BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAL03799.1 rcon0 AAL03799.1 GIB00062CH01 "cell surface
antigen-like protein"
         (652 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

OMPA_RICCN RecName: Full=Outer membrane protein A;AltName: Full=...    67   6e-13
OMPA_RICRI RecName: Full=Outer membrane protein A;AltName: Full=...    65   2e-12
YHU2_SCHPO RecName: Full=Uncharacterized threonine-rich GPI-anch...    47   4e-07
OMPB_RICJA RecName: Full=Outer membrane protein B;AltName: Full=...    45   2e-06
OMPB_RICCN RecName: Full=Outer membrane protein B;AltName: Full=...    42   2e-05
YPJA_ECOLI RecName: Full=Uncharacterized outer membrane protein ...    40   4e-05
YUAO_ECOLI RecName: Full=Uncharacterized protein yuaO;Flags: Pre...    39   2e-04
PMP9_CHLPN RecName: Full=Probable outer membrane protein pmp9;Al...    37   5e-04
FLGI_COLP3 RecName: Full=Flagellar P-ring protein;AltName: Full=...    37   5e-04

>OMPA_RICCN RecName: Full=Outer membrane protein A;AltName: Full=rOmp
            A;         Short=rOmpA;AltName: Full=190 kDa
            antigen;AltName: Full=Cell surface antigen;
          Length = 2021

 Score = 66.6 bits (161), Expect = 6e-13
 Identities = 92/338 (27%), Positives = 130/338 (38%), Gaps = 63/338 (18%)

Query: 275  GNKTVILQKSVSA-TSLTLGNNAVANLQDSLTKSGNVDFTNGGVLEFSG-----ANPAGY 328
            GN   +   +V A  +L  G +  AN         N+DF     LEF+G      N   Y
Sbjct: 939  GNTNALATVNVGAGVTLQAGGSLDAN---------NIDFGARSTLEFNGPLDGGGNAIPY 989

Query: 329  LLNSQIKNGNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNAVAAFTIDVSNKALTL-- 386
                         LNV T   +LTA   +IG V  INIG GN    F ID S   +T+  
Sbjct: 990  YFKXXXXXXXXXXLNVNTK--LLTAYHLTIGTVAEINIGAGNL---FAIDASAGDVTILN 1044

Query: 387  GSDINLNNTKSVFGLTTSKNQQVTFM--------NSVDG----FAGGGGSVNLSSTSSTI 434
              DI+     S   L+      V  +          VD     F GG   +N+ S     
Sbjct: 1045 AQDIHFRALDSALVLSNLTGVGVNNILLAADLVAPGVDEGTVVFDGGVNGLNIGS----- 1099

Query: 435  PNDNVLTLQGNLGNETLGTKANPLAXXXXXXXXXXXXXXXXXXXXXLDMSNTAVLNIAAG 494
               NV     N+G +  G K N L                       D++   + N+   
Sbjct: 1100 ---NVAGAARNIG-DVGGNKFNTLLIYNAVTITD-------------DVNLEGIQNVLIN 1142

Query: 495  GVFADASLTSAKIAKINIGEVNAGPAVYALDALNGDFPLDAPGVTFVNSASVLKLMTTVA 554
                +A  TS+     N G +    A Y +DA NG+  + A  + F ++ + L L  +  
Sbjct: 1143 N---NADFTSS--TAFNAGTIQINDATYTIDANNGNLNIPAGNIKFAHADAQLILQNS-- 1195

Query: 555  SGKNSTIELTGNIEPVVPNTGVVEINARNANTKLTIDG 592
            SG + TI L  NI+P   + G+V +N+  A  KLTI G
Sbjct: 1196 SGNDRTITLGANIDPDNDDEGIVILNSVTAGKKLTIAG 1233



 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 95/378 (25%), Positives = 134/378 (35%), Gaps = 57/378 (15%)

Query: 275 GNKTVILQKSVSATSLTLGNNAVANLQDSLTKSGN-VDFTNGGVLEFSGANPAGYLLNSQ 333
           GN   +   SV A   TLG   +      LT + + V FTN  V+  +GA          
Sbjct: 360 GNTNALATISVGAGKATLGGAIIKATTTKLTDNASAVTFTNPVVV--TGAID-------- 409

