BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAL03713.1 rcon0 thdF GIB00062CH01 "possible thiophene and
furan oxidation protein t.."
         (445 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1xzpA [d.250.1 - a.24.25 - c.37.1] PROBABLE TRNA MODIFICATION GT...   198   2e-53
1xzqA [d.250.1 - a.24.25 - c.37.1] PROBABLE TRNA MODIFICATION GT...   196   8e-53
1rflA [c.37.1] PROBABLE TRNA MODIFICATION GTPASE TRME                  96   2e-22
2gjaB [x.x.x] TRNA MODIFICATION GTPASE TRME                            89   3e-20
2gjaA [x.x.x] TRNA MODIFICATION GTPASE TRME                            89   3e-20
2gj9A [x.x.x] TRNA MODIFICATION GTPASE TRME                            89   3e-20
2gj9B [x.x.x] TRNA MODIFICATION GTPASE TRME                            86   2e-19
2gj8D [x.x.x] TRNA MODIFICATION GTPASE TRME                            79   3e-17
2gj8B [x.x.x] TRNA MODIFICATION GTPASE TRME                            79   3e-17
2gj8A [x.x.x] TRNA MODIFICATION GTPASE TRME                            79   3e-17
1xzqB [d.250.1] PROBABLE TRNA MODIFICATION GTPASE TRME                 69   3e-14
1xzpB [d.250.1] PROBABLE TRNA MODIFICATION GTPASE TRME                 69   3e-14
3ievA [x.x.x] GTP-BINDING PROTEIN ERA                                  59   3e-11
1egaB [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)              58   5e-11
1egaA [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)              58   5e-11
1mkyA [c.37.1 - c.37.1 - d.52.5] PROBABLE GTP-BINDING PROTEIN ENGA     53   2e-09
1wf3A [c.37.1 - d.52.3] GTP-BINDING PROTEIN                            45   4e-07
2wjjB [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG                 39   3e-05
2wjjA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG                 39   3e-05
2wjhA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG                 39   3e-05
2wjgB [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG                 39   3e-05
2wjgA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG                 39   3e-05
3a1wA [x.x.x] IRON(II) TRANSPORT PROTEIN B                             38   7e-05
3a1vA [x.x.x] IRON(II) TRANSPORT PROTEIN B                             38   7e-05
3a1uA [x.x.x] IRON(II) TRANSPORT PROTEIN B                             38   7e-05
3a1tA [x.x.x] IRON(II) TRANSPORT PROTEIN B                             38   7e-05
3a1sB [x.x.x] IRON(II) TRANSPORT PROTEIN B                             38   7e-05
3a1sA [x.x.x] IRON(II) TRANSPORT PROTEIN B                             38   7e-05
2hjgA [x.x.x] GTP-BINDING PROTEIN ENGA                                 35   3e-04
2dykA [x.x.x] GTP-BINDING PROTEIN                                      35   3e-04
3ec1A [x.x.x] YQEH GTPASE                                              35   6e-04
3i8xA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B                         34   7e-04
3i8sA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B                         34   7e-04
3i92A [x.x.x] FERROUS IRON TRANSPORT PROTEIN B                         34   0.001

>1xzpA [d.250.1 - a.24.25 - c.37.1] PROBABLE TRNA MODIFICATION
           GTPASE TRME
          Length = 456

 Score =  198 bits (504), Expect = 2e-53
 Identities = 145/455 (31%), Positives = 222/455 (48%), Gaps = 15/455 (3%)

Query: 1   METIFAQSSAFGKAGVAVFRISGPKSLEVLQL-LTGRKDFKSRLMYYQQITVPETKELID 59
           M+TI A ++  GK  +A+ R+SGP S +++Q  L  R     R   +  I   E      
Sbjct: 7   MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKHLRTRSKIVPRKAIHGWIH--ENGXXXX 64

Query: 60  NVMVVYFKSPGSFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNK 119
                ++KSP S+TGED+VE+  HG               +G R+AE GEFTKRAFLN K
Sbjct: 65  XXXXXFYKSPKSYTGEDMVEVMCHGGPXXXXXXXXXXXX-SGARMAEPGEFTKRAFLNGK 123

