RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAZ22048.1 pubi0 yhdH GIB00256CH01 "zinc-binding alcohol
dehydrogenase"
         (333 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1o89A2 [c.2.1.1] YHDH A:116 -- 292                                    122   5e-31
1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A...   100   5e-24
1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323                         93   5e-22
1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --...    89   7e-21
1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294                   87   3e-20
1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294                       84   3e-19
1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339              82   9e-19
1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --...    77   3e-17
1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309                    75   1e-16
1pqwA [c.2.1.1] POLYKETIDE SYNTHASE                                    73   4e-16
1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329           73   7e-16
1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269                    72   1e-15
1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383                         70   3e-15
1e3jA1 [b.35.1.2] NADP(H)-DEPENDENT KETOSE REDUCTASE A:4 -- 142 ...    70   5e-15
1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327       69   8e-15
1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 13...    69   1e-14
1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326                    68   1e-14
1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 -...    68   2e-14
1o8cA2 [c.2.1.1] YHDH A:116 -- 192                                     68   2e-14
1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312       65   1e-13
2oplA1 [d.227.1.1] HYPOTHETICAL PROTEIN A:4 -- 185                     64   2e-13
1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 -...    63   5e-13
1gv8A [c.94.1.2] OVOTRANSFERRIN                                        61   2e-12
1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 ...    59   7e-12
1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A...    56   6e-11
1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A...    53   5e-10
1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- ...    53   7e-10
1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE- A...    52   1e-09
1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302        48   2e-08
1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 -- 605     43   5e-07
1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 -...    42   9e-07
1sb8A [c.2.1.2] WBPP                                                   42   1e-06
1qycA [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1            40   5e-06
2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336         40   6e-06
1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313     39   7e-06
1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:71...    39   1e-05
1vl0A [c.2.1.2] DTDP-4-DEHYDRORHAMNOSE REDUCTASE, RFBD ORTHOLOG        37   3e-05
1i24A [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1                   37   3e-05
2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215                37   3e-05
1k6iA [c.2.1.2] NMRA                                                   37   4e-05
1xq6A [c.2.1.2] UNKNOWN PROTEIN                                        37   4e-05
1a9yA [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE                              37   5e-05
1ujmA [c.2.1.2] ALDEHYDE REDUCTASE II                                  36   6e-05
2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374              35   1e-04
2b69A1 [c.2.1.2] UDP-GLUCURONATE DECARBOXYLASE 1 A:4 -- 315            34   2e-04
1tdjA1 [c.79.1.1] BIOSYNTHETIC THREONINE DEAMINASE A:5 -- 335          34   2e-04
1nasA [c.2.1.2] SEPIAPTERIN REDUCTASE                                  34   2e-04
1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127...    34   2e-04
1yb1A [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI           34   3e-04
2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:...    34   3e-04
1b8pA1 [c.2.1.5] PROTEIN (MALATE DEHYDROGENASE) A:3 -- 158             33   4e-04
1eq2A [c.2.1.2] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE               33   4e-04
1p9oA [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE                33   4e-04
1jr2A [c.113.1.1] UROPORPHYRINOGEN-III SYNTHASE                        33   5e-04
1db3A [c.2.1.2] GDP-MANNOSE 4,6-DEHYDRATASE                            33   5e-04
2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236              33   6e-04
1ae1A [c.2.1.2] TROPINONE REDUCTASE-I                                  33   7e-04
1xg5A [c.2.1.2] ARPG836                                                33   7e-04
1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 ...    32   8e-04
1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355               32   8e-04
1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTI...    32   9e-04
1zemA1 [c.2.1.2] XYLITOL DEHYDROGENASE A:3 -- 262                      32   9e-04
1snyA [c.2.1.2] SNIFFER CG10964-PA                                     32   0.001
1y81A1 [c.2.1.8] CONSERVED HYPOTHETICAL PROTEIN A:6 -- 121             32   0.001
1bxkA [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)                 32   0.001

>1o89A2 [c.2.1.1] YHDH A:116 -- 292
          Length = 177

 Score =  122 bits (308), Expect = 5e-31
 Identities = 74/176 (42%), Positives = 109/176 (61%), Gaps = 4/176 (2%)

Query: 120 ISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGY 179
           + +++AMI+GTAG TA+LC  A++    +   +    ++VTGASGGVGS AV +L+K GY
Sbjct: 1   LDARKAMIIGTAGFTAMLCVMALE-DAGVRPQDGE--IVVTGASGGVGSTAVALLHKLGY 57

Query: 180 DVTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQT 239
            V AV+G+    +YL+SLGA  ++ + +  +      +  W G +DTVG K+LA  LAQ 
Sbjct: 58  QVVAVSGRESTHEYLKSLGASRVLPRDEFAESRPLEKQV-WAGAIDTVGDKVLAKVLAQM 116

Query: 240 RDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLID 295
              G VAACG A  + L TTVMPFI+R V+L G++SV    +RR   W  + + + 
Sbjct: 117 NYGGCVAACGLAGGFTLPTTVMPFILRNVRLQGVDSVMTPPERRAQAWQRLVADLP 172


>1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A:17
           -- 250
          Length = 228

 Score = 99.5 bits (247), Expect = 5e-24
 Identities = 9/194 (4%), Positives = 33/194 (17%), Gaps = 12/194 (6%)

Query: 62  PHIPGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDIS 121
              P  +    +     +K+                   G+               + + 
Sbjct: 27  RTTPATELDAWL-----AKYPPSQVTRYGDPGSPNSEPVGWIAVYGQGYSPNSGDVQGLQ 81

Query: 122 SKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDV 181
           +    +  +           ++           K +        +      I        
Sbjct: 82  AAWEALQTSGRPI---TPGTLRQLAITHHVLSGKWLXHLAPGFKLDHAWAGIARAVVEGR 138

Query: 182 TAV-TGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGV---VDTVGGKILANALA 237
             V       ++  R +      +  D              G+   +           + 
Sbjct: 139 LQVAKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIRAAGIKCLLTYKPDVYTYLGIY 198

Query: 238 QTRDNGIVAACGNA 251
           +     +      +
Sbjct: 199 RANRWHLCPTLYES 212


>1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323
          Length = 143

 Score = 92.9 bits (230), Expect = 5e-22
 Identities = 54/134 (40%), Positives = 82/134 (61%), Gaps = 7/134 (5%)

Query: 21  VKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNSK 80
           V+++D+S L  GDV V V +S LNYKDAL +    K+++ FP IPGIDFAGTV  S++ +
Sbjct: 14  VQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFAGTVRTSEDPR 73