Query: 334 IKNGNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNAVAAFTIDVSNKALTLGSDINLN 393
               NTG  N    G +    DS++    T NIG  NA+A  ++  + KA   G+ I   
Sbjct: 410 ----NTGNAN---NGIVTFTGDSTV----TGNIGNTNALATISVG-AGKATLGGAIIKAT 457

Query: 394 NTKSVFGLTTSKNQQVTFMNSV--DGFAGGGGSVNL--------SSTSSTIPNDNVL-TL 442
            TK      T     VTF N V   G     G+ N         S+ +  I N N L T+
Sbjct: 458 TTK-----LTDNASAVTFTNPVVVTGAIDNTGNANNGIVTFTGDSTVTGNIGNTNALATI 512

Query: 443 QGNLGNETLGTKANPLAXXXXXXXXXXXXXXXXXXXXXLDMSNTAVLNIAAGGVFADASL 502
               G  TLG  A   A                       + NT   N        D+++
Sbjct: 513 SVGAGKATLGG-AIIKATTTKLTDNASAVTFTNPVVVTGAIDNTGNANNGIVTFTGDSTV 571

Query: 503 T-----SAKIAKINIGEVNAGPAVYALDALNGDFPLDAPGVTFVNSASVLKLMTTVASGK 557
           T     +  +A I++G   A      + A       +A  VTF N   V   +    +  
Sbjct: 572 TGNIGNTNALATISVGAGKATLGGAIIKATTTKLTDNASAVTFTNPVVVTGAIDNTGNAN 631

Query: 558 NSTIELTGNIEPVVPNTG------VVEINARNANTKLTIDGMANKYAIGTKANPVSKVQL 611
           N  +  TGN   V  N G       V + A  A    T++G   K       N  S + L
Sbjct: 632 NGIVTFTGN-STVTGNIGNTNALATVNVGAGIA----TLEGAVIKATTTKLTNAASVLTL 686

Query: 612 TGHGTLVITAL-NTPNID 628
           T    ++  A+ NT  +D
Sbjct: 687 TNVNAVLTGAIDNTTGVD 704



 Score = 40.8 bits (94), Expect = 3e-05
 Identities = 88/365 (24%), Positives = 125/365 (34%), Gaps = 58/365 (15%)

Query: 275 GNKTVILQKSVSATSLTLGNNAVANLQDSLTKSGN-VDFTNGGVLEFSGANPAGYLLNSQ 333
           GN   +   SV A   TLG   +      LT + + V FTN  V+  +GA          
Sbjct: 504 GNTNALATISVGAGKATLGGAIIKATTTKLTDNASAVTFTNPVVV--TGAID-------- 553

Query: 334 IKNGNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNAVAAFTIDVSNKALTLGSDINLN 393
               NTG  N    G +    DS++    T NIG  NA+A  ++  + KA   G+ I   
Sbjct: 554 ----NTGNAN---NGIVTFTGDSTV----TGNIGNTNALATISVG-AGKATLGGAIIKAT 601

Query: 394 NTKSVFGLTTSKNQQVTFMNSV--DGFAGGGGSVNL--------SSTSSTIPNDNVL--- 440
            TK      T     VTF N V   G     G+ N         S+ +  I N N L   
Sbjct: 602 TTK-----LTDNASAVTFTNPVVVTGAIDNTGNANNGIVTFTGNSTVTGNIGNTNALATV 656

Query: 441 -------TLQGNLGNETLGTKANPLAXXXXXXXXXXXXXXXXXXXXXLDMSNTAVLNIAA 493
                  TL+G +   T  TK    A                     +D      LN A 
Sbjct: 657 NVGAGIATLEGAVIKATT-TKLTNAASVLTLTNVNAVLTGAIDNTTGVDNVGVLNLNGAL 715

Query: 494 GGVFADASLTSAKIAKINIGEVNAGPAVYALDALNGDFPLDAPGVTFVNSASVLKLMTTV 553
             V  +   T+A +A I++G   A      + A       +A  VTF N   V   +   
Sbjct: 716 SQVTGNIGNTNA-LATISVGAGKATLGGAVIKATTTKLTDNASAVTFTNPVVVTGAIDNT 774

