BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABF08451.1 rmet0 ABF08451.1 GIB00349CH01 "transcriptional
regulator"
         (139 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1d06A [d.110.3] NITROGEN FIXATION REGULATORY PROTEIN FIXL              57   4e-11
1s66U [d.110.3] HYPOTHETICAL PROTEIN YDDU                              52   1e-09
1s66L [d.110.3] HYPOTHETICAL PROTEIN YDDU                              52   1e-09
1vb6A [x.x.x] HEME PAS SENSOR PROTEIN                                  51   2e-09
1v9zA [d.110.3] HEME PAS SENSOR PROTEIN                                51   2e-09
1vb6B [x.x.x] HEME PAS SENSOR PROTEIN                                  42   1e-06
2cmnA [x.x.x] SENSOR PROTEIN FIXL                                      39   7e-06
1y28A [d.110.3] SENSOR PROTEIN FIXL                                    38   2e-05
1v9yA [d.110.3] HEME PAS SENSOR PROTEIN                                38   2e-05
1xj4B [x.x.x] SENSOR PROTEIN FIXL                                      38   2e-05
2vv6A [x.x.x] SENSOR PROTEIN FIXL                                      38   2e-05
1drmA [d.110.3] SENSOR PROTEIN FIXL                                    38   2e-05
1xj6A [x.x.x] SENSOR PROTEIN FIXL                                      37   3e-05
1xj4A [x.x.x] SENSOR PROTEIN FIXL                                      37   3e-05
1xj3A [d.110.3 (1dp6A)] SENSOR PROTEIN FIXL                            37   3e-05
2vv6C [x.x.x] SENSOR PROTEIN FIXL                                      37   3e-05
1lt0A [d.110.3] SENSOR PROTEIN FIXL                                    37   3e-05
1lsvA [d.110.3] SENSOR PROTEIN FIXL                                    37   3e-05
1dp8A [d.110.3] FIXL PROTEIN                                           37   3e-05

>1d06A [d.110.3] NITROGEN FIXATION REGULATORY PROTEIN FIXL
          Length = 130

 Score = 56.6 bits (135), Expect = 4e-11
 Identities = 29/82 (35%), Positives = 45/82 (54%)

Query: 11  ILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAA 70
           IL+ + DA + + TDG I  +N AA   FGY  +E +GQ+L +++PE  +  H    Q  
Sbjct: 21  ILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRY 80

Query: 71  IDTGKTRLSGKPTLTKAIHKDG 92
           + TG+ R+ G   +     KDG
Sbjct: 81  MATGEKRIIGIDRVVSGQRKDG 102


>1s66U [d.110.3] HYPOTHETICAL PROTEIN YDDU
          Length = 115

 Score = 51.6 bits (122), Expect = 1e-09
 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 2/111 (1%)

Query: 12  LEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAI 71
           LEQ     +  + +  +  +N AA +L+GY  +E +G ++D++IP  L+ AH +  +   
Sbjct: 7   LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNR 66

Query: 72  DTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARDVT 122
           + GK R+ G     +   KDG K++     + +S A G V   +A+ RD +
Sbjct: 67  EGGKARVEGMSRELQLEKKDGSKIWTRFALSKVS-AEGKVY-YLALVRDAS 115


>1s66L [d.110.3] HYPOTHETICAL PROTEIN YDDU
          Length = 119

 Score = 51.6 bits (122), Expect = 1e-09
 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 2/111 (1%)

Query: 12  LEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAI 71
           LEQ     +  + +  +  +N AA +L+GY  +E +G ++D++IP  L+ AH +  +   
Sbjct: 11  LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNR 70

Query: 72  DTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARDVT 122
           + GK R+ G     +   KDG K++     + +S A G V   +A+ RD +
Sbjct: 71  EGGKARVEGMSRELQLEKKDGSKIWTRFALSKVS-AEGKVY-YLALVRDAS 119


