RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAZ21961.1 pubi0 nrdB GIB00256CH01 "ribonucleoside-diphosphate
reductase beta chain"
         (337 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1syyA [a.25.1.2] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN      244   9e-68
1kgnA [a.25.1.2] RIBONUCLEOTIDE REDUCTASE PROTEIN R2F                 236   4e-65
1h0nA [a.25.1.2] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE                 194   2e-52
1av8A [a.25.1.2] RIBONUCLEOTIDE REDUCTASE R2                          160   2e-42
1fyzC [a.25.1.2] METHANE MONOOXYGENASE COMPONENT A, BETA CHAIN        121   1e-30
1t0qB [a.25.1.2] TOLUENE, O-XYLENE MONOOXYGENASE OXYGENASE             99   9e-24
1za0A1 [a.25.1.2] POSSIBLE ACYL-[ACYL-CARRIER PROTEIN] DESATURAS...    44   4e-07

>1syyA [a.25.1.2] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN
          Length = 317

 Score =  244 bits (625), Expect = 9e-68
 Identities = 81/291 (27%), Positives = 139/291 (47%), Gaps = 18/291 (6%)

Query: 28  YKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKN-LTQSEKNLLTQIFRFFTQADV 86
             P +Y W ++ +L     +WLP E+P+G D+  W+ + L++ E+ ++     FF+ A+ 
Sbjct: 30  LVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKSDRLSEDERRVILLNLGFFSTAES 89

Query: 87  EVQ-NCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEY-------- 137
            V  N  L  +  V  P E    +   A  E VH   + ++ +++G+ E E         
Sbjct: 90  LVGNNIVLAIFKHVTNP-EARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIFNAYNERA 148

Query: 138 -----SAFXXXXXXXXXXXXXQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPR 192
                  F             +   +   ++    +  +    EG+  ++ F ++L+F R
Sbjct: 149 AIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKNLVGYYIIMEGIFFYSGFVMILSFHR 208

Query: 193 HNKMKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHED 252
            NKM G+G+   + +RDET+H N  I L      ENPEIWTPEL+ E+ +  +  ++ E 
Sbjct: 209 QNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEI 268

Query: 253 AFIDLAFEMGPMQGLTAQDVKLYIRFIANRRLSQLGLEPIYDVDKNPLTWL 303
            +       G + GL A     Y++ IA+RRL ++GL+PIY   KNP  W+
Sbjct: 269 EYAQDCLPRG-ILGLRASMFIDYVQHIADRRLERIGLKPIYHT-KNPFPWM 317


>1kgnA [a.25.1.2] RIBONUCLEOTIDE REDUCTASE PROTEIN R2F
          Length = 296

 Score =  236 bits (603), Expect = 4e-65
 Identities = 58/276 (21%), Positives = 107/276 (38%), Gaps = 10/276 (3%)

Query: 33  YPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSEKNLLTQIFRFFTQADVEVQNCY 92
                + W       WLPE++P+ +D++ W K +T  E+    ++F   T  D       
Sbjct: 25  DEKDLEVWDRLTGNFWLPEKIPVSNDIQSWNK-MTPQEQLATMRVFTGLTLLDTIQGTVG 83

Query: 93  LRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAFXXXXXXXXXXXX 152
                   +      + T  A ME+VH  +YS++  T+        AF            
Sbjct: 84  AISLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRK 143

Query: 153 XQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDETL 212
            +        D  L   V S   E    ++ F + +      K+     I+   +RDE++
Sbjct: 144 AKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDESV 203

Query: 213 HCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDV 272
           H   +   +++ + +  E    E KA  +     + E+E  + +  +      G T  DV
Sbjct: 204 HGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIY---DDLGWTE-DV 259

Query: 273 KLYIRFIANRRLSQLGLEPIYDVDKNP-----LTWL 303
           K ++R+ AN+ L+ LG E ++  D+       L+ L
Sbjct: 260 KRFLRYNANKALNNLGYEGLFPTDETKVSPAILSSL 295


