# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_23266.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAL03301.1  [L=221]
Description: rcon0 AAL03301.1 GIB00062CH01 "unknown"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
        2.3    9.8   0.0        3.4    9.2   0.0    1.3  1  PF12018  Domain of unknown function (DUF3508)
        3.5   10.7   0.1         38    7.4   0.0    2.3  2  PF02189  Immunoreceptor tyrosine-based activation motif
         19    8.0   0.2         75    6.1   0.0    2.1  1  PF04336  Protein of unknown function, DUF479
         40    6.8   0.0    1.7e+02    4.7   0.0    1.9  1  PF11408  Sgs1 RecQ helicase
         42    6.2   0.0         84    5.2   0.0    1.4  1  PF09314  Domain of unknown function (DUF1972)
         61    6.0   0.1    1.1e+02    5.2   0.0    1.4  1  PF06358  Protein of unknown function (DUF1065)
         69    6.3   0.4    1.7e+02    5.0   0.3    1.6  1  PF10530  Toxin with inhibitor cystine knot ICK or Knottin sc
         70    5.8   0.0    1.4e+02    4.9   0.0    1.4  1  PF07011  Protein of unknown function (DUF1313)
      1e+02    5.3   1.0    5.2e+02    3.0   0.1    2.1  2  PF00647  Elongation factor 1 gamma, conserved domain
    1.1e+02    5.8   0.0    2.5e+02    4.6   0.0    1.6  1  PF11689  Protein of unknown function (DUF3286)
    1.2e+02    5.6   0.0    1.9e+02    4.9   0.0    1.2  1  PF02203  Tar ligand binding domain homologue
    1.5e+02    5.1   0.6    4.7e+02    3.5   0.2    2.0  1  PF10841  Protein of unknown function (DUF2644)
    2.1e+02    3.3   0.0    2.7e+02    2.9   0.0    1.1  1  PF04007  Protein of unknown function (DUF354)
    2.4e+02    3.9   0.1    6.5e+02    2.5   0.1    1.7  1  PF08253  Erm Leader peptide
    3.5e+02    3.3   0.1    6.9e+02    2.4   0.0    1.4  1  PF10855  Protein of unknown function (DUF2648)
    3.7e+02    2.8   0.2    5.3e+02    2.3   0.1    1.2  1  PF09564  NgoBV restriction endonuclease
    4.8e+02    3.6   0.0    7.4e+02    3.0   0.0    1.2  1  PF07392  Cyclin-dependent kinase inhibitor 2a p19Arf N-termi
    5.5e+02    3.5   0.1    1.4e+03    2.2   0.1    1.7  1  PF07620  SLEI


Domain and alignment annotation for each model:
>> PF12018  Domain of unknown function (DUF3508)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.2   0.0   0.00062       3.4      99     150 ..      56     110 ..      40     143 .. 0.69

  Alignments for each domain:
  == domain 1    score: 9.2 bits;  conditional E-value: 0.00062
     PF12018  99 ktavpteqvfPlFaalaqlwikLkeekelvs...vlsnllenLekflkaqkllfp 150
                 +  +p     P+F++l+++++kL e+  l      + ++ + L++ ++  ++ ++
  AAL03301.1  56 SPIMPEDSLLPKFSYLSKIFAKLSEKRMLFYcdlFMGEISTLLREATESCDEAIS 110
                 5556888899**************9988764111456666777766666666666 PP

>> PF02189  Immunoreceptor tyrosine-based activation motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.3   0.0       1.4   7.5e+03       5      16 ..     120     131 ..     120     132 .. 0.67
   2 ?    7.4   0.0    0.0069        38       4      21 .]     144     161 ..     143     161 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.3 bits;  conditional E-value: 1.4
                 S----------- CS
     PF02189   5 qpLnkrqrdtYs 16 
                 qp   r++d Y 
  AAL03301.1 120 QPMAARNDDLYQ 131
                 566668888885 PP