Query: 81  FIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSF 140
           F  G EV+LTGW VGE ++GG ++ A+V GD+LV  P+  ++K+  +         + + 
Sbjct: 74  FHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGQAAKEISLSEAPNFAEAIINN 133

Query: 141 AIKAREELLLGEKV 154
            I+       G  +
Sbjct: 134 QIQ-------GRTL 140


>1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --
           397
          Length = 201

 Score = 89.1 bits (220), Expect = 7e-21
 Identities = 21/212 (9%), Positives = 52/212 (24%), Gaps = 53/212 (25%)

Query: 6   KALVVNQ----ESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEF 61
           + +V       E +          +       V+++V  +++   D  ++        + 
Sbjct: 3   RGVVYLGSGKVEVQKIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTA--QV 60

Query: 62  PHIPGIDFAGTVLE--SDNSKFIKGDEVILT----------------------------- 90
             + G +  G V+E   D      GD V +                              
Sbjct: 61  GLVLGHEITGEVIEKGRDVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARAGG 120

Query: 91  --GWRVGEIYFGGYSQ--FAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSFAIKARE 146
             G+     + GG ++          L+K P    + + + +       +    ++    
Sbjct: 121 AYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKINIAEVVGVQV---ISLD--- 174

Query: 147 ELLLGEKVKDVLVTGASGGVGSIAVMILNKFG 178
                           +G      +     F 
Sbjct: 175 ------DAPRGYGEFDAGVPKKFVIDPHKTFS 200


>1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
          Length = 174

 Score = 87.1 bits (215), Expect = 3e-20
 Identities = 36/179 (20%), Positives = 74/179 (41%), Gaps = 11/179 (6%)

Query: 120 ISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGY 179
           +  KQ   +G    TA     A+     +  GE V   LV GASGGVG  A  I   +G 
Sbjct: 1   LDFKQGAAIGIPYFTAY---RALIHSACVKAGESV---LVHGASGGVGLAACQIARAYGL 54

Query: 180 DVTAVTGKAENEKYLRSLGAKNIINKADLD---KDARPLDKGLWDGVVDTVGGKILANAL 236
            +    G  E +K +   GA  + N  +++   K  + + +   D +++ +    L+  L
Sbjct: 55  KILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDL 114

Query: 237 AQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLID 295
           +     G V   G+    ++N      + +   + G+   +++ +  +     +++ ++
Sbjct: 115 SLLSHGGRVIVVGSRGTIEIN--PRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGME 171


>1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294
          Length = 182

 Score = 83.6 bits (206), Expect = 3e-19
 Identities = 46/188 (24%), Positives = 72/188 (38%), Gaps = 18/188 (9%)

Query: 117 PKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNK 176
           P  ++      +G  GLTA    F +     +  GE V   LV+ A+G VGS+   I   
Sbjct: 2   PLSLA---LGTIGMPGLTAY---FGLLEVCGVKGGETV---LVSAAAGAVGSVVGQIAKL 52

Query: 177 FGYDVTAVTGKAENEKYLRSLGAKNIINKAD---LDKDARPLDKGLWDGVVDTVGGKILA 233
            G  V    G  E   YL+ +G     N      L++  +      +D   D VGG+ L 
Sbjct: 53  KGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLN 112

Query: 234 NALAQTRDNGIVAACGNASDY------KLNTTVMPFIIRGVKLWGINSVTASIKRREFVW 287
             L+Q +D G +A CG  S Y          +    I + +++ G          RE   
Sbjct: 113 TVLSQMKDFGKIAICGAISVYNRMDQLPPGPSPESIIYKQLRIEGFIVYRWQGDVREKAL 172

Query: 288 NEVKSLID 295
            ++   + 
Sbjct: 173 RDLMKWVL 180


>1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
          Length = 176

 Score = 82.1 bits (202), Expect = 9e-19
 Identities = 22/178 (12%), Positives = 52/178 (29%), Gaps = 15/178 (8%)

Query: 124 QAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTA 183
           +  ++G    T      +     ++  G       V G  G   S+ +         +  
Sbjct: 5   KVCLIGCGFSTGY---GSAVKVAKVTQGSTC---AVFGLGGAGLSVIMGCKAAGAARIIG 58

Query: 184 VTGKAENEKYLRSLGAKNIINKADLDKDA----RPLDKGLWDGVVDTVGGK--ILANALA 237
           V    +     + +GA   +N  D  K        +  G  D   + +G    ++     
Sbjct: 59  VDINKDKFAKAKEVGATECVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSC 118

Query: 238 QTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLID 295
                G+    G   D +  +     ++ G    G  ++    K ++    ++ +   
Sbjct: 119 CQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKG--AIFGGFKSKDS-VPKLVADFM 173


>1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --
           386
          Length = 175

 Score = 76.8 bits (188), Expect = 3e-17
 Identities = 30/180 (16%), Positives = 52/180 (28%), Gaps = 25/180 (13%)

Query: 6   KALVVNQ---ESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNN--------- 53
           +A++  Q     +    +   ID   L   +V+V+   S +N  D   +           
Sbjct: 5   QAVLYTQHGEPKDVLFTQSFEIDDDNLAPNEVIVKTLGSPVNPSDINQIQGVYPSKPAKT 64

Query: 54  GAKLVKEFPHIPGIDFAGTVLES--DNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGD 111
                 E     G +    V++   + S    GD VI +        FG +   A  N D
Sbjct: 65  TGFGTTEPAAPCGNEGLFEVIKVGSNVSSLEAGDWVIPSHV-----NFGTWRTHALGNDD 119

Query: 112 YLVKKPKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAV 171
             +K P              GLT       +          ++       A+   G   +
Sbjct: 120 DFIKLPNPAQ--SKANGKPNGLTDAKSIETLYDG--TKPLHEL--YQDGVANSKDGKQLI 173


>1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
          Length = 166

 Score = 74.8 bits (183), Expect = 1e-16
 Identities = 31/155 (20%), Positives = 51/155 (32%), Gaps = 11/155 (7%)

Query: 120 ISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGY 179
           +   +   +  AG+T         AR         + V ++G  GG+G +AV      G 
Sbjct: 1   VEFAEIAPILCAGVTVYKGLKQTNARPG-------QWVAISGI-GGLGHVAVQYARAMGL 52

Query: 180 DVTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVV--DTVGGKILANALA 237
            V A+       +  R LGA   +N    D              V    V       A+ 
Sbjct: 53  HVAAIDIDDAKLELARKLGASLTVNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFGQAIG 112

Query: 238 QTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWG 272
             R  G +A  G        T +   +++G+ + G
Sbjct: 113 MARRGGTIALVGLPPG-DFPTPIFDVVLKGLHIAG 146


