BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABF08687.1 rmet0 ABF08687.1 GIB00349CH01 "2,3-dimethylmalate
lyase"
         (564 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1s2tB [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      399   e-113
1m1bB [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      399   e-113
1m1bA [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      399   e-113
1s2uB [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      396   e-113
1s2uA [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      396   e-113
1s2vB [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      395   e-112
1s2vA [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      390   e-111
1s2vC [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      385   e-109
1s2vD [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      383   e-109
1pymB [c.1.12] PROTEIN (PHOSPHOENOLPYRUVATE MUTASE)                   360   e-102
1pymA [c.1.12] PROTEIN (PHOSPHOENOLPYRUVATE MUTASE)                   360   e-102
1s2wA [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE                      350   6e-99
2hjpA [x.x.x] PHOSPHONOPYRUVATE HYDROLASE                             200   7e-54
2hrwA [x.x.x] PHOSPHONOPYRUVATE HYDROLASE                             199   2e-53
1zlpB [x.x.x] PETAL DEATH PROTEIN                                      88   7e-20
1zlpA [x.x.x] PETAL DEATH PROTEIN                                      88   7e-20
1xg4A [x.x.x] PROBABLE METHYLISOCITRATE LYASE                          87   1e-19
1xg3C [x.x.x] PROBABLE METHYLISOCITRATE LYASE                          87   1e-19
1xg3B [x.x.x] PROBABLE METHYLISOCITRATE LYASE                          87   1e-19
1xg3A [x.x.x] PROBABLE METHYLISOCITRATE LYASE                          87   1e-19
1xg3D [x.x.x] PROBABLE METHYLISOCITRATE LYASE                          86   2e-19
1oqfA [c.1.12] 2-METHYLISOCITRATE LYASE                                86   3e-19
1mumA [c.1.12] 2-METHYLISOCITRATE LYASE                                86   3e-19
1ujqA [c.1.12] PROBABLE METHYLISOCITRATE LYASE                         85   6e-19
1o5qC [c.1.12] PROBABLE METHYLISOCITRATE LYASE                         85   6e-19
1o5qA [c.1.12] PROBABLE METHYLISOCITRATE LYASE                         85   6e-19
1o5qD [c.1.12] PROBABLE METHYLISOCITRATE LYASE                         84   1e-18
1o5qB [c.1.12] PROBABLE METHYLISOCITRATE LYASE                         84   1e-18
3b8iE [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE                        84   1e-18
3b8iC [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE                        84   1e-18
3b8iB [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE                        84   1e-18
3b8iA [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE                        84   1e-18
3ih1B [x.x.x] METHYLISOCITRATE LYASE                                   82   5e-18
3ih1A [x.x.x] METHYLISOCITRATE LYASE                                   82   5e-18
3b8iD [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE                        80   2e-17
1jylA [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE                  70   2e-14
3eooJ [x.x.x] METHYLISOCITRATE LYASE                                   70   2e-14
3eooI [x.x.x] METHYLISOCITRATE LYASE                                   70   2e-14
3eooE [x.x.x] METHYLISOCITRATE LYASE                                   70   2e-14
3eooD [x.x.x] METHYLISOCITRATE LYASE                                   70   2e-14
3eooC [x.x.x] METHYLISOCITRATE LYASE                                   70   2e-14
3eooB [x.x.x] METHYLISOCITRATE LYASE                                   70   2e-14
3eooA [x.x.x] METHYLISOCITRATE LYASE                                   70   2e-14
1jykA [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE                  69   3e-14
2ze3A [x.x.x] DFA0005                                                  59   5e-11
2ggoA [x.x.x] 401AA LONG HYPOTHETICAL GLUCOSE-1-PHOSPHATE              54   1e-09
3fa4L [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 52   4e-09
3fa3L [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 52   4e-09
3fa3I [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 52   4e-09
3fa3B [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 52   4e-09
3fa3A [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 52   4e-09
3fa4I [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 50   2e-08
3fa4H [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 50   2e-08
3fa4F [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 50   2e-08
3fa4D [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 50   2e-08
3fa4C [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 50   2e-08
3fa4B [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 50   2e-08
3fa3J [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 50   2e-08
3fa4K [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 49   3e-08
3fa4J [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 49   3e-08
3fa4E [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 49   3e-08
3fa4A [x.x.x] 2,3-DIMETHYLMALATE LYASE                                 49   3e-08
3fwwA [x.x.x] BIFUNCTIONAL PROTEIN GLMU                                45   4e-07
1wvcA [c.68.1] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE                44   9e-07
2v0jA [x.x.x] BIFUNCTIONAL PROTEIN GLMU                                44   2e-06
2v0hA [x.x.x] BIFUNCTIONAL PROTEIN GLMU                                44   2e-06
2oi6B [x.x.x] BIFUNCTIONAL PROTEIN GLMU                                39   3e-05
2oi6A [x.x.x] BIFUNCTIONAL PROTEIN GLMU                                39   3e-05
1hv9B [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE      39   3e-05
1hv9A [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE      39   3e-05
1fxjA [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE      39   3e-05
1fwyB [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE      39   3e-05
1fwyA [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE      39   3e-05
1dquA [c.1.12] ISOCITRATE LYASE                                        39   3e-05
1tzfA [c.68.1] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE                38   8e-05
2ux8H [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE                  36   3e-04
2ux8G [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE                  36   3e-04
2ux8F [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE                  36   3e-04
2ux8E [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE                  36   3e-04
2ux8D [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE                  36   3e-04
2ux8C [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE                  36   3e-04
2ux8B [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE                  36   3e-04
2ux8A [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE                  36   3e-04
2qiwA [x.x.x] PEP PHOSPHONOMUTASE                                      36   3e-04
2e3dD [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE             35   4e-04
2e3dC [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE             35   4e-04
2e3dB [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE             35   4e-04
2e3dA [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE             35   4e-04
3brkX [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE                  34   0.001