Query: 554 ASGKNSTIELTGNIEPVVPNTGVVEINARNANTKLTIDGMANKYAIGTKANPVSKVQLTG 613
            +  N     TG+          V  N  N N   T++  A    +       + + LT 
Sbjct: 775 GNANNGIATFTGD--------STVTGNIGNTNALATVNVGAGLLRVQGGVVKSNTINLTD 826

Query: 614 HGTLV 618
           + + V
Sbjct: 827 NASAV 831



 Score = 40.4 bits (93), Expect = 4e-05
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 4/55 (7%)

Query: 54  GNIDNKLGGGVNILNFVGNSTVIGNVGATNPVNILNVQGNNAGTINLAAGGNLAA 108
           G IDN       I+ F G+STV GN+G TN +  +NV    AG + L AGG+L A
Sbjct: 913 GAIDNTGNANNGIVTFTGDSTVTGNIGNTNALATVNV---GAG-VTLQAGGSLDA 963



 Score = 38.1 bits (87), Expect = 2e-04
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 20  LVRFQQDVISD--IDFNGTAAQVTIADGKNVGGATGGNIDNKLGGGVNILNFVGNSTVIG 77
           L+R Q  V+    I+    A+ VT  +   V GA    IDN       I+ F G+STV G
Sbjct: 809 LLRVQGGVVKSNTINLTDNASAVTFTNPVVVTGA----IDNTGNANNGIVTFTGDSTVTG 864

Query: 78  NVGATNPVNILNVQGNNA 95
           N+G TN +  ++V    A
Sbjct: 865 NIGNTNALATISVGAGKA 882


>OMPA_RICRI RecName: Full=Outer membrane protein A;AltName: Full=rOmp
            A;         Short=rOmpA;AltName: Full=190 kDa
            antigen;AltName: Full=Cell surface antigen;
          Length = 2249

 Score = 65.1 bits (157), Expect = 2e-12
 Identities = 87/334 (26%), Positives = 128/334 (38%), Gaps = 38/334 (11%)

Query: 271  VNAAGNKTVI--LQKSVSATSLTLGNNAVANLQDSLTKSGNVDFTNGGVLEFSGANPAG- 327
            V   GN TV   +  + +  ++ +G         SL  + N+DF     LEF+G    G 
Sbjct: 1154 VTFTGNSTVTGDIGNTNALATVNVGAGITLQAGGSLA-ANNIDFGARSTLEFNGPLDGGG 1212

Query: 328  ----YLLNSQIKNGNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNAVAAFTIDVSNKA 383
                Y             LNV T   +LTA+  +IG V  INIG GN    FTID S   
Sbjct: 1213 KAIPYYFKXXXXXXXXXXLNVNTK--LLTASHLTIGTVAEINIGAGNL---FTIDASVGD 1267

Query: 384  LTL--GSDINLNNTKSVFGLTTSKNQQVT-FMNSVDGFAGGGGSVNLSSTSSTIPNDNVL 440
            +T+    +IN     SV  L+      V   + + D  A G                   
Sbjct: 1268 VTILNAQNINFRARDSVLVLSNLTGVGVNNILLAADLVAPGADEXXXXXXXXXXXXXXXX 1327

Query: 441  TLQGNLGN--ETLGTKANPLAXXXXXXXXXXXXXXXXXXXXXLDMSNTAVLNIAAGGVFA 498
                   N  +  G K N L                       D++   + N+    +  
Sbjct: 1328 XXXXTARNIGDGGGNKFNTLLIYNAVTITD-------------DVNLEGIQNVL---INK 1371

Query: 499  DASLTSAKIAKINIGEVNAGPAVYALDALNGDFPLDAPGVTFVNSASVLKLMTTVASGKN 558
            +A  TS+     N G +    A Y +DA NG+  + A  + F ++ + L L  +  SG +
Sbjct: 1372 NADFTSS--TAFNAGAIQINDATYTIDANNGNLNIPAGNIQFAHADAQLVLQNS--SGND 1427

