# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_23271.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAL03819.1  [L=249]
Description: rcon0 AAL03819.1 GIB00062CH01 "unknown"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
     0.0009   22.0   1.0        4.2   10.1   0.1    2.5  2  PF09411  Lipid A 3-O-deacylase (PagL)
  ------ inclusion threshold ------
      0.011   16.9   0.7      0.011   16.9   0.5    2.2  2  PF03249  Type specific antigen
        2.7   10.4   0.0        5.4    9.4   0.0    1.4  1  PF00167  Fibroblast growth factor
        3.8   10.4   0.2        9.7    9.1   0.2    1.7  1  PF05079  Protein of unknown function (DUF680)
         10    9.1   0.0         56    6.7   0.0    2.1  1  PF04773  FecR protein
         11    7.3   0.7         19    6.6   0.0    1.6  1  PF07396  Phosphate-selective porin O and P
         15    7.3   0.1         83    4.9   0.1    1.9  1  PF04414  D-aminoacyl-tRNA deacylase
         31    7.0   1.3         42    6.6   0.1    1.8  1  PF05481  Mycobacterium 19 kDa lipoprotein antigen
         31    6.9   0.1         74    5.7   0.0    1.6  1  PF08195  TRI9 protein
         35    7.2   0.6         72    6.2   0.4    1.5  1  PF05968  Bacillus PapR protein
         44    6.5   0.0         90    5.5   0.0    1.4  1  PF09006  Lung surfactant protein D coiled-coil trimerisation
         45    6.9   7.0        4.5   10.1   1.4    2.0  1  PF12393  Dr family adhesin
         46    5.3   0.1         64    4.8   0.0    1.1  1  PF00266  Aminotransferase class-V
         51    5.8   0.1         80    5.2   0.1    1.3  1  PF07795  Protein of unknown function (DUF1635)
         53    5.4   0.0         89    4.7   0.0    1.3  1  PF06560  Glucose-6-phosphate isomerase (GPI)
         60    6.2   0.3    1.5e+02    5.0   0.1    1.8  1  PF03106  WRKY DNA -binding domain
         65    5.7   0.0         87    5.3   0.0    1.2  1  PF07996  Type IV secretion system proteins
         79    5.5   0.1    1.5e+02    4.6   0.1    1.4  1  PF06270  Protein of unknown function (DUF1030)
         84    5.4   1.1    1.7e+02    4.3   0.7    1.5  1  PF08085  Entericidin EcnA/B family
         88    5.4   0.0    1.7e+02    4.5   0.0    1.4  1  PF07029  CryBP1 protein
    1.7e+02    4.4   0.0    2.5e+02    3.8   0.0    1.2  1  PF03145  Seven in absentia protein family
    1.7e+02    5.2   1.7    4.9e+02    3.8   1.2    1.8  1  PF08139  Prokaryotic membrane lipoprotein lipid attachment s
    2.5e+02    4.1   0.1    6.7e+02    2.7   0.1    1.8  1  PF08790  LYAR-type C2HC zinc finger
    2.8e+02    4.6   0.1    7.9e+02    3.2   0.1    1.7  1  PF12553  Protein of unknown function (DUF3742)
    3.1e+02    1.6   2.2    4.2e+02    1.2   1.5    1.1  1  PF05110  AF-4 proto-oncoprotein
    4.6e+02    2.5   0.8    7.9e+02    1.7   0.6    1.3  1  PF05756  S-antigen protein
      5e+02    3.1   0.2      9e+02    2.3   0.1    1.3  1  PF02674  Colicin V production protein
      6e+02    3.3   0.0    9.6e+02    2.6   0.0    1.3  1  PF10187  N-terminal domain of NEFA-interacting nuclear prote
    9.1e+02    2.9   1.2    1.6e+03    2.1   0.9    1.4  1  PF11839  Protein of unknown function (DUF3359)
    9.6e+02    2.7   0.2    2.6e+03    1.4   0.1    1.6  1  PF07620  SLEI
    1.4e+03    2.2   1.2    3.1e+03    1.1   0.8    1.5  1  PF01138  3' exoribonuclease family, domain 1
    1.9e+03    1.6   0.5    4.3e+03    0.4   0.3    1.4  1  PF08106  Formaecin family
    1.5e+04    0.1   7.7    3.6e+03    2.0   0.3    3.5  2  PF05017  TMP repeat