>1s2tB [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 291

 Score =  399 bits (1025), Expect = e-113
 Identities = 195/286 (68%), Positives = 232/286 (81%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ GVRD+NEASWTQ
Sbjct: 4   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQ 63

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPKTNS   
Sbjct: 64  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHD 123

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
           G  QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 124 GRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 183

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 184 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 243

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 244 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 289


>1m1bB [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 289

 Score =  399 bits (1025), Expect = e-113
 Identities = 195/286 (68%), Positives = 232/286 (81%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ GVRD+NEASWTQ
Sbjct: 3   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQ 62

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPKTNS   
Sbjct: 63  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHD 122

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
           G  QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 123 GRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 182

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 183 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 242

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 243 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 288


>1m1bA [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 291

 Score =  399 bits (1025), Expect = e-113
 Identities = 195/286 (68%), Positives = 232/286 (81%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ GVRD+NEASWTQ
Sbjct: 3   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQ 62

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPKTNS   
Sbjct: 63  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHD 122

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
           G  QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 123 GRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 182

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 183 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 242

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 243 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 288


>1s2uB [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 289

 Score =  396 bits (1017), Expect = e-113
 Identities = 194/286 (67%), Positives = 231/286 (80%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ GVR +NEASWTQ
Sbjct: 3   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRASNEASWTQ 62

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPKTNS   
Sbjct: 63  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHD 122

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
           G  QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 123 GRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 182

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 183 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 242

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 243 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 288


>1s2uA [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 290

 Score =  396 bits (1017), Expect = e-113
 Identities = 194/286 (67%), Positives = 231/286 (80%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ GVR +NEASWTQ
Sbjct: 3   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRASNEASWTQ 62

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPKTNS   
Sbjct: 63  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHD 122

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
           G  QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 123 GRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 182

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 183 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 242

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 243 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 288


>1s2vB [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 287

 Score =  395 bits (1015), Expect = e-112
 Identities = 195/286 (68%), Positives = 232/286 (81%), Gaps = 3/286 (1%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ GVRD+NEASWTQ
Sbjct: 4   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQ 63

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPKTNS   
Sbjct: 64  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNS--- 120

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
           G  QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 121 GRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 180

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 181 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 240

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 241 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 286


>1s2vA [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 282

 Score =  390 bits (1002), Expect = e-111
 Identities = 193/286 (67%), Positives = 230/286 (80%), Gaps = 7/286 (2%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ GVRD+NEASWTQ
Sbjct: 3   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQ 62

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPKTN    
Sbjct: 63  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTN---- 118

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
              QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 119 ---QPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 175

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 176 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 235

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 236 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 281


>1s2vC [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 282

 Score =  385 bits (989), Expect = e-109
 Identities = 191/286 (66%), Positives = 228/286 (79%), Gaps = 9/286 (3%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ GVRD+NEASWTQ
Sbjct: 4   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQ 63

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPK      
Sbjct: 64  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPK------ 117