Query: 559  STIELTGNIEPVVPNTGVVEINARNANTKLTIDG 592
             TI L  NI+P   + G+V +N+  A  KLTI G
Sbjct: 1428 RTITLGANIDPDNDDEGIVILNSVTAGKKLTIAG 1461



 Score = 44.7 bits (104), Expect = 2e-06
 Identities = 33/78 (42%), Positives = 42/78 (53%), Gaps = 8/78 (10%)

Query: 31   IDFNGTAAQVTIADGKNVGGATGGNIDNKLGGGVNILNFVGNSTVIGNVGATNPVNILNV 90
            I+    A+ VT  +   V GA    IDN       I+ F GNSTV G++G TN +  +NV
Sbjct: 1122 INLTDNASAVTFTNPVVVTGA----IDNTGNANNGIVTFTGNSTVTGDIGNTNALATVNV 1177

Query: 91   QGNNAGTINLAAGGNLAA 108
                AG I L AGG+LAA
Sbjct: 1178 ---GAG-ITLQAGGSLAA 1191


>YHU2_SCHPO RecName: Full=Uncharacterized threonine-rich GPI-anchored
            glycoprotein PJ4664.02;Flags: Precursor;
          Length = 3971

 Score = 47.4 bits (111), Expect = 4e-07
 Identities = 70/370 (18%), Positives = 149/370 (40%), Gaps = 56/370 (15%)

Query: 276  NKTVILQKSVSATSLTLGNNAVANLQDSLTKSG----NVDFTNGGVLEFSGANPAGYLLN 331
            + T I   S+  +S  + +++V N   ++T S     +   T+  +L  S    +  ++N
Sbjct: 3092 SSTAITSSSIVNSSTPITSSSVLNSSTAITSSSILNSSTPITSSSILNSSTPITSSTVVN 3151

Query: 332  SQIKNGNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNAVAAFTIDVSNKALTLGSDIN 391
            S     ++ TLN  T  T  +  +SS  + ++  +     + + ++  S+  +T  + +N
Sbjct: 3152 SSTPITSSTTLNTSTPITSSSVLNSSTAITSSSIVNSSTPITSSSVLNSSTPITSSTTLN 3211

Query: 392  ----------LNNTKSVFGLTTSKNQQVTFMNSVDGFAGGGGSVNLSSTSSTIPNDNVLT 441
                      LN++ ++   +   +      +SV   +    S  + +TS+ I + +VL 
Sbjct: 3212 TSTPITSSSVLNSSTAITSSSVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLN 3271

Query: 442  LQGNLGNETLGTKANPLAXXXXXXXXXXXXXXXXXXXXXLDMSNTAVLNIAAGGVFADAS 501
                + + T+   + P+                         +++ V+N +     +   
Sbjct: 3272 SSTPITSSTVVNTSTPI-------------------------TSSTVVNSSTPITSSTTL 3306

Query: 502  LTSAKIAKINIGEVNAGPAVYALDALNGDFPLDAPGV----TFVNSASVLKLMTTVASGK 557
             TS  I   ++  +N+  A+ +  ALN   P+ +  V    T + S+S+L   T V S  
Sbjct: 3307 NTSTPITSSSV--LNSSTAITSSTALNTSTPITSSSVLNSSTAITSSSILNSSTPVTSSS 3364

Query: 558  --NSTIELTGNIEPVVPNTGVVEINARNANTKLTIDGMANKYAIGTKANPVSKVQLTGHG 615
              NS+  +T +   V  +T +    A N +T +T   + N       + P++   +    
Sbjct: 3365 VLNSSTPITSS-TVVNSSTPITSSTALNTSTPITSSSVLN------SSTPITSSTVVNSS 3417

Query: 616  TLVI--TALN 623
            T +   TALN
Sbjct: 3418 TPITSSTALN 3427



 Score = 36.2 bits (82), Expect = 8e-04
 Identities = 42/196 (21%), Positives = 85/196 (43%), Gaps = 7/196 (3%)