>1vb6A [x.x.x] HEME PAS SENSOR PROTEIN
          Length = 114

 Score = 51.2 bits (121), Expect = 2e-09
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 2/109 (1%)

Query: 12  LEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAI 71
           LEQ     +  + +  +  +N AA +L+GY  +E +G ++D++IP  L+ AH +  +   
Sbjct: 7   LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNR 66

Query: 72  DTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARD 120
           + GK R+ G     +   KDG K++     + +S A G V   +A+ RD
Sbjct: 67  EGGKARVEGMSRELQLEKKDGSKIWTRFALSKVS-AEGKVY-YLALVRD 113


>1v9zA [d.110.3] HEME PAS SENSOR PROTEIN
          Length = 113

 Score = 51.2 bits (121), Expect = 2e-09
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 2/109 (1%)

Query: 12  LEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAI 71
           LEQ     +  + +  +  +N AA +L+GY  +E +G ++D++IP  L+ AH +  +   
Sbjct: 7   LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNR 66

Query: 72  DTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARD 120
           + GK R+ G     +   KDG K++     + +S A G V   +A+ RD
Sbjct: 67  EGGKARVEGMSRELQLEKKDGSKIWTRFALSKVS-AEGKVY-YLALVRD 113


>1vb6B [x.x.x] HEME PAS SENSOR PROTEIN
          Length = 110

 Score = 42.0 bits (97), Expect = 1e-06
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 6/109 (5%)

Query: 12  LEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAI 71
           LEQ     +  + +  +  +N AA +L+GY  +E +G ++D++IP  L+ AH +  +   
Sbjct: 7   LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNR 66

Query: 72  DTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARD 120
           + G+  +S +  L K   KDG K++     + +S A G V   +A+ RD
Sbjct: 67  EGGE-GMSRELQLEK---KDGSKIWTRFALSKVS-AEGKVY-YLALVRD 109


>2cmnA [x.x.x] SENSOR PROTEIN FIXL
          Length = 117

 Score = 39.3 bits (90), Expect = 7e-06
 Identities = 23/76 (30%), Positives = 39/76 (51%)

Query: 17 DALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTGKT 76
          DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H     A   T   
Sbjct: 1  DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISAYRTTSDP 60

Query: 77 RLSGKPTLTKAIHKDG 92
           + G   +     +DG
Sbjct: 61 HIIGIGRIVTGKRRDG 76


>1y28A [d.110.3] SENSOR PROTEIN FIXL
          Length = 119

 Score = 38.1 bits (87), Expect = 2e-05
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 15 LADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTG 74
          + DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T 
Sbjct: 1  IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTS 60

Query: 75 KTRLSGKPTLTKAIHKDG 92
             + G   +     +DG
Sbjct: 61 DPHIIGIGAIVTGKRRDG 78


>1v9yA [d.110.3] HEME PAS SENSOR PROTEIN
          Length = 103

 Score = 38.1 bits (87), Expect = 2e-05
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 12 LEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAH 63
          LEQ     +  + +  +  +N AA +L+GY  +E +G ++D++IP  L+ AH
Sbjct: 7  LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAH 58


>1xj4B [x.x.x] SENSOR PROTEIN FIXL
          Length = 107

 Score = 37.7 bits (86), Expect = 2e-05
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 15 LADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTG 74
          + DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T 
Sbjct: 2  IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTS 61

Query: 75 KTRLSGKPTLTKAIHKDG 92
             + G   +     +DG
Sbjct: 62 DPHIIGIGRIVTGKRRDG 79


>2vv6A [x.x.x] SENSOR PROTEIN FIXL
          Length = 106

 Score = 37.7 bits (86), Expect = 2e-05
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 15 LADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTG 74
          + DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T 
Sbjct: 1  IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTS 60

Query: 75 KTRLSGKPTLTKAIHKDG 92
             + G   +     +DG
Sbjct: 61 DPHIIGIGRIVTGKRRDG 78


>1drmA [d.110.3] SENSOR PROTEIN FIXL
          Length = 119

 Score = 37.7 bits (86), Expect = 2e-05
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 15 LADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTG 74
          + DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T 
Sbjct: 1  IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTS 60