Domain and alignment annotation for each model:
>> PF09411  Lipid A 3-O-deacylase (PagL)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   10.0   0.0    0.0015       4.6      63     109 ..      43      98 ..      34     103 .. 0.88
   2 !   10.1   0.1    0.0014       4.2      63     111 ..     145     207 ..     115     211 .. 0.79

  Alignments for each domain:
  == domain 1    score: 10.0 bits;  conditional E-value: 0.0015
                 -EE-EEEE----EEE---B--.........--B----EEEEEEE----EE----B- CS
     PF09411  63 ssklyleagigvallsktrde.........dkdlgtafqFedqlglGyqfgdrasv 109
                 ++++yl +++g+++++kt+++         + ++ ++  F+ ++g+Gy + d+ ++
  AAL03819.1  43 ENQWYLKLNAGGVIFNKTKPKgadfklnniKSNIKSNTGFTGEIGAGYYIMDNLRT 98 
                 348***************************999***************99888765 PP

  == domain 2    score: 10.1 bits;  conditional E-value: 0.0014
                 -E.E-EEEE----EEE---B--...........--B----EEEEEEE----EE----..B--- CS
     PF09411  63 ss.klyleagigvallsktrde...........dkdlgtafqFedqlglGyqfgdra..svgl 111
                 s  k+++ ag+g+a++ ++ ++           +     + +F++ql lG  f+  +  +++l
  AAL03819.1 145 SMfKVFAGAGVGAAFVKEKIHSkdikggvtdtfNGTTKNKTNFAYQLSLGTSFEVAQgvKAEL 207
                 44489*************************999777777888888888888888777445555 PP

>> PF03249  Type specific antigen
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   0.2      0.42   1.3e+03       1      15 [.       1      15 [.       1     120 [. 0.65
   2 ?   16.9   0.5   3.6e-06     0.011     437     472 ..     137     172 ..     128     211 .. 0.79

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 0.42
     PF03249  1 mkkimliasamsals 15
                mkk++lia+a +al 
  AAL03819.1  1 MKKLLLIAAASTALL 15
                888888888888763 PP

  == domain 2    score: 16.9 bits;  conditional E-value: 3.6e-06
     PF03249 437 lyadllttesfsiyaGvGaGlaytsGkiddkdikah 472
                  y d++    f ++aG G G a+ + ki  kdik+ 
  AAL03819.1 137 GYVDFVDLSMFKVFAGAGVGAAFVKEKIHSKDIKGG 172
                 599******************************964 PP

>> PF00167  Fibroblast growth factor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.4   0.0    0.0018       5.4      69     105 ..      20      55 ..       8      67 .. 0.83

  Alignments for each domain:
  == domain 1    score: 9.4 bits;  conditional E-value: 0.0018
                 -TGGG-----BSSSS-B-----S---TT--------- CS
     PF00167  69 lsseCvfkEeleennYntyasakykrewyvalnkkGr 105
                    +C ++ +++++    ++s  + ++wy+ ln  G 
  AAL03819.1  20 SFADCDMNSSVDSSTNSSMSSSVE-NQWYLKLNAGGV 55 
                 4469******************99.********9885 PP

>> PF05079  Protein of unknown function (DUF680)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   0.2    0.0032       9.7       1      49 [.       1      44 [.       1      71 [. 0.65

  Alignments for each domain:
  == domain 1    score: 9.1 bits;  conditional E-value: 0.0032
     PF05079  1 MkkiaLtaAA..iLvasgsAFAgSdnygsdnvnqpaatakvDtsaTasiek 49
                Mkk++L aAA   L+ sg  FA  d   ++ v+         +s  +s+e+
  AAL03819.1  1 MKKLLLIAAAstALLTSGLSFADCDM--NSSVDSST-----NSSMSSSVEN 44
                9*****9998556999******9998..22333333.....3355555555 PP

>> PF04773  FecR protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.018        56      18      64 ..      27      70 ..      16      79 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.018
     PF04773 18 gsrvrlgansalskdasegrrerevkllkGevlvdvaksakrpfeve 64
                +s+v  ++ns++ +++ e++    +kl +G v+++ +k +  +f+++
  AAL03819.1 27 NSSVDSSTNSSM-SSSVENQWY--LKLNAGGVIFNKTKPKGADFKLN 70
                688889999999.777777777..********999999888889875 PP

