182


>1upaA2 [c.36.1.5] CARBOXYETHYLARGININE SYNTHASE A:12 -- 197
          Length = 183

 Score = 48.9 bits (116), Expect = 6e-09
 Identities = 16/139 (11%), Positives = 36/139 (25%), Gaps = 5/139 (3%)

Query: 344 AMPGGTGMDIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQ-V 402
            + G     I   +     F +   E  A   A  LA    +P     +           
Sbjct: 21  GVVGREAASILFDEVEGIDFVLTRHEFTAGVAADVLARITGRPQACWATLGPGXTNLSTG 80

Query: 403 VHDVAIQSLPVRFIIDRAGLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNT 462
           +    +   PV  +  ++       +      D   +    +   +      E+  + ++
Sbjct: 81  IATSVLDRSPVIALAAQSESHDIFPNDTHQCLDSVAIVAPXSKYAVELQRPHEITDLVDS 140

Query: 463 SMTINNK----PCAIRYPR 477
           ++         P  I  P 
Sbjct: 141 AVNAAXTEPVGPSFISLPV 159


>3cr3C1 [c.54.1.2] PTS-DEPENDENT DIHYDROXYACETONE KINASE, C:3 -- 123
          Length = 121

 Score = 44.5 bits (105), Expect = 1e-07
 Identities = 15/126 (11%), Positives = 27/126 (21%), Gaps = 15/126 (11%)

Query: 506 VCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQEL-----ILKCAREHEAMIT 560
           + I+S    +            K I  T +       +          ++       +  
Sbjct: 3   IVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVXNAIEENEADNLLTF 62

Query: 561 VEEGSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIEQDSPKKMYDVAGLNASQISK 620
            + GS       V                   I     IE          AG     I +
Sbjct: 63  FDLGSARXNLDLVSE----------XTDKELTIFNVPLIEGAYTASALLEAGATFEAIKE 112

Query: 621 KILDIL 626
           ++   L
Sbjct: 113 QLEKXL 118


>1q18A2 [c.55.1.7] GLUCOKINASE A:112 -- 321
          Length = 210

 Score = 35.7 bits (82), Expect = 5e-05
 Identities = 23/133 (17%), Positives = 40/133 (30%), Gaps = 10/133 (7%)

Query: 301 SKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGMDIFAKDFPK 360
           ++   V+ E+V SG  L    +       +  E          A+         A     
Sbjct: 68  AEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFC 127

Query: 361 RMFDVGIAE-------QHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPV 413
            +                 V  A G+     + + A  S F     D+      +  +PV
Sbjct: 128 VIXGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKA--SGFRAAFEDKGRFKEYVHDIPV 185

Query: 414 RFII-DRAGLVGA 425
             I+ D  GL+G+
Sbjct: 186 YLIVHDNPGLLGS 198


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.319    0.139    0.394 

Gapped
Lambda     K      H
   0.267   0.0541    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 15,292,207
Number of extensions: 1085807
Number of successful extensions: 4196
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 3963
Number of HSP's successfully gapped: 143
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)