>1pqwA [c.2.1.1] POLYKETIDE SYNTHASE
          Length = 183

 Score = 73.2 bits (179), Expect = 4e-16
 Identities = 33/191 (17%), Positives = 69/191 (36%), Gaps = 16/191 (8%)

Query: 124 QAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTA 183
           +A   G A LTA     ++     L  GE+V   L+  A+GGVG  AV I    G  +  
Sbjct: 2   EAATFGVAYLTAW---HSLCEVGRLSPGERV---LIHSATGGVGMAAVSIAKMIGARIYT 55

Query: 184 VTGKAENEKYLRSLGAKNIINKADL---DKDARPLDKGLWDGVVDTVGGKILANALAQTR 240
             G     + L  LG + + +   +   D+     D    D V++++ G+ +   +    
Sbjct: 56  TAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILA 115

Query: 241 DNGIVAACGNASDYKLNTTVMPFIIRGVKLWGIN---SVTASIKRREFVWNEVKSLIDFE 297
             G     G    Y   +  +  + +      ++   ++     R   +   +   +   
Sbjct: 116 PGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVA-- 173

Query: 298 QLEKSIKTVSL 308
             +  ++ + +
Sbjct: 174 --DGKLEVLPV 182


>1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329
          Length = 147

 Score = 72.5 bits (177), Expect = 7e-16
 Identities = 23/158 (14%), Positives = 50/158 (31%), Gaps = 19/158 (12%)

Query: 1   MSDNFKALVVNQESENFTR----EVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAK 56
           M    K+  + +  +        E+K+++   LK+G+VL++  +  ++    +      +
Sbjct: 1   MVKA-KSWTLKKHFQGKPTQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKE 59

Query: 57  LVKEFPHIPGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKK 116
                  + G   A  V+ES NS F  G  V+          +  +        + L+ +
Sbjct: 60  ----GAVMMGQQVAR-VVESKNSAFPAGSIVLAQSG------WTTHFISDGKGLEKLLTE 108

Query: 117 PKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKV 154
             D   +    +            A           K 
Sbjct: 109 WPDKKIQYHEHVTKGFENMP---AAFIEMLNGANLGKA 143


>1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269
          Length = 168

 Score = 71.6 bits (175), Expect = 1e-15
 Identities = 39/179 (21%), Positives = 63/179 (35%), Gaps = 19/179 (10%)

Query: 121 SSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYD 180
           S ++A     + LTA     A+K R +   GEKV   LV  A+G +G+ AV +    G  
Sbjct: 2   SPEEAAAFPVSFLTAY---LALK-RAQARPGEKV---LVQAAAGALGTAAVQVARAMGLR 54

Query: 181 VTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTR 240
           V A   + E      +LGA+     A   +            +V  V GK +  +L    
Sbjct: 55  VLAAASRPEKLALPLALGAE---EAATYAEVPERAKAWGGLDLVLEVRGKEVEESLGLLA 111

Query: 241 DNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRR----EFVWNEVKSLID 295
             G +   G A         +  + R + + G       + R     E     +   + 
Sbjct: 112 HGGRLVYIGAAEAP---IPPLRLMRRNLAVLG--FWLTPLLREGALVEEALGFLLPRLG 165


>1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383
          Length = 382

 Score = 70.2 bits (171), Expect = 3e-15
 Identities = 21/192 (10%), Positives = 46/192 (23%), Gaps = 21/192 (10%)

Query: 32  GDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGID-----------FAGTVLESDNSK 80
           G   ++     L   +A  L N     +    +  I                 L      
Sbjct: 17  GFSYLENAREVLRSGEARCLGNPRSEPEYVKALYVIGASRIPVGDGCSHTLEELG-VFDI 75

Query: 81  FIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSF 140
            + G+ V  +     E         +++     V+    +         +  +       
Sbjct: 76  SVPGEMVFPSPLDFFERGKPTPLVRSRLQLPNGVRVWLKLEWYNPF---SLSVKDRPAVE 132

Query: 141 AIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAV---TGKAENEKYLRSL 197
            I      +    +   +    S   G     +   +GY          +   +   R L
Sbjct: 133 IISRLSRRVEKGSL---VADATSSNFGVALSAVARLYGYRARVYLPGAAEEFGKLLPRLL 189

Query: 198 GAKNIINKADLD 209
           GA+ I++     
Sbjct: 190 GAQVIVDPEAPS 201


>1e3jA1 [b.35.1.2] NADP(H)-DEPENDENT KETOSE REDUCTASE A:4 -- 142
           A:313 -- 351
          Length = 178

 Score = 69.5 bits (169), Expect = 5e-15
 Identities = 29/187 (15%), Positives = 59/187 (31%), Gaps = 37/187 (19%)

Query: 3   DNFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNG--AKLVKE 60
           DN  A++  Q        ++       K  +VL+Q+ Y  +   D     +G  A  + +
Sbjct: 1   DNLSAVLYKQN----DLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADFIVK 56

Query: 61  FPHIPGIDFAGTVLE--SDNSKFIKGDEVILT----------------------GWRVGE 96
            P + G + +GTV++   +     KGD V +                        +    
Sbjct: 57  DPMVIGHEASGTVVKVGKNVKHLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDLTFCATP 116

Query: 97  IYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKD 156
              G  +++     D+  K P + + KQ +         +    A +             
Sbjct: 117 PDDGNLARYYVHAADFCHKLPDNCNVKQLVTHSFKLEQTV---DAFE-AARKKADNT--- 169

Query: 157 VLVTGAS 163
           + V  + 
Sbjct: 170 IKVMISC 176


>1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327
          Length = 147

 Score = 69.0 bits (168), Expect = 8e-15
 Identities = 24/151 (15%), Positives = 43/151 (28%), Gaps = 10/151 (6%)

Query: 6   KALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIP 65
             +  ++       +      +     ++ V+     +N+ D  I + G       P   
Sbjct: 2   TRIEFHKHGGPEVLQAVEFTPADPAENEIQVENKAIGINFIDTYIRS-GLYPPPSLPSGL 60

Query: 66  GIDFAGTVLE--SDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSK 123
           G + AG V +  S       GD V+           G YS    +  D     P  I   
Sbjct: 61  GTEAAGIVSKVGSGVKHIKAGDRVVYAQSA-----LGAYSSVHNIIADKAAILPAAIKVD 115

Query: 124 QAMILGTAGLTALLCSFAIKAREELLLGEKV 154
            A         A      +++R     G  +
Sbjct: 116 VAEQQKYPLKDAQRAHEILESR--ATQGSSL 144


>1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 139
           A:314 -- 352
          Length = 178