Query: 268  AITVNAAGNK-TVILQKSVSATSLTLGNNAVANLQDSLTKSG----NVDFTNGGVLEFSG 322
            AIT ++  N  T I   SV  +S  + ++ V N    +T S     +   T+  V+  S 
Sbjct: 3227 AITSSSVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 3286

Query: 323  ANPAGYLLNSQIKNGNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNAVAAFTIDVSNK 382
               +  ++NS     ++ TLN  T  T  +  +SS  + ++  +     + + ++  S+ 
Sbjct: 3287 PITSSTVVNSSTPITSSTTLNTSTPITSSSVLNSSTAITSSTALNTSTPITSSSVLNSST 3346

Query: 383  ALTLGSDINLNNTKSVFGLTTSKNQQVTFMNSVDGFAGGGGSVNLSSTSSTIPNDNVLTL 442
            A+T  S +N ++T        + +  +T    V+       S  L +TS+ I + +VL  
Sbjct: 3347 AITSSSILN-SSTPVTSSSVLNSSTPITSSTVVNSSTPITSSTAL-NTSTPITSSSVLNS 3404

Query: 443  QGNLGNETLGTKANPL 458
               + + T+   + P+
Sbjct: 3405 STPITSSTVVNSSTPI 3420


>OMPB_RICJA RecName: Full=Outer membrane protein B;AltName:
           Full=rOmp B;         Short=rOmpB;AltName: Full=168 kDa
           surface-layer protein;
          Length = 1656

 Score = 44.7 bits (104), Expect = 2e-06
 Identities = 94/370 (25%), Positives = 136/370 (36%), Gaps = 54/370 (14%)

Query: 293 GNNAVANLQDSLTKSGNVDF-TNGGVLEFSGANP----AGYLL--NSQIKNGNTGTLNVY 345
           G  A+AN  + L+  G +DF      L F  ANP    A  +L  N+ I NG  GTLNV 
Sbjct: 160 GGAAIAN--NDLSGLGTIDFGAAASTLVFDLANPTTQKAPLILADNALIVNGANGTLNV- 216

Query: 346 TTGTILTATDSSIGMVNTINIGQGNAVAAFTIDVSNKALTL---GSDINLNNTKSVFGLT 402
            T   +  +D S   V  INIG G                    G+ IN N T     L 
Sbjct: 217 -TNGFIQVSDKSFATVKAINIGDGQGFMFXXXXXXXXXXXXQAGGTTINFNGTDGTGRLV 275

Query: 403 -TSKNQQVTFMNSVDGFAGGG--GSVNLSSTSSTIPNDNVLTLQGNLGNETLGT-----K 454
             SKN   T  N V G  GG   G + L    +T+  +  L       N  +GT     +
Sbjct: 276 LLSKNGAATDFN-VTGSLGGNLKGIIEL----NTVAINGQLIANAGPANAVIGTNNGAGR 330

Query: 455 ANPLAXXXXXXXXXXXXXXXXXXXXXLDMSNT-------AVLNIAAGGVFADASLTS--- 504
           A                         +  +N         ++++   G  A  +  S   
Sbjct: 331 AAGFVVSVDNGKAATIDGQVYAKDMVIQSANANGQVNFRHIVDVGIDGTTAFKTAASIVA 390

Query: 505 ----AKIAKINIGEVNAGPAVYALDALNGDFPLDA--PGVTFVNSASVLKLM---TTVAS 555
               +     + G + A   V     L G+F  DA  PG    N+A V+      T  ++
Sbjct: 391 ITQNSNFGTTDFGNLAAQVTVPDTMTLTGNFTGDANNPG----NTAGVITFAANGTLASA 446

Query: 556 GKNSTIELTGNIEPV-VPNTGVVEIN-ARNANTKLTIDGMANKYAIGTKAN-PVSKVQLT 612
             ++ + +T NI  +     GVV+++    A  +L   G   K A GT  N  V++  L 
Sbjct: 447 SADANVAVTNNITAIEASGVGVVQLSGTHTAELRLGNAGSVFKLADGTVINGKVNQTVLV 506