Query: 75 KTRLSGKPTLTKAIHKDG 92
             + G   +     +DG
Sbjct: 61 DPHIIGIGRIVTGKRRDG 78


>1xj6A [x.x.x] SENSOR PROTEIN FIXL
          Length = 105

 Score = 37.4 bits (85), Expect = 3e-05
 Identities = 22/76 (28%), Positives = 38/76 (50%)

Query: 17 DALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTGKT 76
          DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T   
Sbjct: 2  DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDP 61

Query: 77 RLSGKPTLTKAIHKDG 92
           + G   +     +DG
Sbjct: 62 HIIGIGRIVTGKRRDG 77


>1xj4A [x.x.x] SENSOR PROTEIN FIXL
          Length = 106

 Score = 37.4 bits (85), Expect = 3e-05
 Identities = 22/76 (28%), Positives = 38/76 (50%)

Query: 17 DALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTGKT 76
          DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T   
Sbjct: 1  DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDP 60

Query: 77 RLSGKPTLTKAIHKDG 92
           + G   +     +DG
Sbjct: 61 HIIGIGRIVTGKRRDG 76


>1xj3A [d.110.3 (1dp6A)] SENSOR PROTEIN FIXL
          Length = 116

 Score = 37.4 bits (85), Expect = 3e-05
 Identities = 22/76 (28%), Positives = 38/76 (50%)

Query: 17 DALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTGKT 76
          DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T   
Sbjct: 1  DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDP 60

Query: 77 RLSGKPTLTKAIHKDG 92
           + G   +     +DG
Sbjct: 61 HIIGIGRIVTGKRRDG 76


>2vv6C [x.x.x] SENSOR PROTEIN FIXL
          Length = 104

 Score = 37.4 bits (85), Expect = 3e-05
 Identities = 22/76 (28%), Positives = 38/76 (50%)

Query: 17 DALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTGKT 76
          DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T   
Sbjct: 1  DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDP 60

Query: 77 RLSGKPTLTKAIHKDG 92
           + G   +     +DG
Sbjct: 61 HIIGIGRIVTGKRRDG 76


>1lt0A [d.110.3] SENSOR PROTEIN FIXL
          Length = 117

 Score = 37.4 bits (85), Expect = 3e-05
 Identities = 22/76 (28%), Positives = 38/76 (50%)

Query: 17 DALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTGKT 76
          DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T   
Sbjct: 2  DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDP 61

Query: 77 RLSGKPTLTKAIHKDG 92
           + G   +     +DG
Sbjct: 62 HIIGIGRIVTGKRRDG 77


>1lsvA [d.110.3] SENSOR PROTEIN FIXL
          Length = 117

 Score = 37.4 bits (85), Expect = 3e-05
 Identities = 22/76 (28%), Positives = 38/76 (50%)

Query: 17 DALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTGKT 76
          DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T   
Sbjct: 1  DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDP 60

Query: 77 RLSGKPTLTKAIHKDG 92
           + G   +     +DG
Sbjct: 61 HIIGIGRIVTGKRRDG 76


>1dp8A [d.110.3] FIXL PROTEIN
          Length = 118

 Score = 37.4 bits (85), Expect = 3e-05
 Identities = 22/76 (28%), Positives = 38/76 (50%)

Query: 17 DALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAAIDTGKT 76
          DA+I  D  G I  ++ AA  LFG+   EA+GQ++++++PE  ++ H         T   
Sbjct: 2  DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDP 61

Query: 77 RLSGKPTLTKAIHKDG 92
           + G   +     +DG
Sbjct: 62 HIIGIGRIVTGKRRDG 77


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 962,711,724
Number of extensions: 38428099
Number of successful extensions: 92207
Number of sequences better than 1.0e-03: 1871
Number of HSP's gapped: 90338
Number of HSP's successfully gapped: 2252
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)