hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_23269.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAL03659.1
Accession:      [none]
Description:    rcon0 AAL03659.1 GIB00062CH01 "unknown"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0048761  RNI-like                                        33.6    1.6e-09   1
0039098  RNI-like                                        33.3      2e-09   1
0045711  RNI-like                                        24.3    6.8e-07   1
0052014  RNI-like                                        11.5    0.00027   1
0045099  RNI-like                                        14.3    0.00069   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0039098    1/1      22    76 ..    52   106 ..    33.3    2e-09
0045099    1/1      22    75 ..   164   218 ..    14.3  0.00069
0045711    1/1      22    72 ..   375   460 .]    24.3  6.8e-07
0048761    1/1      22    75 ..    50   103 ..    33.6  1.6e-09
0052014    1/1      22    76 ..   342   456 .]    11.5  0.00027

Alignments of top-scoring domains:
0039098: domain 1 of 1, from 22 to 76: score 33.3, E = 2e-09
                   *->dLsgnglgdegakaLaeaLkvnstLrsLdLssndigdegvlaLaeaL
                      dLs+ +++de ak La+aLk n++L+sL L +n+ig+  ++++ e L
  AAL03659.1    22    DLSNKNITDEQAKDLAAALKANRSLTSLYLPWNNIGEATFKIINEYL 68   

                   ksnttLtedLsgnrltglglealpsalaslpsLreLdLsgnnltdeglkalppel
                      dLs+ ++t++ +++l++al+ ++sL++L+L +nn++++ +k +  e+
  AAL03659.1    22    DLSNKNITDEQAKDLAAALKANRSLTSLYLPWNNIGEATFKII-NEY 67   

                   lsglpnLedLsgnqitdegalaLlsaleknksLteLdlsgnpisdegllallell
                      dLs+ +itde+a++L+ al+ n+sLt+L+l +n+i++++++ + e+l
  AAL03659.1    22    DLSNKNITDEQAKDLAAALKANRSLTSLYLPWNNIGEATFKIINEYL 68   

                   krnklllelldlsdnelseeelelleevlelnpllkiekdLsnnglgdegakalaeaLaknttLtsLdLssNnigdeGakaLaeal
                      dLsn +++de ak la aL+ n++LtsL+L +Nnig+++ k + e l
  AAL03659.1    22    DLSNKNITDEQAKDLAAALKANRSLTSLYLPWNNIGEATFKIINEYL 68   

                   kknttLtdLsgnklsdlglealakalknplpsLetLdlsgnnltdegllslpel
                      dLs+ +++d+ ++ la alk  ++sL++L+l +nn+++++++ + e+
  AAL03659.1    22    DLSNKNITDEQAKDLAAALKA-NRSLTSLYLPWNNIGEATFKIINEY 67   

                   lsklpsLkeLdlsgnplsdegleellellkklkllllllllllnllslll
                   l +++++++                                         
  AAL03659.1    68 LYRNKTITK----------------------------------------- 76   

                   lelleellellldldels