Query: 613 GHGTLVITAL 622
           G G L   A+
Sbjct: 507 G-GVLAAGAI 515



 Score = 38.1 bits (87), Expect = 2e-04
 Identities = 29/101 (28%), Positives = 43/101 (42%), Gaps = 15/101 (14%)

Query: 6   YRRGRIIVQFTQNSLVRFQQDVISDIDFNGTAAQVTIADGKNVGGATGGNIDNKLGGGVN 65
           ++    IV  TQNS            DF   AAQVT+ D   + G   G+ +N  G    
Sbjct: 382 FKTAASIVAITQNSN-------FGTTDFGNLAAQVTVPDTMTLTGNFTGDANNP-GNTAG 433

Query: 66  ILNFVGNSTVI-----GNVGATNPVNILNVQGNNAGTINLA 101
           ++ F  N T+       NV  TN  NI  ++ +  G + L+
Sbjct: 434 VITFAANGTLASASADANVAVTN--NITAIEASGVGVVQLS 472


>OMPB_RICCN RecName: Full=Outer membrane protein B;AltName:
           Full=rOmp B;         Short=rOmpB;AltName: Full=168 kDa
           surface-layer protein;
          Length = 1655

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 44/115 (38%), Positives = 51/115 (44%), Gaps = 15/115 (13%)

Query: 318 LEFSGANP----AGYLL--NSQIKNGNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNA 371
           L F+ ANP    A  +L  N+ I NG  GTLNV  T   +  +  S   VN INIG G  
Sbjct: 184 LVFNLANPTTQKAPLILGDNAVIVNGANGTLNV--TNGFIKVSSKSFATVNVINIGDGQG 241

Query: 372 VAAFTIDVSN-KALTL---GSDINLNNTKSVFGLT-TSKNQQVTFMNSVDGFAGG 421
           +  F  D  N   L L   G+ I  N T     L   SKN   T  N V G  GG
Sbjct: 242 I-MFNTDADNVNTLNLQANGATITFNGTDGTGRLVLLSKNAAATDFN-VTGSLGG 294


>YPJA_ECOLI RecName: Full=Uncharacterized outer membrane protein
           ypjA;Flags: Precursor;
          Length = 1526

 Score = 40.4 bits (93), Expect = 4e-05
 Identities = 51/200 (25%), Positives = 85/200 (42%), Gaps = 23/200 (11%)

Query: 270 TVNAAGNKTVILQKSVSATSLTLGNNAVANLQDSLTKSGNVDFTNGGVLEFS-------- 321
           T++  G   +I+QK     S  L N  V  +QD   ++ +V+  +GG L  S        
Sbjct: 502 TIDTGGK--LIVQKEAKTDSTRLNNGGVLEVQDG-GEAKHVEQQSGGALIASTTSGTLIE 558

Query: 322 GANPAG---YLLNSQIKN---GNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNAV-AA 374
           G N  G   Y+ NS+ KN    N G+L V T    +    ++ G ++      G  + +A
Sbjct: 559 GTNSYGDAFYIRNSEAKNVVLENAGSLTVVTGSRAVDTIINANGKMDVYGKDVGTVLNSA 618

Query: 375 FTIDVSNKALTLGSDINLNNTKSVFGLTTSKN----QQVTFMNSVDGFAGGGGSVNLSST 430
            T  +   A +  ++I     ++V+GL T  N    +Q+    S +     GG+  + + 
Sbjct: 619 GTQTIYASATSDKANIK-GGKQTVYGLATEANIESGEQIVDGGSTEKTHINGGTQTVQNY 677

Query: 431 SSTIPNDNVLTLQGNLGNET 450
              I  D V  LQ  + N T
Sbjct: 678 GKAINTDIVSGLQQIMANGT 697


>YUAO_ECOLI RecName: Full=Uncharacterized protein yuaO;Flags:
           Precursor;
          Length = 1758

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 38/185 (20%), Positives = 76/185 (41%), Gaps = 10/185 (5%)

Query: 272 NAAGNKTVILQKSVSATSLTLGNNAVANLQDSLTKSGN-VDFTNGGVLEFSGANPAGYLL 330
           NAA  K ++    +SA S+++G    A    ++T +GN    ++G     +  N A   L
Sbjct: 713 NAASAKVIVDNADLSANSMSIGEGDTA----AVTMTGNGATISSGNTFTVARGNNASATL 768