 Score = 68.5 bits (167), Expect = 1e-14
 Identities = 32/185 (17%), Positives = 58/185 (31%), Gaps = 37/185 (20%)

Query: 6   KALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIP 65
           K   +              +K      D +V+         D   +  GA   +    I 
Sbjct: 2   KGFAML---SIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGER-HNMIL 57

Query: 66  GIDFAGTVLE--SDNSKFIKGDEVI------------------------LTGWRVGEIYF 99
           G +  G V+E  S+   F  GD V+                        L GW+   +  
Sbjct: 58  GHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKD 117

Query: 100 GGYSQFAKVN--GDYLVKKPKDISSKQAMILGTAGLTALLCSF-AIKAREELLLGEKVKD 156
           G + +F  VN     L   PK++   + +     G   +  +F  +K +      + +K 
Sbjct: 118 GVFGEFFHVNDADMNLAHLPKEVDPSKLVTHVFRGFDNIEKAFMLMKDKP----KDLIKP 173

Query: 157 VLVTG 161
           V++  
Sbjct: 174 VVILA 178


>1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326
          Length = 172

 Score = 68.1 bits (166), Expect = 1e-14
 Identities = 33/158 (20%), Positives = 54/158 (34%), Gaps = 12/158 (7%)

Query: 119 DISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFG 178
                +   L  AG+TA     A+K     L       V + G  GG+G IAV +L    
Sbjct: 3   REKLVEMAPLADAGITAY---RAVKKAARTLYPGAY--VAIVGV-GGLGHIAVQLLKVMT 56

Query: 179 -YDVTAVTGKAENEKYLRSLGAKNIIN--KADLDKDARPLDKGLWDGVVDTVGGKIL-AN 234
              V A+  K E  K    LGA ++++  +  + +          +  +D VG +     
Sbjct: 57  PATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRGRGVNVAMDFVGSQATVDY 116

Query: 235 ALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWG 272
                   G +   G   + +     +  I   V   G
Sbjct: 117 TPYLLGRMGRLIIVGYGGELRFP--TIRVISSEVSFEG 152


>1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 --
           124 A:312 -- 351
          Length = 166

 Score = 67.8 bits (165), Expect = 2e-14
 Identities = 28/155 (18%), Positives = 39/155 (25%), Gaps = 30/155 (19%)

Query: 29  LKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDF----AGTVLESDNSKFIKG 84
           L  G V V+  Y  ++       N         P            G V ES + K  KG
Sbjct: 36  LNEGQVQVRTLYLSVDPYXRCKXNEDTGTDYLAPWQLAQVADGGGIGIVEESKHQKLAKG 95

Query: 85  DEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQ-AMILGTAGLTALLCSFAIK 143
           D V          ++  +   A ++G+ L K    +            GL          
Sbjct: 96  DFVT--------SFYWPWQTKAILDGNGLEKVDPQLVDGLKVKETVAKGLENX------- 140

Query: 144 AREELLLGEKVKDVLVTGASGGVGSIAVMILNKFG 178
                  G            G VG   V I     
Sbjct: 141 -------GVAF---QSXXTGGNVGKQIVCISEDSS 165


>1o8cA2 [c.2.1.1] YHDH A:116 -- 192
          Length = 77

 Score = 67.6 bits (165), Expect = 2e-14
 Identities = 38/80 (47%), Positives = 55/80 (68%), Gaps = 3/80 (3%)

Query: 120 ISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGY 179
           + +++AMI+GTAG TA+LC  A+     +   +    ++VTGASGGVGS AV +L+K GY
Sbjct: 1   LDARKAMIIGTAGFTAMLCVMAL-EDAGVRPQDGE--IVVTGASGGVGSTAVALLHKLGY 57

Query: 180 DVTAVTGKAENEKYLRSLGA 199
            V AV+G+    +YL+SLGA
Sbjct: 58  QVVAVSGRESTHEYLKSLGA 77


>1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
          Length = 170

 Score = 65.0 bits (158), Expect = 1e-13
 Identities = 16/157 (10%), Positives = 44/157 (28%), Gaps = 15/157 (9%)

Query: 124 QAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTA 183
           +   L       +    A +       G ++   ++   +G +G ++V+    +G  V  
Sbjct: 4   EEGALLEPLSVGV---HACRR-----AGVQLGTTVLVIGAGPIGLVSVLAAKAYGAFVVC 55

Query: 184 VTGKAENEKYLRSLGAKNIINKADLDKDA-------RPLDKGLWDGVVDTVGGKILANAL 236
                   +  ++ GA   +      ++        R     L +  +D  G +      
Sbjct: 56  TARSPRRLEVAKNCGADVTLVVDPAKEEESSIIERIRSAIGDLPNVTIDCSGNEKCITIG 115

Query: 237 AQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGI 273
                 G            +   ++    R + +  +
Sbjct: 116 INITRTGGTLMLVGMGSQMVTVPLVNACAREIDIKSV 152


>2oplA1 [d.227.1.1] HYPOTHETICAL PROTEIN A:4 -- 185
          Length = 181

 Score = 64.3 bits (156), Expect = 2e-13
 Identities = 18/148 (12%), Positives = 36/148 (24%), Gaps = 15/148 (10%)

Query: 43  LNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGY 102
           +N  +   L    + +K  P I    F  T                      G       
Sbjct: 4   VNGVNVDQLXATIEQIKAKPEIAQFKFRATNQWXGG-----THNQATIKDFYGAXAEDDT 58

Query: 103 SQFAKVNGDYLV---KKPKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKD--V 157
            +    + D       + +  +  + +++  +G           AR     G  ++    
Sbjct: 59  RKPXVFDLDEPPVLLGENRGANPVEYLLVALSGCLTTSLVAHAAAR-----GIALRGVKS 113

Query: 158 LVTGASGGVGSIAVMILNKFGYDVTAVT 185
              G     G + +      GY    V 
Sbjct: 114 RYEGDIDLRGFLGLSEEVPVGYREIRVF 141


>1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 --
           374
          Length = 198

 Score = 62.9 bits (152), Expect = 5e-13
 Identities = 27/132 (20%), Positives = 50/132 (37%), Gaps = 11/132 (8%)

Query: 6   KALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIP 65
           KA V+ +E + F   ++ ++ +  K  +V +++  + +   D  +++    LV   P I 
Sbjct: 10  KAAVLWEEKKPF--SIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG--TLVTPLPVIA 65

Query: 66  GIDFAGTVLE--SDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSK 123
           G + AG V       +    GD+VI            G  +  K        K      +
Sbjct: 66  GHEAAGIVESIGEGVTTVRPGDKVIPLWT-----PQCGKCRVCKHPEGNFCLKNDLSMPR 120