>> PF07396  Phosphate-selective porin O and P
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0    0.0061        19     303     359 ..      67     123 ..      65     127 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.0061
                 EEEEETT--E-EEE-EEEEE-EEEE-SSSEEEEEEEEEEEEEEE------------E CS
     PF07396 303 lklndknndvlggkqkiitlGvnwYvkgnlklqlnYikvksdratkaekddtvdavt 359
                 +kln+ + +++     +  +G+ +Y+++nl+  l    v s+  +k++++++++++ 
  AAL03819.1  67 FKLNNIKSNIKSNTGFTGEIGAGYYIMDNLRTDLTIGTVASSHLKKSKTYPDGNSFS 123
                 7888888788888888889***************99999999999998888777665 PP

>> PF04414  D-aminoacyl-tRNA deacylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1     0.027        83     113     143 ..     203     237 ..     197     244 .. 0.71

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.027
                 HHHHHHHHHHH------......EEEE-----TT- CS
     PF04414 113 avaeavlealekeeeeev....ekklvgiGGgHYa 143
                 + ae+v ++++  +++++    +   v +GG+HY 
  AAL03819.1 203 VKAELVYSWRDYGKTKNTtktiNGDKVKFGGTHYK 237
                 5566676666666666555555778899******6 PP

>> PF05481  Mycobacterium 19 kDa lipoprotein antigen
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.1     0.014        42       1      40 [.       1      41 [.       1      66 [. 0.75

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.014
     PF05481  1 mkrkllvavagveilvagvsGcssg.nkstpssskttssss 40
                mk+ ll+a a++++l++g+s      n s  ss++++ sss
  AAL03819.1  1 MKKLLLIAAASTALLTSGLSFADCDmNSSVDSSTNSSMSSS 41
                89999**********99987655540444555555555554 PP

>> PF08195  TRI9 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.025        74      16      32 ..     143     159 ..     134     161 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.025
     PF08195  16 DvsWLevFaYsGvsaaL 32 
                 D s   vFa +Gv aa 
  AAL03819.1 143 DLSMFKVFAGAGVGAAF 159
                 8999***********96 PP

>> PF05968  Bacillus PapR protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.4     0.024        72       1      25 [.       1      26 [.       1      34 [. 0.76

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.024
     PF05968  1 mKKlL.igSLltlAmlwGislgDtal 25
                mKKlL i+   t  ++ G+s++D  +
  AAL03819.1  1 MKKLLlIAAASTALLTSGLSFADCDM 26
                99986256666666789*****9866 PP

>> PF09006  Lung surfactant protein D coiled-coil trimerisation
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0      0.03        90      20      36 ..     105     121 ..      93     126 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.03
                 HHHHHHHHHHHS----B CS
     PF09006  20 aafsqYkKavLFPdGqs 36 
                  a s+ kK   +PdG s
  AAL03819.1 105 VASSHLKKSKTYPDGNS 121
                 6889***********98 PP

>> PF12393  Dr family adhesin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.1   1.4    0.0015       4.5       1      17 [.       1      17 [.       1      18 [. 0.94

  Alignments for each domain:
  == domain 1    score: 10.1 bits;  conditional E-value: 0.0015
     PF12393  1 MKKLAIMaatSvltavs 17
                MKKL ++aa+S+ + +s
  AAL03819.1  1 MKKLLLIAAASTALLTS 17
                ************99887 PP

>> PF00266  Aminotransferase class-V
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.021        64     192     227 ..     139     172 ..     134     201 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.021
                 -SEEEE--TTT------EEEEEEHHHHTT------- CS
     PF00266 192 vDflafSgHKllgPtGiGvlyvrrellekleplklg 227
                 vDf+ +S  K+++ +G+G+ +v+++  +k   +k+g
  AAL03819.1 139 VDFVDLSMFKVFAGAGVGAAFVKEKIHSKD--IKGG 172
                 8***********************766543..4444 PP

>> PF07795  Protein of unknown function (DUF1635)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.027        80      81     111 ..      15      45 ..       8      64 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.027
     PF07795  81 ltesnsfsssdveesissselsvldplvene 111
                 lt+  sf   d+++s+ ss+ s +   ven+
  AAL03819.1  15 LTSGLSFADCDMNSSVDSSTNSSMSSSVENQ 45 
                 78899*******************9999887 PP