Query: 120 FDLTAAEGIADLINAETIMQHKQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDED 179
            DLT+AE + DLI A++    K ++R   G L    ++ R +L+++L+ +   +D+PDE 
Sbjct: 124 MDLTSAEAVRDLIEAKSETSLKLSLRNLKGGLRDFVDSLRRELIEVLAEIRVELDYPDEI 183

Query: 180 IPDTVLNEVTNTHTILVNTISEYLNDNRKGELLRSGLKLAIIGPPNVGKSSLLNFLMQRD 239
             +T   EV      +   ++E L     G LL  GL++ I+G PNVGKS+LLN L+  D
Sbjct: 184 --ETNTGEVVTRLERIKEKLTEELKKADAGILLNRGLRMVIVGKPNVGKSTLLNRLLNED 241

Query: 240 IAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDIIEQEGIKRAINSAKTADIK 299
            AIV++I GTTRD+I   + I G    + DTAG+R E++D++E+ GI+R +   + ADI 
Sbjct: 242 RAIVTDIPGTTRDVISEEIVIRGILFRIVDTAGVRSETNDLVERLGIERTLQEIEKADIV 301

Query: 300 IIMFDAEK-LDSS----XXXXXXXXXXXXXXXXXXKIDLIEASKIFSIENKYKCLRVSVK 354
           + + DA   LD                                    +      +++S  
Sbjct: 302 LFVLDASSPLDEEDRKILERIKNKRYLVVIXXXXXXXXXXXXXXXXXLGTDRHMVKISAX 361

Query: 355 NNIALSSILKNIENIAENMAGFTETPYITNQRHRNYLQQALSHL----TAFSLDNDLVLA 410
                     +I    + +        ITN R +  L+    HL     +      + +A
Sbjct: 362 XXXXXXXXXXSIYRETQEIFERGSDSLITNLRQKQLLENVKGHLEDAIKSLKEGMPVDMA 421

Query: 411 TEDIRMTARCIGAITGVINVEEILGEIFKNFCIGK 445
           + D+      +  +TG    E++L  IF NFC+GK
Sbjct: 422 SIDLERALNLLDEVTGRSFREDLLDTIFSNFCVGK 456


>1xzqA [d.250.1 - a.24.25 - c.37.1] PROBABLE TRNA MODIFICATION
           GTPASE TRME
          Length = 449

 Score =  196 bits (499), Expect = 8e-53
 Identities = 144/454 (31%), Positives = 221/454 (48%), Gaps = 15/454 (3%)

Query: 2   ETIFAQSSAFGKAGVAVFRISGPKSLEVLQL-LTGRKDFKSRLMYYQQITVPETKELIDN 60
           +TI A ++  GK  +A+ R+SGP S +++Q  L  R     R   +  I   E       
Sbjct: 1   DTIVAVATPPGKGAIAILRLSGPDSWKIVQKHLRTRSKIVPRKAIHGWIH--ENGXXXXX 58

Query: 61  VMVVYFKSPGSFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKF 120
               ++KSP S+TGED+VE+  HG               +G R+AE GEFTKRAFLN K 
Sbjct: 59  XXXXFYKSPKSYTGEDMVEVMCHGGPXXXXXXXXXXXX-SGARMAEPGEFTKRAFLNGKM 117

Query: 121 DLTAAEGIADLINAETIMQHKQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDEDI 180
           DLT+AE + DLI A++    K ++R   G L    ++ R +L+++L+ +   +D+PDE  
Sbjct: 118 DLTSAEAVRDLIEAKSETSLKLSLRNLKGGLRDFVDSLRRELIEVLAEIRVELDYPDEI- 176

Query: 181 PDTVLNEVTNTHTILVNTISEYLNDNRKGELLRSGLKLAIIGPPNVGKSSLLNFLMQRDI 240
            +T   EV      +   ++E L     G LL  GL++ I+G PNVGKS+LLN L+  D 
Sbjct: 177 -ETNTGEVVTRLERIKEKLTEELKKADAGILLNRGLRMVIVGKPNVGKSTLLNRLLNEDR 235

Query: 241 AIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDIIEQEGIKRAINSAKTADIKI 300
           AIV++I GTTRD+I   + I G    + DTAG+R E++D++E+ GI+R +   + ADI +
Sbjct: 236 AIVTDIPGTTRDVISEEIVIRGILFRIVDTAGVRSETNDLVERLGIERTLQEIEKADIVL 295