Query: 124 QAMILGTAGLTA 135
             M  GT+  T 
Sbjct: 121 GTMQDGTSRFTC 132


>1gv8A [c.94.1.2] OVOTRANSFERRIN
          Length = 160

 Score = 61.0 bits (147), Expect = 2e-12
 Identities = 10/165 (6%), Positives = 31/165 (18%), Gaps = 20/165 (12%)

Query: 21  VKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGT--VLESDN 78
             ++         ++  +      +                  I  +   G       ++
Sbjct: 2   YYAVAVVKKGTDFMIKDLRGKTSCHTGLGRSAG------WNIPIGTLIHRGDIEWEGIES 55

Query: 79  SKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLC 138
               +                   +   +          K    + A   G +G    L 
Sbjct: 56  GSVEQAVAKFF-SASC-----VPGATTEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQCLK 109

Query: 139 SFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTA 183
                   +  +       +   A        ++ L+     V +
Sbjct: 110 DG------KGDVAFVKHTTVQENAPEEKDEYELLCLDGTRQPVDS 148


>1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 --
           371
          Length = 188

 Score = 59.1 bits (142), Expect = 7e-12
 Identities = 29/195 (14%), Positives = 64/195 (32%), Gaps = 50/195 (25%)

Query: 6   KALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIP 65
            A V   +  +F  E++++     +  +VLV+V  + + + D ++ +   K     P + 
Sbjct: 5   IAAVTPCKGADF--ELQALKIRQPQGDEVLVKVVATGMCHTDLIVRD--QKYPVPLPAVL 60

Query: 66  GIDFAGTVLE--SDNSKFIKGDEVILTGWRVGEIYF------------------------ 99
           G + +G +     + ++   GD V+L+    G+                           
Sbjct: 61  GHEGSGIIEAIGPNVTELQVGDHVVLSYGYCGKCTQCNTGNPAYCSEFFGRNFSGADSEG 120

Query: 100 -------------GGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSFAIKARE 146
                          ++ +A    +  VK  KD    Q +              AI +R+
Sbjct: 121 NHALCVNDHFFAQSSFATYALSRENNTVKVTKDFPFDQLVKFYAFDEIN---QAAIDSRK 177

Query: 147 ELLLGEKVKDVLVTG 161
               G  +K ++   
Sbjct: 178 ----GITLKPIIKIA 188


>1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A:3
           -- 144 A:313 -- 349
          Length = 178

 Score = 56.0 bits (134), Expect = 6e-11
 Identities = 27/172 (15%), Positives = 47/172 (27%), Gaps = 36/172 (20%)

Query: 6   KALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIP 65
           KA+      +    E   I +      DV +++ Y  + + D             +P +P
Sbjct: 2   KAVGAYSAKQPL--EPMDITRREPGPNDVKIEIAYCGVCHSDLHQ-VRSEWAGTVYPCVP 58

Query: 66  GIDFAGTVLE--SDNSKFIKGDEVILTGWRV----------------------------- 94
           G +  G V+       K+  GD V +                                  
Sbjct: 59  GHEIVGRVVAVGDQVEKYAPGDLVGVGCIVDSCKHCEECEDGLENYCDHMTGTYNSPTPD 118

Query: 95  -GEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSFAIKAR 145
                 GGYSQ   V+  Y+++                    +L    +K R
Sbjct: 119 EPGHTLGGYSQQIVVHERYVLRIRVADIEMIRADQINEAYERMLRG-DVKYR 169


>1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
           -- 127
          Length = 127

 Score = 53.2 bits (127), Expect = 5e-10
 Identities = 17/107 (15%), Positives = 32/107 (29%), Gaps = 12/107 (11%)

Query: 157 VLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYL-RSLGAKNIINKADLDKDARP- 214
           +L+ GA G +        +  G        +         S  A  + +    D      
Sbjct: 10  ILILGA-GPIVIGQACEFDYSGAQACKALREEGYRVINVNSNPATIMTDPEMADATYIEP 68

Query: 215 ---------LDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNAS 252
                    ++K   D V+ T+GG+   N   +    G++   G   
Sbjct: 69  IHWEVVRKIIEKERPDAVLPTMGGQTALNCALELERQGVLEEFGVTM 115


>1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- 155
           A:338 -- 367
          Length = 184

 Score = 52.6 bits (125), Expect = 7e-10
 Identities = 27/173 (15%), Positives = 55/173 (31%), Gaps = 7/173 (4%)

Query: 1   MSDNFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKE 60
           M     A+V+ + ++      K  + S +  G +LV++  + +   D  +   G      
Sbjct: 1   MGLKAHAMVLEKFNQPL--VYKEFEISDIPRGSILVEILSAGVCGSDVHMF-RGEDPRVP 57

Query: 61  FPHIPGIDFAGTVLE--SDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPK 118
            P I G + AG V+E   +                       G   + KV+ +  +   +
Sbjct: 58  LPIILGHEGAGRVVEVNGEKRDLNGELLKPGDLIVWNRGITCGECYWCKVSKEPYLCPNR 117

Query: 119 DISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAV 171
            +            L     S  +   E  +L  KV + +         + A+
Sbjct: 118 KVYGINRGCSEYPHLRGCYSSHIVLDPETDVL--KVSEKITHRLPLKEANKAL 168


>1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
           A:153 -- 320
          Length = 168

 Score = 52.0 bits (125), Expect = 1e-09
 Identities = 25/144 (17%), Positives = 51/144 (35%), Gaps = 15/144 (10%)

Query: 164 GGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGV 223
           GG+GS+  +I    G +   ++  +   +    +GA + I   + + D        +D +
Sbjct: 37  GGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLE-EGDWGEKYFDTFDLI 95

Query: 224 VDTVGGKI---LANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASI 280
           V                  +  G + +     +     ++ P+ ++ V +    S   SI
Sbjct: 96  VVCASSLTDIDFNIMPKAMKVGGRIVSIS-IPEQHEMLSLKPYGLKAVSISY--SALGSI 152

Query: 281 KRREFVWNEVKSLIDFEQLEKSIK 304
           K       E+  L+     EK IK
Sbjct: 153 K-------ELNQLLKLVS-EKDIK 168


>1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302
          Length = 131

 Score = 47.9 bits (114), Expect = 2e-08
 Identities = 24/113 (21%), Positives = 43/113 (38%), Gaps = 19/113 (16%)

Query: 6   KALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIP 65
           KA V+ +       E+  + +   + G+V+++V+   LN+ D L+           P IP
Sbjct: 2   KAWVLKRLGGPL--ELVDLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIP 59