  == domain 2    score: 7.4 bits;  conditional E-value: 0.0069
                 SS---------------- CS
     PF02189   4 YqpLnkrqrdtYsdLgtk 21 
                 Yq+L+++    Ys++g+k
  AAL03301.1 144 YQELSTDCSVYYSVIGRK 161
                 *******9999****997 PP

>> PF04336  Protein of unknown function, DUF479
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.013        75      58     102 ..     102     146 ..      98     156 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.013
     PF04336  58 legieraLarmakrlsrpnplagaveelekhyeeleedFlafypd 102
                  e +++a+++  +rlsr +p+a   ++l +h++    +  + y++
  AAL03301.1 102 TESCDEAISGYLTRLSRSQPMAARNDDLYQHQNGTLYKLFKCYQE 146
                 5778999***********************999876666566655 PP

>> PF11408  Sgs1 RecQ helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.031   1.7e+02      63      79 ..      67      83 ..      60      84 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.031
                HGGGTHHHHHHHHHHTT CS
     PF11408 63 kykyfkatladlrkkrs 79
                k+ y+++++a+l+ kr+
  AAL03301.1 67 KFSYLSKIFAKLSEKRM 83
                9*************997 PP

>> PF09314  Domain of unknown function (DUF1972)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.015        84     134     159 ..      67      92 ..      62     105 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.015
     PF09314 134 kWskpvkkylkfseklmvkyadlvis 159
                 k+s + k + k+sek m+ y+dl + 
  AAL03301.1  67 KFSYLSKIFAKLSEKRMLFYCDLFMG 92 
                 8889999****************876 PP

>> PF06358  Protein of unknown function (DUF1065)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0      0.02   1.1e+02      22      57 ..      29      64 ..       5      73 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.02
     PF06358 22 vvsvlyspffsnevkassyagavfknsgcimdrnsf 57
                 +++lys +f+    +s+y+   + ns  im  +s+
  AAL03301.1 29 DLALLYSLIFATTSSSSAYSLDALTNSSPIMPEDSL 64
                4789***************************88875 PP

>> PF10530  Toxin with inhibitor cystine knot ICK or Knottin scaffold
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.3     0.031   1.7e+02      13      19 ..     165     171 ..     164     172 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.031
     PF10530  13 kGCCfkm 19 
                 ++CC+ +
  AAL03301.1 165 HNCCYSY 171
                 9***975 PP

>> PF07011  Protein of unknown function (DUF1313)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.024   1.4e+02      39      74 ..     117     152 ..     114     163 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.024
     PF07011  39 sripdnlsrNVaLirelNgNiskVvslYsdLstsFs 74 
                 sr +   +rN  L +  Ng + k  + Y++Lst+ s
  AAL03301.1 117 SRSQPMAARNDDLYQHQNGTLYKLFKCYQELSTDCS 152
                 66666778999*********************9865 PP

>> PF00647  Elongation factor 1 gamma, conserved domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   0.1      0.71   3.9e+03      33      60 ..     126     153 ..     108     159 .. 0.78
   2 ?    3.0   0.1     0.093   5.2e+02      35      65 ..     179     209 ..     175     213 .. 0.80

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 0.71
     PF00647  33 lpyfwehfdkegyslwkvkykyeeelkl 60 
                  + +++h +   y+l+k+  ++  ++ +
  AAL03301.1 126 NDDLYQHQNGTLYKLFKCYQELSTDCSV 153
                 4678999999999999998778777766 PP

  == domain 2    score: 3.0 bits;  conditional E-value: 0.093
     PF00647  35 yfwehfdkegyslwkvkykyeeelklefmts 65 
                 +f +  d++ ++lw+v+y++e  ++++  + 
  AAL03301.1 179 TFCTSSDAHYTTLWWVNYSIEILNTVHTEVR 209
                 6888899999********9887776666555 PP