>1h0nA [a.25.1.2] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE
          Length = 288

 Score =  194 bits (493), Expect = 2e-52
 Identities = 64/285 (22%), Positives = 112/285 (39%), Gaps = 15/285 (5%)

Query: 24  ENPVYKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSEKNLLTQIFRFFTQ 83
              V  P  Y   +  +   +   W  EEV L  D++ W+  L   E++ ++ +  FF  
Sbjct: 15  RRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA-LKPDERHFISHVLAFFAA 73

Query: 84  ADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESE----YSA 139
           +D  V    +  ++   + TE         +ME +H   YS L+DT      E    ++A
Sbjct: 74  SDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNA 133

Query: 140 FXXXXXXXXXXXXXQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGM 199
                           +    +      V  F A  EG+    SFA +    +   M G+
Sbjct: 134 IETMPCVKKKADWALRWIGDKEATYGERVVAF-AAVEGIFFSGSFASIFWLKKRGLMPGL 192

Query: 200 GQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAF 259
                   RDE LHC+    +FK  +H+  E         + +     +  E  F+  A 
Sbjct: 193 TFSNELISRDEGLHCDFACLMFKHLVHKPAE-------QRVREIITNAVRIEQEFLTEAL 245

Query: 260 EMGPMQGLTAQDVKLYIRFIANRRLSQLGLEPIYDVDKNPLTWLD 304
            +  + G+    +K YI F+A+R + +LG   I+ V +NP  +++
Sbjct: 246 PVK-LIGMNCTLMKQYIEFVADRLMLELGFNKIFRV-ENPFDFME 288


>1av8A [a.25.1.2] RIBONUCLEOTIDE REDUCTASE R2
          Length = 340

 Score =  160 bits (406), Expect = 2e-42
 Identities = 61/324 (18%), Positives = 106/324 (32%), Gaps = 38/324 (11%)

Query: 21  LLVENPV----YKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSEKNLLTQ 76
           +    PV    Y   +Y         Q    W PEEV +  D  D+Q  L + EK++   
Sbjct: 17  MFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHEKHIFIS 75

Query: 77  IFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIG-MPES 135
             ++ T  D             +    E+   +  +A  ET+H  +Y+H++  I   P  
Sbjct: 76  NLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV 135

Query: 136 EYSAFXXXXXXXXXXXXXQNFDMSSKKDIALTVA-------------------------- 169
            +                 ++     +  +                              
Sbjct: 136 VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYL 195

Query: 170 --VFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDETLHCNSMIRLFKEFIHE 227
             +     E ++ + SFA    F     M+G  +I+    RDE LH      +       
Sbjct: 196 CLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALHLTGTQHMLNLLRSG 255

Query: 228 NPEI----WTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIANRR 283
             +        E K E Y       + E  + D  F  G M GL    +  Y+ +I N R
Sbjct: 256 ADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYITNIR 315

Query: 284 LSQLGLEPIYDVDKNPLTWLDSML 307
           +  +GL+  +    NP+ W+++ L
Sbjct: 316 MQAVGLDLPFQTRSNPIPWINTWL 339


>1fyzC [a.25.1.2] METHANE MONOOXYGENASE COMPONENT A, BETA CHAIN
          Length = 388

 Score =  121 bits (304), Expect = 1e-30
 Identities = 16/289 (5%), Positives = 59/289 (20%), Gaps = 12/289 (4%)

Query: 30  PFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSEKNLLTQIFRFFTQADVEVQ 89
           P R           +   +    +          + +  + ++     +      +    
Sbjct: 100 PLRRWHAPYVKDKAEEWRYTDRFLQGYSADGQI-RAMNPTWRDEFINRYWGAFLFNEYGL 158

Query: 90  NCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAFXXXXXXXXX 149
                            + +  +   +             +      +            
Sbjct: 159 FNAHSQGAREALSDVTRVSLAFWGFDKIDIAQMIQLERGFLAKIVPGFDESTAVPKAEWT 218