Query: 66  GIDFAGTVLESDNSKFIKGDEV-ILTGWRVGEIYFGGYSQFAKVNGDYLVKKP 117
           G++  G V         +G     L          GG ++   V    L+  P
Sbjct: 60  GMEVVGVV---------EGRRYAALVPQ-------GGLAERVAVPKGALLPLP 96


>1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 -- 605
          Length = 395

 Score = 43.0 bits (99), Expect = 5e-07
 Identities = 11/78 (14%), Positives = 20/78 (25%), Gaps = 7/78 (8%)

Query: 105 FAKVNGDYLVKKPKDISSKQAMI-LGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGAS 163
           F  V  + + K   D  +   +   GTA L  ++          L   +  +  +   A 
Sbjct: 7   FMLVVREKVNKLRNDPVAGGGLPKYGTAVLVNII------NENGLYPVKNFQTGVYPYAY 60

Query: 164 GGVGSIAVMILNKFGYDV 181
              G              
Sbjct: 61  EQSGEAMAAKYLVRNKPC 78


>1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
           214
          Length = 128

 Score = 42.2 bits (98), Expect = 9e-07
 Identities = 11/72 (15%), Positives = 23/72 (31%)

Query: 157 VLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLD 216
             + G SG +G     + ++ G+++         E+        +  +   L K      
Sbjct: 3   YGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELDSPDVVIDFSSPEALPKTVDLCK 62

Query: 217 KGLWDGVVDTVG 228
           K     V+ T  
Sbjct: 63  KYRAGLVLGTTA 74


>1sb8A [c.2.1.2] WBPP
          Length = 341

 Score = 41.8 bits (97), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 34/77 (44%), Gaps = 7/77 (9%)

Query: 145 REELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAV----TGKAENEKYLRSL-GA 199
           R+EL    KV   L+TG +G +GS  +  L K    V  +    TG   N   +RSL   
Sbjct: 9   RKELPAQPKV--WLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEVRSLVSE 66

Query: 200 KNIINKADLDKDARPLD 216
           K   N   +  D R LD
Sbjct: 67  KQWSNFKFIQGDIRNLD 83


>1qycA [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
          Length = 307

 Score = 39.8 bits (91), Expect = 5e-06
 Identities = 6/53 (11%), Positives = 15/53 (28%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKAD 207
             +L+ GA+G +G          G+    +  ++                 + 
Sbjct: 4   SRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASG 56


>2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
          Length = 144

 Score = 39.5 bits (92), Expect = 6e-06
 Identities = 10/57 (17%), Positives = 21/57 (36%), Gaps = 3/57 (5%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAV---TGKAENEKYLRSLGAKNIINKADL 208
            +V V GA+G VG   V +L++  + +  +          +      +   +   D 
Sbjct: 3   LNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRXGFAESSLRVGDVDS 59


>1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313
          Length = 174

 Score = 39.2 bits (91), Expect = 7e-06
 Identities = 29/161 (18%), Positives = 58/161 (36%), Gaps = 16/161 (9%)

Query: 120 ISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMIL-NKFG 178
           I  + A+++     T     F      ++ LG  V    V G  G VG +AV     +  
Sbjct: 1   IPLEAAVMIPDMMTTG----FHGAELADIELGATV---AVLGI-GPVGLMAVAGAKLRGA 52

Query: 179 YDVTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLD----KGLWDGVVDTVGGKILAN 234
             + AV  +       +  GA +I+N  D   +++ ++    KG+   ++      I+A 
Sbjct: 53  GRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMAT 112

Query: 235 ALAQTRDNGIVAACGNASD---YKLNTTVMPFIIRGVKLWG 272
           A+   +  G +A      +     +        +    + G
Sbjct: 113 AVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKG 153


>1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
           -- 745
          Length = 136

 Score = 38.8 bits (89), Expect = 1e-05
 Identities = 13/89 (14%), Positives = 23/89 (25%), Gaps = 4/89 (4%)

Query: 157 VLVTGASGGVGSIAVMILNKFGYDVTAV----TGKAENEKYLRSLGAKNIINKADLDKDA 212
           V V GA G VG+  V  +        +                +    +  +   +  + 
Sbjct: 3   VGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNL 62

Query: 213 RPLDKGLWDGVVDTVGGKILANALAQTRD 241
             L       VV T G         ++  
Sbjct: 63  EFLIDNGIHAVVGTTGFTAERFQQVESWL 91


>1vl0A [c.2.1.2] DTDP-4-DEHYDRORHAMNOSE REDUCTASE, RFBD ORTHOLOG
          Length = 281

 Score = 37.3 bits (86), Expect = 3e-05
 Identities = 40/202 (19%), Positives = 68/202 (33%), Gaps = 31/202 (15%)

Query: 157 VLVTGASGGVGSIAVMILNKFGYDVTA-------VTGKAENEKYLRSLGAKNIINKADLD 209
           +L+TGA+G +G      L     +V         +T      K+        +IN A   
Sbjct: 4   ILITGANGQLGREIQKQLKGKNVEVIPTDVQDLDITNVLAVNKFFNEKKPNVVINCAAHT 63

Query: 210 KDARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACG------NASDYKLNTTVMPF 263
              +  ++      ++ +G K LA A        +  +                  V P 
Sbjct: 64  AVDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQISTDYVFDGEAKEPITEFDEVNPQ 123

Query: 264 IIRGV-KLWGINSVTAS-----IKRREFVW----NEVKSLIDFEQLEKSIKTV------- 306
              G  KL G N V A      I R  +++    N VK+ I+  +    +K V       
Sbjct: 124 SAYGKTKLEGENFVKALNPKYYIVRTAWLYGDGNNFVKTXINLGKTHDELKVVHDQVGTP 183

Query: 307 -SLEDLIDIYPKMLKGETSGRY 327
            S  DL  +  K++  +  G +
Sbjct: 184 TSTVDLARVVLKVIDEKNYGTF 205


>1i24A [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
          Length = 392

 Score = 37.2 bits (84), Expect = 3e-05
 Identities = 15/62 (24%), Positives = 23/62 (37%), Gaps = 4/62 (6%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAV----TGKAENEKYLRSLGAKNIINKADLDK 210
             V+V G  G  G    + L+K  Y+V  V        +++  L SL     I+      
Sbjct: 2   SRVMVIGGDGYCGWATALHLSKKNYEVCIVDNLVRRLFDHQLGLESLTPIASIHDRISRW 61

Query: 211 DA 212
            A
Sbjct: 62  KA 63


>2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
          Length = 208

 Score = 36.9 bits (84), Expect = 3e-05
 Identities = 7/30 (23%), Positives = 12/30 (40%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAV 184
           K VL+ GA+G  G   +  +         +
Sbjct: 3   KRVLLAGATGLTGEHLLDRILSEPTLAKVI 32