Query: 301 IMFDAEK-LDSS----XXXXXXXXXXXXXXXXXXKIDLIEASKIFSIENKYKCLRVSVKN 355
            + DA   LD                                    +      +++S   
Sbjct: 296 FVLDASSPLDEEDRKILERIKNKRYLVVIXXXXXXXXXXXXXXXXXLGTDRHMVKISAXX 355

Query: 356 NIALSSILKNIENIAENMAGFTETPYITNQRHRNYLQQALSHL----TAFSLDNDLVLAT 411
                    +I    + +        ITN R +  L+    HL     +      + +A+
Sbjct: 356 XXXXXXXXXSIYRETQEIFERGSDSLITNLRQKQLLENVKGHLEDAIKSLKEGMPVDMAS 415

Query: 412 EDIRMTARCIGAITGVINVEEILGEIFKNFCIGK 445
            D+      +  +TG    E++L  IF NFC+GK
Sbjct: 416 IDLERALNLLDEVTGRSFREDLLDTIFSNFCVGK 449


>1rflA [c.37.1] PROBABLE TRNA MODIFICATION GTPASE TRME
          Length = 172

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 51/102 (50%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 209 GELLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQ 268
           G LLR G+K+ I G PN GKSSLLN L  R+ AIV++IAGTTRD++  H+ I G P+ + 
Sbjct: 1   GSLLREGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHII 60

Query: 269 DTAGIREESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDS 310
           DTAG+R E+SD +E+ GI+RA    + AD  + M D    D+
Sbjct: 61  DTAGLR-EASDEVERIGIERAWQEIEQADRVLFMVDGTTTDA 101


>2gjaB [x.x.x] TRNA MODIFICATION GTPASE TRME
          Length = 161

 Score = 88.6 bits (218), Expect = 3e-20
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 215 GLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIR 274
           G+K+ I G PN GKSSLLN L  R+ AIV++IAGTTRD++  H+ I G P+ + DTAG+R
Sbjct: 2   GMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR 61

Query: 275 EESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDS 310
            E+SD +E+ GI+RA    + AD  + M D    D+
Sbjct: 62  -EASDEVERIGIERAWQEIEQADRVLFMVDGTTTDA 96


>2gjaA [x.x.x] TRNA MODIFICATION GTPASE TRME
          Length = 168

 Score = 88.6 bits (218), Expect = 3e-20
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 215 GLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIR 274
           G+K+ I G PN GKSSLLN L  R+ AIV++IAGTTRD++  H+ I G P+ + DTAG+R
Sbjct: 2   GMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR 61

Query: 275 EESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDS 310
            E+SD +E+ GI+RA    + AD  + M D    D+
Sbjct: 62  -EASDEVERIGIERAWQEIEQADRVLFMVDGTTTDA 96


>2gj9A [x.x.x] TRNA MODIFICATION GTPASE TRME
          Length = 161

 Score = 88.6 bits (218), Expect = 3e-20
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 215 GLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIR 274
           G+K+ I G PN GKSSLLN L  R+ AIV++IAGTTRD++  H+ I G P+ + DTAG+R
Sbjct: 1   GMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR 60

Query: 275 EESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDS 310
            E+SD +E+ GI+RA    + AD  + M D    D+
Sbjct: 61  -EASDEVERIGIERAWQEIEQADRVLFMVDGTTTDA 95


>2gj9B [x.x.x] TRNA MODIFICATION GTPASE TRME
          Length = 160

 Score = 86.3 bits (212), Expect = 2e-19
 Identities = 46/95 (48%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 216 LKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRE 275
           +K+ I G PN GKSSLLN L  R+ AIV++IAGTTRD++  H+ I G P+ + DTAG+R 
Sbjct: 1   MKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR- 59

Query: 276 ESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDS 310
           E+SD +E+ GI+RA    + AD  + M D    D+
Sbjct: 60  EASDEVERIGIERAWQEIEQADRVLFMVDGTTTDA 94


>2gj8D [x.x.x] TRNA MODIFICATION GTPASE TRME
          Length = 166

 Score = 78.6 bits (192), Expect = 3e-17
 Identities = 45/94 (47%), Positives = 64/94 (68%), Gaps = 3/94 (3%)

Query: 217 KLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREE 276
           K+ I G PN GKSSLLN L  R+ AIV++IAGTTRD++  H+ I G P+ + DTAG+R E
Sbjct: 5   KVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDG-PLHIIDTAGLR-E 62