Query: 331 N---SQIKNGNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNAVAAFTIDVSNKALTLG 387
           +   S+               T+LT  DS++     + +GQG             ++ + 
Sbjct: 769 DYSDSKXXXXXXXXXXXEKAQTVLTLKDSALAATGDVIMGQGQETQTDLTLSPQSSIKVS 828

Query: 388 SDINLNNTKSVFGLTTSKNQQVTFMNSVDGFAGGGGSVNLSSTSSTIPNDNVLTL-QGNL 446
            ++++    +        N  ++  NS+    G   +V ++   +TI + N  T+ +GN 
Sbjct: 829 GNMSIAQGNAASAKVIVDNADLS-ANSMSIGEGDTAAVTMTGNGATISSGNTFTVARGNN 887

Query: 447 GNETL 451
            + TL
Sbjct: 888 ASATL 892


>PMP9_CHLPN RecName: Full=Probable outer membrane protein
           pmp9;AltName: Full=Polymorphic membrane protein
           9;AltName: Full=Outer membrane protein 10;
          Length = 928

 Score = 37.0 bits (84), Expect = 5e-04
 Identities = 50/213 (23%), Positives = 79/213 (37%), Gaps = 39/213 (18%)

Query: 269 ITVNAAGNKTVILQKSVSATS--LTLGNNAVANLQDSLTKSGNVDFTNGGVLEFSGANPA 326
           +++  AG+ T +       T+  L+   +    L  ++    N  FTN    +       
Sbjct: 65  VSITNAGSPTALTASCFKETTGNLSFQGHGYQFLLQNIDAGANCTFTNTAANKXXXXXXX 124

Query: 327 GYLLNSQIKNGNTGTLNVYTTGTILTATDSSIGMVNTINIGQGNAVAAFTIDVS------ 380
                 Q  N  TGT  + +TG     ++ S       +   G A+   +I +S      
Sbjct: 125 XXXXXIQTTNATTGTGAIKSTGACSIQSNYSCYFGQNFSNDNGGALQGSSISLSLNPNLT 184

Query: 381 ---NKALTLGS------DINLNNT--KSVFGLTT----------------SKNQQVTFMN 413
              NKA   G        I +NNT   + F   T                S N+ ++F+N
Sbjct: 185 FAKNKATQKGGALYSTGGITINNTLNSASFSENTAANNGGAIYTEASSFISSNKAISFIN 244

Query: 414 -SVDGFAGGGGSVNLSSTSSTIPNDNVLTLQGN 445
            SV   +  GG++  SSTS+  P   VLTL  N
Sbjct: 245 NSVTATSATGGAIYCSSTSAPKP---VLTLSDN 274


>FLGI_COLP3 RecName: Full=Flagellar P-ring protein;AltName:
           Full=Basal body P-ring protein;Flags: Precursor;
          Length = 363

 Score = 37.0 bits (84), Expect = 5e-04
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 13/112 (11%)

Query: 318 LEFSGANPAGYLLNSQIKNGNTGTLNVYTTGTILTATDSSIGMVNTIN----IGQGNAVA 373
           LEF  A+PA  +    I N  TGT+ + +  T+L A  +  G+  TIN    + Q NA A
Sbjct: 241 LEFEPASPAAKI----IVNSRTGTIVIGSEVTLLAAAITHGGITVTINEIQDVSQPNAFA 296

Query: 374 AFTIDVSNKALTLGSDINLNNTKSVFGLTTSKNQQVTFMNSVDGFAGGGGSV 425
                V+N+     SDIN++N+ +   +        T + +++    G G V
Sbjct: 297 EGETVVTNQ-----SDINVSNSDARMFVFKPGVTLETLVRAINEVGAGPGDV 343


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.320    0.134    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 7,853,422,417
Number of extensions: 316429759
Number of successful extensions: 880905
Number of sequences better than 1.0e-03: 20832
Number of HSP's gapped: 847338
Number of HSP's successfully gapped: 27615
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.9 bits)