>> PF06560  Glucose-6-phosphate isomerase (GPI)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.029        89      20      56 ..     199     235 ..     187     241 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.029
     PF06560  20 ltetleddvvYevrdlkkseeegeiikadqlrydiTv 56 
                 + ++++ + vY  rd+ k++++   i+ d+++++ T 
  AAL03819.1 199 VAQGVKAELVYSWRDYGKTKNTTKTINGDKVKFGGTH 235
                 5678999**************************9885 PP

>> PF03106  WRKY DNA -binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.048   1.5e+02       4      13 ..     208     217 ..     205     231 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.048
                 ---EEE---B CS
     PF03106   4 gynWrKYGqK 13 
                  y+Wr YG+ 
  AAL03819.1 208 VYSWRDYGKT 217
                 59******84 PP

>> PF07996  Type IV secretion system proteins
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.029        87       1      67 [.       1      78 [.       1     101 [. 0.68

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.029
     PF07996  1 Mkkkliilalavalllsspaaaa...gipvldaasisqtlanslqqvaqlkqqlkq............lkqqlqqakqqyqs 67
                Mkk+l+i+a++ all+s +++a    +  v ++++   ++ +s+++  q+  +l++            +   l++ k++ +s
  AAL03819.1  1 MKKLLLIAAASTALLTSGLSFADcdmNSSVDSSTN--SSMSSSVEN--QWYLKLNAggvifnktkpkgADFKLNNIKSNIKS 78
                9*999999999999999999998754333333333..455555555..7777777766666666666655556666666555 PP

>> PF06270  Protein of unknown function (DUF1030)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.1      0.05   1.5e+02      23      39 ..     135     151 ..     127     160 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.05
     PF06270  23 ihGytdivvlvvytvfe 39 
                 + Gy d v l ++ vf 
  AAL03819.1 135 LNGYVDFVDLSMFKVFA 151
                 68*************95 PP

>> PF08085  Entericidin EcnA/B family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.7     0.057   1.7e+02       1      18 [.       1      16 [.       1      24 [. 0.61

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.057
     PF08085  1 MkkliililalaalaflL 18
                Mkkl+++++a  al  l 
  AAL03819.1  1 MKKLLLIAAASTAL--LT 16
                9**44444444443..33 PP

>> PF07029  CryBP1 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.055   1.7e+02      10      53 ..     181     223 ..     174     230 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.055
     PF07029  10 kkqkvpfccvvsiPkGfelvansdpklvYsldglsvvketcrkt 53 
                  k+k  f   +s+   fe+++  +  lvYs    + +k+t++ t
  AAL03819.1 181 TKNKTNFAYQLSLGTSFEVAQGVKAELVYSWRDYGKTKNTTK-T 223
                 46788899999**********************999999975.4 PP

>> PF03145  Seven in absentia protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.082   2.5e+02     131     149 ..     177     195 ..     155     216 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.082
     PF03145 131 ligeekeaenFayelelgg 149
                 + g+ k++ nFay+l+lg 
  AAL03819.1 177 FNGTTKNKTNFAYQLSLGT 195
                 67999***********986 PP

>> PF08139  Prokaryotic membrane lipoprotein lipid attachment site
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   1.2      0.16   4.9e+02       1      21 [.       1      14 [.       1      17 [. 0.86

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.16
     PF08139  1 MsespnmmKkilflllallmL 21
                M       Kk+l++++a+ +L
  AAL03819.1  1 M-------KKLLLIAAASTAL 14
                5.......*********9874 PP

>> PF08790  LYAR-type C2HC zinc finger
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.1      0.22   6.7e+02       9      19 ..     230     240 ..     228     241 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.22
     PF08790   9 tFdgesykaHt 19 
                  F g+ yk+H+
  AAL03819.1 230 KFGGTHYKGHN 240
                 699*******7 PP

>> PF12553  Protein of unknown function (DUF3742)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1      0.26   7.9e+02      39      54 .]      84      99 ..      83      99 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.26
     PF12553 39 GpaGyGlYdgdeyRiD 54
                G  G G+Y+ d++R D
  AAL03819.1 84 GEIGAGYYIMDNLRTD 99
                7779********9988 PP