Query: 277 SSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDS 310
           +SD +E+ GI+RA    + AD +++  D    D+
Sbjct: 63  ASDEVERIGIERAWQEIEQAD-RVLFVDGTTTDA 95


>2gj8B [x.x.x] TRNA MODIFICATION GTPASE TRME
          Length = 155

 Score = 78.6 bits (192), Expect = 3e-17
 Identities = 45/94 (47%), Positives = 64/94 (68%), Gaps = 3/94 (3%)

Query: 217 KLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREE 276
           K+ I G PN GKSSLLN L  R+ AIV++IAGTTRD++  H+ I G P+ + DTAG+R E
Sbjct: 1   KVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDG-PLHIIDTAGLR-E 58

Query: 277 SSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDS 310
           +SD +E+ GI+RA    + AD +++  D    D+
Sbjct: 59  ASDEVERIGIERAWQEIEQAD-RVLFVDGTTTDA 91


>2gj8A [x.x.x] TRNA MODIFICATION GTPASE TRME
          Length = 156

 Score = 78.6 bits (192), Expect = 3e-17
 Identities = 45/94 (47%), Positives = 64/94 (68%), Gaps = 3/94 (3%)

Query: 217 KLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREE 276
           K+ I G PN GKSSLLN L  R+ AIV++IAGTTRD++  H+ I G P+ + DTAG+R E
Sbjct: 2   KVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDG-PLHIIDTAGLR-E 59

Query: 277 SSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDS 310
           +SD +E+ GI+RA    + AD +++  D    D+
Sbjct: 60  ASDEVERIGIERAWQEIEQAD-RVLFVDGTTTDA 92


>1xzqB [d.250.1] PROBABLE TRNA MODIFICATION GTPASE TRME
          Length = 117

 Score = 68.6 bits (166), Expect = 3e-14
 Identities = 45/120 (37%), Positives = 62/120 (51%), Gaps = 4/120 (3%)

Query: 1   METIFAQSSAFGKAGVAVFRISGPKSLEVLQL-LTGRKDFKSRLMYYQQITVPETKELID 59
           M+TI A ++  GK  +A+ R+SGP S +++Q  L  R     R   +  I   E      
Sbjct: 1   MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKHLRTRSKIVPRKAIHGWIH--ENGXXXX 58

Query: 60  NVMVVYFKSPGSFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNK 119
                ++KSP S+TGED+VE+  HG               +G R+AE GEFTKRAFLN K
Sbjct: 59  XXXXXFYKSPKSYTGEDMVEVMCHGGPXXXXXXXXXXXX-SGARMAEPGEFTKRAFLNGK 117


>1xzpB [d.250.1] PROBABLE TRNA MODIFICATION GTPASE TRME
          Length = 131

 Score = 68.6 bits (166), Expect = 3e-14
 Identities = 45/120 (37%), Positives = 62/120 (51%), Gaps = 4/120 (3%)

Query: 1   METIFAQSSAFGKAGVAVFRISGPKSLEVLQL-LTGRKDFKSRLMYYQQITVPETKELID 59
           M+TI A ++  GK  +A+ R+SGP S +++Q  L  R     R   +  I   E      
Sbjct: 14  MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKHLRTRSKIVPRKAIHGWIH--ENGXXXX 71

Query: 60  NVMVVYFKSPGSFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNK 119
                ++KSP S+TGED+VE+  HG               +G R+AE GEFTKRAFLN K
Sbjct: 72  XXXXXFYKSPKSYTGEDMVEVMCHGGPXXXXXXXXXXXX-SGARMAEPGEFTKRAFLNGK 130


>3ievA [x.x.x] GTP-BINDING PROTEIN ERA
          Length = 302

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 2/90 (2%)

Query: 218 LAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDI-GGYPIILQDTAGIRE- 275
           +AI+G PNVGKS+LLN L+   ++I+S  AGTTR  + G  +I     II  DT GI E 
Sbjct: 7   VAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEP 66

Query: 276 ESSDIIEQEGIKRAINSAKTADIKIIMFDA 305
           + SD++    ++ A  S + AD+ + M DA
Sbjct: 67  KKSDVLGHSMVEIAKQSLEEADVILFMIDA 96