Query: 150 XXXXQNFDMSSKKDIALTV--------AVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQ 201
                     + + +   V        +V + +      F                    
Sbjct: 219 NGEVYKSARLAVEGLWQEVFDWNESAFSVHAVYDALFGQFVRREFFQRLAPRFGDNLTPF 278

Query: 202 IVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEM 261
            +  +     +    +  L+   + ++PE ++   +  +       +E   A +     +
Sbjct: 279 FINQAQTYFQIAKQGVQDLYYNCLGDDPE-FSDYNRTVMRNWTGKWLEPTIAALRDFMGL 337

Query: 262 GPMQGLTAQDVKLYIRFIANRRLSQLGLEPIYDVD-KNPLTWLDSMLNA 309
              +       K  I     R +     +    +D K     +   + A
Sbjct: 338 F-AKLPAGTTDKEEITASLYRVVDDWIEDYASRIDFKADRDQIVKAVLA 385


>1t0qB [a.25.1.2] TOLUENE, O-XYLENE MONOOXYGENASE OXYGENASE
          Length = 322

 Score = 98.6 bits (245), Expect = 9e-24
 Identities = 29/283 (10%), Positives = 62/283 (21%), Gaps = 31/283 (10%)

Query: 26  PVYKPFRYPWCYDAW--LTQQRIHWLPEEVPLGDDVRDWQKN-------------LTQSE 70
                F  P  +D W                L D    + +              LT+  
Sbjct: 51  YKKYCFDSPLKHDDWNAFRDPDQLVYRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREW 110

Query: 71  KNLLTQIFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTI 130
              L + +         +Q   +     +   + +    T   +     +   ++    +
Sbjct: 111 VETLARFYTPARYLFHALQMGSVY-IHQIAPASTITNCATYETADHLRWLTHTAYRTREL 169

Query: 131 GMPESEYSAFXXXXXXXXXXXXXQNF-----DMSSKKDIALTVAVFSAFTEGLQLFASFA 185
                +                 Q F           D        +  T+     A   
Sbjct: 170 ANCYPDVGFGKRERDVWENDPAWQGFRELIEKALIAWDWGEAFTAINLVTKPAVEEALLQ 229

Query: 186 ILLNFPRHNKMKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACR 245
            L +  +      +G +     RD   H      L K  + +        L+  + K   
Sbjct: 230 QLGSLAQSEGDTLLGLLAQAQKRDAERHRRWSSALVKMALEKEG--NREVLQKWVAKWEP 287

Query: 246 TIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIANRRLSQLG 288
              +  +A+           G  A       +  +      +G
Sbjct: 288 LADKAIEAYCSAL-----PDGENAIV---EAKSASRYVRQMMG 322


>1za0A1 [a.25.1.2] POSSIBLE ACYL-[ACYL-CARRIER PROTEIN] DESATURASE
           A:8 -- 274
          Length = 242

 Score = 43.5 bits (102), Expect = 4e-07
 Identities = 15/168 (8%), Positives = 34/168 (20%), Gaps = 8/168 (4%)

Query: 79  RFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPE---- 134
              T+      +         F          + +++      A   LL           
Sbjct: 18  HLDTEDIWFAHDYVPFDQGENFAFLGGRDWDPSQSTLPRTITDACEILLILKDNDWWGRW 77

Query: 135 -SEYSAFXXXXXXXXXXXXXQN--FDMSSKKDIALTVAVFSAFTEGLQLFA-SFAILLNF 190
              ++A                   D  + +D+ +                       N 
Sbjct: 78  LGRWTAEEHLHAIALREYLVVTREVDPVANEDVRVKYTQVETLVYMAFYERCGAVFCRNL 137

Query: 191 PRHNKMKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKA 238
               +   +  ++    RDE  H      L    +    +     + A
Sbjct: 138 AAQIEEPILAGLIDRIARDEVRHEEFFANLVTHCLDYTRDETIAAIAA 185


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.318    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0498    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 18,192,240
Number of extensions: 1317013
Number of successful extensions: 5509
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5052
Number of HSP's successfully gapped: 196
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)