>> PF05110  AF-4 proto-oncoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   1.5      0.14   4.2e+02     435     467 ..      12      45 ..       7      51 .. 0.84

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 0.14
     PF05110 435 sasdsSs.SeSeSeSsSgSDSesESSssdSEene 467
                  a   S+ S ++ + +S+ DS + SS s S en+
  AAL03819.1  12 TALLTSGlSFADCDMNSSVDSSTNSSMSSSVENQ 45 
                 5555688899999***************998875 PP

>> PF05756  S-antigen protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.6      0.26   7.9e+02      16      32 ..     208     224 ..     207     237 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.26
     PF05756  16 LYiYktYGkvkntDkel 32 
                 +Y ++ YGk knt k +
  AAL03819.1 208 VYSWRDYGKTKNTTKTI 224
                 588999*******9876 PP

>> PF02674  Colicin V production protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1       0.3     9e+02      79     107 ..     130     158 ..     128     160 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.3
     PF02674  79 llgnllrkllsksglglldrvlGavfGll 107
                 ++ +ll++++++  l+++  ++Ga +G++
  AAL03819.1 130 IVSVLLNGYVDFVDLSMFKVFAGAGVGAA 158
                 8999***********************86 PP

>> PF10187  N-terminal domain of NEFA-interacting nuclear protein NIP30
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.32   9.6e+02      42      75 ..     198     231 ..     177     237 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.32
     PF10187  42 erLqenkekKqeefeekiklknqfrgLDedEveF 75 
                 e+ q  k++   ++ +  k kn  + ++ d v+F
  AAL03819.1 198 EVAQGVKAELVYSWRDYGKTKNTTKTINGDKVKF 231
                 555566666667899999**************99 PP

>> PF11839  Protein of unknown function (DUF3359)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.9      0.54   1.6e+03       1      36 [.       1      36 [.       1      45 [. 0.79

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.54
     PF11839  1 mkkllvsalvlaallagGcaslseedrqaldaattt 36
                mkkll+ a + +all++G +    +   ++d++t +
  AAL03819.1  1 MKKLLLIAAASTALLTSGLSFADCDMNSSVDSSTNS 36
                99***9999*********987766666777777655 PP

>> PF07620  SLEI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.1      0.86   2.6e+03       8      12 ..      56      60 ..      56      60 .. 0.92

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.86
     PF07620  8 IfNkm 12
                IfNk+
  AAL03819.1 56 IFNKT 60
                9***7 PP

>> PF01138  3' exoribonuclease family, domain 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.8         1   3.1e+03     117     131 ..       5      19 ..       3      20 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 1
     PF01138 117 alinaaslALadagi 131
                 +li+aas AL+++g+
  AAL03819.1   5 LLIAAASTALLTSGL 19 
                 799*********997 PP

>> PF08106  Formaecin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.4   0.3       1.4   4.3e+03       6      11 ..     124     129 ..     123     129 .. 0.89

  Alignments for each domain:
  == domain 1    score: 0.4 bits;  conditional E-value: 1.4
     PF08106   6 VNtKPT 11 
                 V +KPT
  AAL03819.1 124 VKNKPT 129
                 78***9 PP

>> PF05017  TMP repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.3       1.2   3.6e+03       2      10 ..      70      78 ..      70      78 .. 0.88
   2 ?    0.4   0.1         4   1.2e+04       3      10 ..     168     175 ..     167     176 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 1.2
     PF05017  2 egIksffsg 10
                ++Iks++++
  AAL03819.1 70 NNIKSNIKS 78
                89****986 PP

  == domain 2    score: 0.4 bits;  conditional E-value: 4
     PF05017   3 gIksffsg 10 
                 +Ik+++++
  AAL03819.1 168 DIKGGVTD 175
                 69***997 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (249 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       416  (0.0349228); expected 238.2 (0.02)
Passed bias filter:                      290  (0.0243452); expected 238.2 (0.02)
Passed Vit filter:                        34  (0.00285426); expected 11.9 (0.001)
Passed Fwd filter:                        34  (0.00285426); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              33  [number of targets reported over threshold]
# CPU time: 0.21u 0.05s 00:00:00.26 Elapsed: 00:00:01
# Mc/sec: 2559.84
//