>1egaB [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
          Length = 293

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 37/92 (40%), Positives = 53/92 (57%), Gaps = 8/92 (8%)

Query: 218 LAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREES 277
           +AI+G PNVGKS+LLN L+ + I+I S  A TTR  I G    G Y  I  DT G+  E 
Sbjct: 8   IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLHME- 66

Query: 278 SDIIEQEGIKRAINSAKTA---DIKIIMFDAE 306
               E+  I R +N A ++   D+++++F  E
Sbjct: 67  ----EKRAINRLMNKAASSSIGDVELVIFVVE 94


>1egaA [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
          Length = 292

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 37/92 (40%), Positives = 53/92 (57%), Gaps = 8/92 (8%)

Query: 218 LAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREES 277
           +AI+G PNVGKS+LLN L+ + I+I S  A TTR  I G    G Y  I  DT G+  E 
Sbjct: 8   IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLHME- 66

Query: 278 SDIIEQEGIKRAINSAKTA---DIKIIMFDAE 306
               E+  I R +N A ++   D+++++F  E
Sbjct: 67  ----EKRAINRLMNKAASSSIGDVELVIFVVE 94


>1mkyA [c.37.1 - c.37.1 - d.52.5] PROBABLE GTP-BINDING PROTEIN ENGA
          Length = 400

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 36/129 (27%), Positives = 66/129 (51%), Gaps = 15/129 (11%)

Query: 178 EDIPDTVLNEVT-NTHTILVNTISEYLNDNRKGELLRSGLKLAIIGPPNVGKSSLLNFLM 236
           E IP +  + +  +T   ++  + E   D      +   +K+AI+G PNVGKS+L N ++
Sbjct: 124 EPIPVSAEHNINLDTLETIIKKLEEKGLDLESKPEITDAIKVAIVGRPNVGKSTLFNAIL 183

Query: 237 QRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDIIEQEGIKRAINSAKTA 296
            ++ A+VS I       ++  + I G   +  DTAG+ + S+         R ++S + A
Sbjct: 184 NKERALVSPIP------VDDEVFIDGRKYVFVDTAGLEKYSN--------YRVVDSIEKA 229

Query: 297 DIKIIMFDA 305
           D+ +I+ DA
Sbjct: 230 DVVVIVLDA 238



 Score = 37.4 bits (85), Expect = 9e-05
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 16/88 (18%)

Query: 220 IIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSD 279
           I+G PNVGKS+L N L+              +D ++  ++  G    L DT G+ +   D
Sbjct: 5   IVGRPNVGKSTLFNKLV--------------KDPVQDTVEWYGKTFKLVDTCGVFDNPQD 50

Query: 280 IIEQEGIKRAINSAKTADIKIIMFDAEK 307
           II Q+  K    + + AD+ + + D ++
Sbjct: 51  IISQK--KEVTLNIREADLVLFVVDGKR 76


>1wf3A [c.37.1 - d.52.3] GTP-BINDING PROTEIN
          Length = 296

 Score = 45.1 bits (105), Expect = 4e-07
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 218 LAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRE 275
           +AI+G PNVGKS+LLN L+   +A +S    TTR  + G L  G   I+  DT G+ +
Sbjct: 8   VAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGRRQIVFVDTPGLHK 65


>2wjjB [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
          Length = 161

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 217 KLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREE 276
           ++A+IG PNVGKS++ N L   ++  + N  G T +  EG  +  G    + D  G+   
Sbjct: 5   EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSL 63

Query: 277 SSDIIEQEGIKRAINSAKTADIKIIMFDAEKLD 309
           +++ I+ E I R     +  D+ + + DA  L+
Sbjct: 64  TANSID-EIIARDYIINEKPDLVVNIVDATALE 95


>2wjjA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
          Length = 163

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 217 KLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREE 276
           ++A+IG PNVGKS++ N L   ++  + N  G T +  EG  +  G    + D  G+   
Sbjct: 5   EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSL 63

Query: 277 SSDIIEQEGIKRAINSAKTADIKIIMFDAEKLD 309
           +++ I+ E I R     +  D+ + + DA  L+
Sbjct: 64  TANSID-EIIARDYIINEKPDLVVNIVDATALE 95


>2wjhA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
          Length = 166