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
              QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 118 ---QPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 174

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 175 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 234

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 235 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 280


>1s2vD [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 281

 Score =  383 bits (983), Expect = e-109
 Identities = 190/286 (66%), Positives = 227/286 (79%), Gaps = 10/286 (3%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ GVRD+NEASWTQ
Sbjct: 4   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQ 63

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FP       
Sbjct: 64  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFP------- 116

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
              QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 117 ---QPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 173

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 174 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 233

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 234 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 279


>1pymB [c.1.12] PROTEIN (PHOSPHOENOLPYRUVATE MUTASE)
          Length = 282

 Score =  360 bits (925), Expect = e-102
 Identities = 192/286 (67%), Positives = 227/286 (79%), Gaps = 7/286 (2%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+Q L S +LEFI EAHNGLSARIV+EAGFKGIW SGL++SAQ GVRD+NEASWTQ
Sbjct: 3   KTTQLKQ-LNSKDLEFI-EAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQ 60

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEF +DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPKTNS   
Sbjct: 61  VVEVLEF-SDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHD 119

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
           G  QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 120 GRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 179

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S VIWANH +R + 
Sbjct: 180 IL-HSKKADPSDIEAF-KAWNNQGPVVIVPTKYYKTPTDHFRD-GVS-VIWANHNLRASV 235

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 236 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 281


>1pymA [c.1.12] PROTEIN (PHOSPHOENOLPYRUVATE MUTASE)
          Length = 284

 Score =  360 bits (925), Expect = e-102
 Identities = 192/286 (67%), Positives = 227/286 (79%), Gaps = 7/286 (2%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+Q L S +LEFI EAHNGLSARIV+EAGFKGIW SGL++SAQ GVRD+NEASWTQ
Sbjct: 3   KTTQLKQ-LNSKDLEFI-EAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQ 60

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEF +DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+FPKTNS   
Sbjct: 61  VVEVLEF-SDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHD 119

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
           G  QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 120 GRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 179

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S VIWANH +R + 
Sbjct: 180 IL-HSKKADPSDIEAF-KAWNNQGPVVIVPTKYYKTPTDHFRD-GVS-VIWANHNLRASV 235

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           S++Q   ++I+D Q+LVNVED+I +V EIFRLQ  DE   AE  YL
Sbjct: 236 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYL 281


>1s2wA [c.1.12] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
          Length = 258

 Score =  350 bits (898), Expect = 6e-99
 Identities = 175/272 (64%), Positives = 211/272 (77%), Gaps = 17/272 (6%)

Query: 13  RSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQ 72
           ++ +L+QML S +LEFIMEAHNGLSARIV+EAGFKGIW SGL++SAQ          WTQ
Sbjct: 4   KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQL---------WTQ 54

Query: 73  VVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIG 132
           VV+ LEFM+DASD+PILLD DTGYGNFNN RRLVRKLE RG+AG C+EDK+F        
Sbjct: 55  VVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLF-------- 106

Query: 133 GEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADA 192
           G  QPLADI+EF  KIKA KDSQ D DF IVARVEA IAGWG++EAL+RAEAYR AGADA
Sbjct: 107 GRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADA 166

Query: 193 ILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAA 252
           IL+HSK +   +I  F + W  + P+VIVPTKYY TPTD FR  G+S+VIWANH +R + 
Sbjct: 167 ILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASV 226

Query: 253 SSMQAVAREIHDSQTLVNVEDRIATVNEIFRL 284
           S++Q   ++I+D Q+LVNVED+I +V EIFRL
Sbjct: 227 SAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRL 258


>2hjpA [x.x.x] PHOSPHONOPYRUVATE HYDROLASE
          Length = 283

 Score =  200 bits (509), Expect = 7e-54
 Identities = 113/288 (39%), Positives = 161/288 (55%), Gaps = 8/288 (2%)

Query: 12  SRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWT 71
           +++  LR  L S  L   M AHN L A++  +AGF GIW SG  +SA + V D N  S +
Sbjct: 2   TKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMS 61

Query: 72  QVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFI 131
             ++ +  +A    +P++ D DTG+GN  NV  +V + E  G + + +EDK FPK     
Sbjct: 62  THLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPK----- 116

Query: 132 GGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGAD 191
             + Q L  I+EF GKI           F ++ARVEALIAG G +EA+RR +AY +AGAD
Sbjct: 117 --DTQELVRIEEFQGKIXXXXXXXXXXXFVVIARVEALIAGLGQQEAVRRGQAYEEAGAD 174