>> PF11689  Protein of unknown function (DUF3286)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.046   2.5e+02       5      24 ..      69      88 ..      61     101 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.046
     PF11689  5 SglkkahfssvptresFtlk 24
                S l k + +++++r+ F++ 
  AAL03301.1 69 SYLSKIFAKLSEKRMLFYCD 88
                7789999************7 PP

>> PF02203  Tar ligand binding domain homologue
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.034   1.9e+02      40      81 ..      91     129 ..      88     151 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.034
                 SSSCSHHHHHHHHHHHHHHHHHHHHHTS-.--GGGHHHHHHH CS
     PF02203  40 egalnellaeaeeslaqaekhFseyeaapkkaeqdealaael 81 
                 +g++++ll ea es+++a + +   +++  +++ + a++++l
  AAL03301.1  91 MGEISTLLREATESCDEAISGYLTRLSR--SQP-MAARNDDL 129
                 57899*****************999999..777.44554444 PP

>> PF10841  Protein of unknown function (DUF2644)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.2     0.085   4.7e+02      30      51 ..     154     175 ..     149     183 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.085
     PF10841  30 vyavyldrpyveelfntfaifc 51 
                  y+v+  ++yv++    ++i++
  AAL03301.1 154 YYSVIGRKSYVHNCCYSYLIIL 175
                 59*************9999987 PP

>> PF04007  Protein of unknown function (DUF354)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0     0.048   2.7e+02     245     277 ..      83     115 ..      71     136 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.048
     PF04007 245 LlyysdlvigagGtmnReaalLGvpavscyPgk 277
                 +l+y+dl +g   t+ Rea      a+s y  +
  AAL03301.1  83 MLFYCDLFMGEISTLLREATESCDEAISGYLTR 115
                 79*****************99998999888665 PP

>> PF08253  Erm Leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1      0.12   6.5e+02       3      13 ..     195     205 ..     195     205 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.12
     PF08253   3 lFSIFVIntVH 13 
                 ++SI   ntVH
  AAL03301.1 195 NYSIEILNTVH 205
                 7999999**** PP

>> PF10855  Protein of unknown function (DUF2648)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.12   6.9e+02      12      23 ..     135     146 ..     134     147 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.12
     PF10855  12 gaafygFKKYQn 23 
                 g ++  FK YQ+
  AAL03301.1 135 GTLYKLFKCYQE 146
                 678999*****8 PP

>> PF09564  NgoBV restriction endonuclease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1     0.096   5.3e+02     171     216 ..     151     196 ..     138     210 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.096
     PF09564 171 pgvwysinkknlplfecledfvsaieetvyqnpatrhnaslwkrkf 216
                  +v+ys+  ++  + +c  +++  ++ + +  ++  h ++lw  ++
  AAL03301.1 151 CSVYYSVIGRKSYVHNCCYSYLIILDYSTFCTSSDAHYTTLWWVNY 196
                 5799**9999999***************************997665 PP

>> PF07392  Cyclin-dependent kinase inhibitor 2a p19Arf N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0      0.13   7.4e+02      20      50 ..      90     120 ..      88     121 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.13
     PF07392  20 FvvkivrssrersAsgaraavalvLllvRsq 50 
                 F+  i   +re++ s+  a+   + +l Rsq
  AAL03301.1  90 FMGEISTLLREATESCDEAISGYLTRLSRSQ 120
                 777889999********************98 PP

>> PF07620  SLEI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.1      0.26   1.4e+03       5      10 ..     197     202 ..     195     204 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.26
     PF07620   5 SLEIfN 10 
                 S EI+N
  AAL03301.1 197 SIEILN 202
                 99**** PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (221 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       272  (0.0228341); expected 238.2 (0.02)
Passed bias filter:                      195  (0.01637); expected 238.2 (0.02)
Passed Vit filter:                        18  (0.00151108); expected 11.9 (0.001)
Passed Fwd filter:                        18  (0.00151108); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              18  [number of targets reported over threshold]
# CPU time: 0.18u 0.03s 00:00:00.21 Elapsed: 00:00:01
# Mc/sec: 2650.65
//