>1k6iA [c.2.1.2] NMRA
          Length = 318

 Score = 36.7 bits (83), Expect = 4e-05
 Identities = 8/51 (15%), Positives = 18/51 (35%)

Query: 152 EKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNI 202
           ++ K + V  A+G   +  + +    G+ V A     +           N+
Sbjct: 1   QQKKTIAVVNATGRQAASLIRVAAAVGHHVRAQVHSLKGLIAEELQAIPNV 51


>1xq6A [c.2.1.2] UNKNOWN PROTEIN
          Length = 253

 Score = 36.6 bits (84), Expect = 4e-05
 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 1/54 (1%)

Query: 157 VLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDK 210
           VLVTGASG  G I    L + G D     G   + +    +G +  +   D+  
Sbjct: 7   VLVTGASGRTGQIVYKKLKE-GSDKFVAKGLVRSAQGKEKIGGEADVFIGDITD 59


>1a9yA [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE
          Length = 338

 Score = 36.5 bits (82), Expect = 5e-05
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 157 VLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYL 194
           VLVTG SG +GS   + L + G+DV  +     +++ +
Sbjct: 3   VLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSV 40


>1ujmA [c.2.1.2] ALDEHYDE REDUCTASE II
          Length = 342

 Score = 36.1 bits (81), Expect = 6e-05
 Identities = 30/133 (22%), Positives = 43/133 (32%), Gaps = 1/133 (0%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDKDARP 214
             VLVTGA+G V S  V  L + GY V      A     L+         + +       
Sbjct: 12  SLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDX 71

Query: 215 LDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGIN 274
           L +G +D V+      +   A   +  N        A    LN          VK + + 
Sbjct: 72  LKQGAYDEVIKGA-AGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLT 130

Query: 275 SVTASIKRREFVW 287
           S T S    +   
Sbjct: 131 SSTVSALIPKPNV 143


>2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
          Length = 362

 Score = 35.1 bits (79), Expect = 1e-04
 Identities = 8/27 (29%), Positives = 12/27 (44%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDV 181
             + +TGA G + S     L   G+ V
Sbjct: 16  LKISITGAGGFIASHIARRLKHEGHYV 42


>2b69A1 [c.2.1.2] UDP-GLUCURONATE DECARBOXYLASE 1 A:4 -- 315
          Length = 312

 Score = 34.3 bits (77), Expect = 2e-04
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAV----TGKAENEKYLRSLGAKNIINKADLDK 210
           K +L+TG +G VGS     L   G++VT V    TG+  N ++        +IN   ++ 
Sbjct: 2   KRILITGGAGFVGSHLTDKLXXDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEP 61

Query: 211 DARPLD 216
               +D
Sbjct: 62  LYIEVD 67


>1tdjA1 [c.79.1.1] BIOSYNTHETIC THREONINE DEAMINASE A:5 -- 335
          Length = 331

 Score = 34.2 bits (78), Expect = 2e-04
 Identities = 14/66 (21%), Positives = 23/66 (34%), Gaps = 4/66 (6%)

Query: 148 LLLGEKVKDVLVTGASGGVGSIAV-MILNKFGYDVTAVTGK---AENEKYLRSLGAKNII 203
             L E+ K   V  AS G  +  V     + G     V            +R  G + ++
Sbjct: 67  AGLTEEQKAHGVITASAGNHAQGVAFSSARLGVKALIVMPTATADIKVDAVRGFGGEVLL 126

Query: 204 NKADLD 209
           + A+ D
Sbjct: 127 HGANFD 132


>1nasA [c.2.1.2] SEPIAPTERIN REDUCTASE
          Length = 259

 Score = 34.2 bits (77), Expect = 2e-04
 Identities = 19/99 (19%), Positives = 31/99 (31%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDKDARP 214
              ++TGAS G G      L +     + +   A +E  LR L  +    + DL      
Sbjct: 7   AVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAA 66

Query: 215 LDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASD 253
            D G   GV   +            +   ++       D
Sbjct: 67  ADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGD 105


>1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127 --
           296
          Length = 160

 Score = 34.1 bits (77), Expect = 2e-04
 Identities = 14/97 (14%), Positives = 25/97 (25%), Gaps = 4/97 (4%)

Query: 132 GLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAEN- 190
             T   C   IK     +     +  +V G S  VG+    +L      VT    K  + 
Sbjct: 20  PCTPKGCLELIKETGVPI---AGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHL 76

Query: 191 EKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTV 227
           ++ +       +            +  G         
Sbjct: 77  DEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGIN 113


>1yb1A [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
          Length = 243

 Score = 34.0 bits (77), Expect = 3e-04
 Identities = 15/62 (24%), Positives = 21/62 (33%), Gaps = 4/62 (6%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVT----GKAENEKYLRSLGAKNIINKADLDK 210
           + VL+TGA  G+G +      K    +        G  E     + LGAK      D   
Sbjct: 8   EIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSN 67

Query: 211 DA 212
             
Sbjct: 68  RE 69


>2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
           -- 158
          Length = 142

 Score = 33.9 bits (77), Expect = 3e-04
 Identities = 2/64 (3%), Positives = 8/64 (12%), Gaps = 6/64 (9%)

Query: 149 LLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAV----TGKAENEKYLRSLGAKNIIN 204
           +    +        S         ++                          + A     
Sbjct: 16  VEHATI--YGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARGVTAPIAAAGYQL 73

Query: 205 KADL 208
              +
Sbjct: 74  PMQV 77


>1b8pA1 [c.2.1.5] PROTEIN (MALATE DEHYDROGENASE) A:3 -- 158
          Length = 156

 Score = 33.5 bits (75), Expect = 4e-04
 Identities = 6/27 (22%), Positives = 10/27 (37%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDV 181
             V VTGA+G +    +  +       
Sbjct: 4   MRVAVTGAAGQICYSLLFRIANGDMLG 30


>1eq2A [c.2.1.2] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
          Length = 273

 Score = 33.4 bits (74), Expect = 4e-04
 Identities = 11/38 (28%), Positives = 17/38 (44%)

Query: 157 VLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYL 194
           ++VTG +G +GS  V  LN  G     V    ++    
Sbjct: 2   IIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKF 39


>1p9oA [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
          Length = 269

 Score = 33.4 bits (76), Expect = 4e-04
 Identities = 9/58 (15%), Positives = 15/58 (25%), Gaps = 2/58 (3%)

Query: 144 AREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKN 201
            +  L         L   +SG  G+ +       GY V  +        Y      + 
Sbjct: 28  TKVPLEARPVRF--LDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQT 83


