RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAZ22111.1 pubi0 AAZ22111.1 GIB00256CH01 "GXGXG
motif-containing protein"
         (284 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1ea0A1 [b.80.4.1] GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN A:1203 ...    88   2e-20

>1ea0A1 [b.80.4.1] GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN A:1203 --
           1472
          Length = 270

 Score = 87.6 bits (217), Expect = 2e-20
 Identities = 28/126 (22%), Positives = 42/126 (33%), Gaps = 14/126 (11%)

Query: 100 LNLIFEGSLG-YFGMGSCDGPTVRINGRVGWSCAENLMAGKVVIEKNAGSCFGAAI---- 154
           + +   G+ G   G  +  G  + + G       + L  G +V+     S          
Sbjct: 62  ITIRLRGTAGQSLGAFAVQGIKLEVMGDANDYVGKGLSGGTIVVRPTTSSPLETNKNTII 121

Query: 155 --------RGGDLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILGDVGIN 206
                     G L   G  G R  +   G T++V G  G+     M  G  +ILG VG N
Sbjct: 122 GNTVLYGATAGKLFAAGQAGERFAVRNSGATVVVEG-CGSNGCEYMTGGTAVILGRVGDN 180

Query: 207 LGDSMY 212
               M 
Sbjct: 181 FAAGMT 186



 Score = 51.0 bits (122), Expect = 2e-09
 Identities = 23/120 (19%), Positives = 36/120 (30%), Gaps = 10/120 (8%)

Query: 79  GTIVIKNPQGKHSLGVGILNKLNLIFEGSLGYFGMGSCDGPTVRINGRVGWSCAENLMAG 138
           GTIV++            L        G+   +G        +   G+ G   A      
Sbjct: 101 GTIVVRPTTS------SPLETNKNTIIGNTVLYGAT---AGKLFAAGQAGERFAVRNSGA 151

Query: 139 KVVIEKNAGSCFGAAIRGGDLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRII 198
            VV+E    +     + GG  +  G VG      M GG   V     +   ++     I 
Sbjct: 152 TVVVEGCGSNG-CEYMTGGTAVILGRVGDNFAAGMTGGMAYVYDLDDSLPLYINDESVIF 210


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.313    0.135    0.447 

Gapped
Lambda     K      H
   0.267   0.0558    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 17,186,361
Number of extensions: 1266019
Number of successful extensions: 4611
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 4509
Number of HSP's successfully gapped: 107
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.4 bits)