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 217 KLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREE 276
           ++A+IG PNVGKS++ N L   ++  + N  G T +  EG  +  G    + D  G+   
Sbjct: 5   EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSL 63

Query: 277 SSDIIEQEGIKRAINSAKTADIKIIMFDAEKLD 309
           +++ I+ E I R     +  D+ + + DA  L+
Sbjct: 64  TANSID-EIIARDYIINEKPDLVVNIVDATALE 95


>2wjgB [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
          Length = 166

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 217 KLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREE 276
           ++A+IG PNVGKS++ N L   ++  + N  G T +  EG  +  G    + D  G+   
Sbjct: 6   EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSL 64

Query: 277 SSDIIEQEGIKRAINSAKTADIKIIMFDAEKLD 309
           +++ I+ E I R     +  D+ + + DA  L+
Sbjct: 65  TANSID-EIIARDYIINEKPDLVVNIVDATALE 96


>2wjgA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
          Length = 170

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 217 KLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREE 276
           ++A+IG PNVGKS++ N L   ++  + N  G T +  EG  +  G    + D  G+   
Sbjct: 9   EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSL 67

Query: 277 SSDIIEQEGIKRAINSAKTADIKIIMFDAEKLD 309
           +++ I+ E I R     +  D+ + + DA  L+
Sbjct: 68  TANSID-EIIARDYIINEKPDLVVNIVDATALE 99


>3a1wA [x.x.x] IRON(II) TRANSPORT PROTEIN B
          Length = 159

 Score = 37.7 bits (86), Expect = 7e-05
 Identities = 33/96 (34%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 216 LKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRE 275
           +K+A+ G PNVGK+SL N L       V+N  G T +  EG     GY I L D  G   
Sbjct: 3   VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYS 61

Query: 276 ESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDSS 311
                I+ E I R       AD+ I++ D+   + S
Sbjct: 62  LGYSSID-EKIARDYLLKGDADLVILVADSVNPEQS 96


>3a1vA [x.x.x] IRON(II) TRANSPORT PROTEIN B
          Length = 252

 Score = 37.7 bits (86), Expect = 7e-05
 Identities = 33/96 (34%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 216 LKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRE 275
           +K+A+ G PNVGK+SL N L       V+N  G T +  EG     GY I L D  G   
Sbjct: 3   VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYS 61

Query: 276 ESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDSS 311
                I+ E I R       AD+ I++ D+   + S
Sbjct: 62  LGYSSID-EKIARDYLLKGDADLVILVADSVNPEQS 96


>3a1uA [x.x.x] IRON(II) TRANSPORT PROTEIN B
          Length = 252

 Score = 37.7 bits (86), Expect = 7e-05
 Identities = 33/96 (34%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 216 LKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRE 275
           +K+A+ G PNVGK+SL N L       V+N  G T +  EG     GY I L D  G   
Sbjct: 2   VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYS 60

Query: 276 ESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDSS 311
                I+ E I R       AD+ I++ D+   + S
Sbjct: 61  LGYSSID-EKIARDYLLKGDADLVILVADSVNPEQS 95


>3a1tA [x.x.x] IRON(II) TRANSPORT PROTEIN B
          Length = 254

 Score = 37.7 bits (86), Expect = 7e-05
 Identities = 33/96 (34%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 216 LKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRE 275
           +K+A+ G PNVGK+SL N L       V+N  G T +  EG     GY I L D  G   
Sbjct: 3   VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYS 61

Query: 276 ESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDSS 311
                I+ E I R       AD+ I++ D+   + S
Sbjct: 62  LGYSSID-EKIARDYLLKGDADLVILVADSVNPEQS 96


>3a1sB [x.x.x] IRON(II) TRANSPORT PROTEIN B
          Length = 251

 Score = 37.7 bits (86), Expect = 7e-05
 Identities = 33/96 (34%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 216 LKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRE 275
           +K+A+ G PNVGK+SL N L       V+N  G T +  EG     GY I L D  G   
Sbjct: 5   VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYS 63

Query: 276 ESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDSS 311
                I+ E I R       AD+ I++ D+   + S
Sbjct: 64  LGYSSID-EKIARDYLLKGDADLVILVADSVNPEQS 98


>3a1sA [x.x.x] IRON(II) TRANSPORT PROTEIN B
          Length = 250

 Score = 37.7 bits (86), Expect = 7e-05
 Identities = 33/96 (34%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 216 LKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRE 275
           +K+A+ G PNVGK+SL N L       V+N  G T +  EG     GY I L D  G   
Sbjct: 3   VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYS 61