>1jr2A [c.113.1.1] UROPORPHYRINOGEN-III SYNTHASE
          Length = 260

 Score = 33.1 bits (74), Expect = 5e-04
 Identities = 14/75 (18%), Positives = 24/75 (32%), Gaps = 9/75 (12%)

Query: 113 LVKKPKDISSKQAM---ILGTAGLTALLCSF-AIKAREELLLGEKV-----KDVLVTGAS 163
           L+K  K+    Q      LG  GL A L    + +        EK+        L+  + 
Sbjct: 5   LLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTSP 64

Query: 164 GGVGSIAVMILNKFG 178
             V +  + +     
Sbjct: 65  RAVEAAELCLEQNNK 79


>1db3A [c.2.1.2] GDP-MANNOSE 4,6-DEHYDRATASE
          Length = 335

 Score = 33.0 bits (73), Expect = 5e-04
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAV 184
           K  L+TG +G  GS     L + GY+V  +
Sbjct: 2   KVALITGVTGQDGSYLAEFLLEKGYEVHGI 31


>2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
          Length = 231

 Score = 32.9 bits (73), Expect = 6e-04
 Identities = 8/25 (32%), Positives = 13/25 (52%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGY 179
           K V + GASG  G + +  + + G 
Sbjct: 15  KSVFILGASGETGRVLLKEILEQGL 39


>1ae1A [c.2.1.2] TROPINONE REDUCTASE-I
          Length = 245

 Score = 32.7 bits (73), Expect = 7e-04
 Identities = 11/27 (40%), Positives = 12/27 (44%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDV 181
              LVTG S G+G   V  L   G  V
Sbjct: 7   TTALVTGGSKGIGYAIVEELAGLGARV 33


>1xg5A [c.2.1.2] ARPG836
          Length = 254

 Score = 32.5 bits (73), Expect = 7e-04
 Identities = 13/36 (36%), Positives = 17/36 (47%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAEN 190
           +  LVTGASGG+G+     L + G  V        N
Sbjct: 11  RLALVTGASGGIGAAVARALVQQGLKVVGCARTVGN 46


>1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 A:2
           -- 112
          Length = 111

 Score = 32.4 bits (73), Expect = 8e-04
 Identities = 17/95 (17%), Positives = 34/95 (35%), Gaps = 2/95 (2%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDKDARP 214
             V++ G+ G +G    +   + G +V AV   A+      +  +  +IN  D D   R 
Sbjct: 12  TRVMLLGS-GELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSH-VINMLDGDALRRV 69

Query: 215 LDKGLWDGVVDTVGGKILANALAQTRDNGIVAACG 249
           ++      +V  +        +    +   V  C 
Sbjct: 70  VELEKPHYIVPEIEAIATDMLIQLEEEGLNVVPCA 104


>1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
          Length = 195

 Score = 32.4 bits (73), Expect = 8e-04
 Identities = 20/135 (14%), Positives = 32/135 (23%), Gaps = 12/135 (8%)

Query: 123 KQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVT 182
           +    L     T             +  G  V    V GA G VG  A       G  V 
Sbjct: 2   RDLTCLSDILPTGY---HGAV-TAGVGPGSTV---YVAGA-GPVGLAAAASARLLGAAVV 53

Query: 183 -AVTGKAENEKYLRSLGAKNIINKADLDKDARPL---DKGLWDGVVDTVGGKILANALAQ 238
                      + ++ G +      D     +      +   D  VD VG +   +    
Sbjct: 54  IVGDLNPARLAHAKAQGFEIADLSLDTPLHEQIAALLGEPEVDCAVDAVGFEARGHGHEG 113

Query: 239 TRDNGIVAACGNASD 253
            +         +   
Sbjct: 114 AKHEAPATVLNSLMQ 128


>1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
           A:1 -- 78
          Length = 78

 Score = 32.3 bits (73), Expect = 9e-04
 Identities = 12/63 (19%), Positives = 17/63 (26%), Gaps = 7/63 (11%)

Query: 154 VKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDKDAR 213
           +K V V G  G +G +        G  V  V   AE                   + +  
Sbjct: 1   MKQVCVLGN-GQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSV------ITAEIERW 53

Query: 214 PLD 216
           P  
Sbjct: 54  PET 56


>1zemA1 [c.2.1.2] XYLITOL DEHYDROGENASE A:3 -- 262
          Length = 260

 Score = 32.3 bits (72), Expect = 9e-04
 Identities = 15/61 (24%), Positives = 24/61 (39%), Gaps = 4/61 (6%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAEN----EKYLRSLGAKNIINKADLDK 210
           K  LVTGA G +G    + L + G  +  +    E     E  +R  G +      D+  
Sbjct: 6   KVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVTS 65

Query: 211 D 211
           +
Sbjct: 66  E 66


>1snyA [c.2.1.2] SNIFFER CG10964-PA
          Length = 248

 Score = 32.2 bits (72), Expect = 0.001
 Identities = 7/33 (21%), Positives = 15/33 (45%), Gaps = 3/33 (9%)

Query: 155 KDVLVTGASGGVG---SIAVMILNKFGYDVTAV 184
             +L+TG + G+G     A++ L +    +   
Sbjct: 3   NSILITGCNRGLGLGLVKALLNLPQPPQHLFTT 35


>1y81A1 [c.2.1.8] CONSERVED HYPOTHETICAL PROTEIN A:6 -- 121
          Length = 116

 Score = 32.2 bits (73), Expect = 0.001
 Identities = 18/98 (18%), Positives = 31/98 (31%), Gaps = 16/98 (16%)

Query: 155 KDVLVTGASGGVGSIAVMI---LNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDKD 211
           + + + GAS        +I   L   G++V  V    +        G K   +  +L KD
Sbjct: 2   RKIALVGASKNPAKYGNIILKDLLSKGFEVLPVNPNYD-----EIEGLKCYRSVRELPKD 56

Query: 212 ARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACG 249
                    D +V  V  K+      +  + G      
Sbjct: 57  V--------DVIVFVVPPKVGLQVAKEAVEAGFKKLWF 86


>1bxkA [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
          Length = 341

 Score = 32.1 bits (72), Expect = 0.001
 Identities = 13/43 (30%), Positives = 19/43 (44%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSL 197
           + +L+TG +G +GS  V  +     D   V  K      L SL
Sbjct: 2   RKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSL 44


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.333    0.145    0.477 

Gapped
Lambda     K      H
   0.267   0.0580    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 11,968,225
Number of extensions: 859212
Number of successful extensions: 3894
Number of sequences better than 1.0e-03: 7
Number of HSP's gapped: 3762
Number of HSP's successfully gapped: 212
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)