Query: 276 ESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLDSS 311
                I+ E I R       AD+ I++ D+   + S
Sbjct: 62  LGYSSID-EKIARDYLLKGDADLVILVADSVNPEQS 96


>2hjgA [x.x.x] GTP-BINDING PROTEIN ENGA
          Length = 390

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 11/93 (11%)

Query: 216 LKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRE 275
           ++  +IG PNVGKSSL+N L +  + IVS         ++          ++ DTAG ++
Sbjct: 147 IQFCLIGRPNVGKSSLVNALGEERV-IVS---------VDTSFTYNQQEFVIVDTAGRKK 196

Query: 276 -ESSDIIEQEGIKRAINSAKTADIKIIMFDAEK 307
            +  +  E+  + RA+ +   +++  ++ D E+
Sbjct: 197 GKVYETTEKYSVLRALKAIDRSEVVAVVLDGEE 229


>2dykA [x.x.x] GTP-BINDING PROTEIN
          Length = 150

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 16/81 (19%)

Query: 217 KLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREE 276
           K+ I+G PNVGKSSL N L+++             D+ EG ++      +L DT G+   
Sbjct: 3   KVVIVGRPNVGKSSLFNRLLKK-----------RSDLKEGVVETDRGRFLLVDTGGL--W 49

Query: 277 SSDIIE---QEGIKRAINSAK 294
           S D  E   QE + RA+  A+
Sbjct: 50  SGDKWEKKIQEKVDRALEDAE 70


>3ec1A [x.x.x] YQEH GTPASE
          Length = 311

 Score = 34.7 bits (78), Expect = 6e-04
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 213 RSGLKLAIIGPPNVGKSSLLNFLMQR-----DIAIVSNIAGTTRDIIEGHLDIGGYPIIL 267
           R G  + ++G  NVGKS+ +N +++      ++   S   GTT D+IE  L+ G     L
Sbjct: 102 REGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPGTTLDMIEIPLESGA---TL 158

Query: 268 QDTAGI 273
            DT GI
Sbjct: 159 YDTPGI 164


>3i8xA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
          Length = 258

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 216 LKLAIIGPPNVGKSSLLNFL---MQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAG 272
           L + +IG PN GK++L N L    QR    V N AG T +  EG      + + L D  G
Sbjct: 4   LTIGLIGNPNSGKTTLFNQLTGSRQR----VGNWAGVTVERKEGQFSTTDHQVTLVDLPG 59

Query: 273 IREESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLD 309
               ++     E I      +  AD+ I + DA  L+
Sbjct: 60  TYSLTTQTSLDEQIACHYILSGDADLLINVVDASNLE 96


>3i8sA [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
          Length = 260

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query: 216 LKLAIIGPPNVGKSSLLNFL---MQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAG 272
           L + +IG PN GK++L N L    QR    V N AG T +  EG      + + L D  G
Sbjct: 4   LTIGLIGNPNSGKTTLFNQLTGSRQR----VGNWAGVTVERKEGQFSTTDHQVTLVDLPG 59

Query: 273 IREESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLD 309
               ++  ++++     I S   AD+ I + DA  L+
Sbjct: 60  TYSLTTTSLDEQIACHYILSG-DADLLINVVDASNLE 95


>3i92A [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
          Length = 257

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 30/97 (30%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 216 LKLAIIGPPNVGKSSLLNFL---MQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAG 272
           L + +IG PN GK++L N L    QR    V N AG T +  EG      + + L D  G
Sbjct: 4   LTIGLIGNPNSGKTTLFNQLTGSRQR----VGNWAGVTVERKEGQFSTTDHQVTLVDLPG 59

Query: 273 IREESSDIIEQEGIKRAINSAKTADIKIIMFDAEKLD 309
               +   ++++     I S   AD+ I + DA  L+
Sbjct: 60  TYSLTQTSLDEQIACHYILSG-DADLLINVVDASNLE 95


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.332    0.146    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 781,978,343
Number of extensions: 31713584
Number of successful extensions: 85625
Number of sequences better than 1.0e-03: 1694
Number of HSP's gapped: 84100
Number of HSP's successfully gapped: 2065
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)