Query: 192 AILIHSKLSKADEIVTFAREWAGRAPLVIVPTKY-YSTPTDVFRKAGISLVIWANHLIRV 250
           AILIHS+    DEI+ F + W G+ PLV+VPT Y   T  D+   + + +VI+ NH IR 
Sbjct: 175 AILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRA 234

Query: 251 AASSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           A  +++ V   I     +  V+  + +V EI  LQ  +   A E  YL
Sbjct: 235 AVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYL 282


>2hrwA [x.x.x] PHOSPHONOPYRUVATE HYDROLASE
          Length = 281

 Score =  199 bits (506), Expect = 2e-53
 Identities = 113/288 (39%), Positives = 160/288 (55%), Gaps = 10/288 (3%)

Query: 12  SRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWT 71
           +++  LR  L S  L   M AHN L A++  +AGF GIW SG  +SA + V D N  S +
Sbjct: 2   TKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMS 61

Query: 72  QVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFI 131
             ++ +  +A    +P++ D DTG+GN  NV  +V + E  G + + +EDK FPK     
Sbjct: 62  THLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPK----- 116

Query: 132 GGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGAD 191
               Q L  I+EF GKI           F ++ARVEALIAG G +EA+RR +AY +AGAD
Sbjct: 117 ----QELVRIEEFQGKIXXXXXXXXXXXFVVIARVEALIAGLGQQEAVRRGQAYEEAGAD 172

Query: 192 AILIHSKLSKADEIVTFAREWAGRAPLVIVPTKY-YSTPTDVFRKAGISLVIWANHLIRV 250
           AILIHS+    DEI+ F + W G+ PLV+VPT Y   T  D+   + + +VI+ NH IR 
Sbjct: 173 AILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRA 232

Query: 251 AASSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYL 298
           A  +++ V   I     +  V+  + +V EI  LQ  +   A E  YL
Sbjct: 233 AVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYL 280


>1zlpB [x.x.x] PETAL DEATH PROTEIN
          Length = 285

 Score = 87.8 bits (216), Expect = 7e-20
 Identities = 72/264 (27%), Positives = 128/264 (48%), Gaps = 7/264 (2%)

Query: 34  NGLSARIVREAGFKGIWASGLAISA-QFGVRDNNEASWTQVVD-NLEFMADASDLPILLD 91
           + LSA +V + GF   + SG ++SA   G+ D    + T+VV+      A A +L     
Sbjct: 21  DALSAAVVEKTGFHAAFVSGYSVSAAMLGLPDFGLLTTTEVVEATRRITAAAPNLCXXXX 80

Query: 92  GDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLADIDEFCGKIKAG 151
                    NV+R +R+L   G  GV +ED+++PK    + G+   +   +E   KI A 
Sbjct: 81  XXXXXXXPLNVQRFIRELISAGAKGVFLEDQVWPKKCGHMRGKA--VVPAEEHALKIAAA 138

Query: 152 KDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSKADEIVTFARE 211
           +++  D DF +VAR +A  A  G+EE +RRA  Y++AGADA  + +  +  DE+   + +
Sbjct: 139 REAIGDSDFFLVARTDAR-APHGLEEGIRRANLYKEAGADATFVEAP-ANVDELKEVSAK 196

Query: 212 WAG-RAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAASSMQAVAREIHDSQTLVN 270
             G R   +I   K      + F++ G  L+  +   +   A ++  + + + +  T  +
Sbjct: 197 TKGLRIANMIEGGKTPLHTPEEFKEMGFHLIAHSLTAVYATARALVNIMKILKEKGTTRD 256

Query: 271 VEDRIATVNEIFRLQDADEYSAAE 294
             D++AT +E   L   + +   E
Sbjct: 257 DLDQMATFSEFNELISLESWYEME 280


>1zlpA [x.x.x] PETAL DEATH PROTEIN
          Length = 284

 Score = 87.8 bits (216), Expect = 7e-20
 Identities = 72/264 (27%), Positives = 128/264 (48%), Gaps = 7/264 (2%)

Query: 34  NGLSARIVREAGFKGIWASGLAISA-QFGVRDNNEASWTQVVD-NLEFMADASDLPILLD 91
           + LSA +V + GF   + SG ++SA   G+ D    + T+VV+      A A +L     
Sbjct: 21  DALSAAVVEKTGFHAAFVSGYSVSAAMLGLPDFGLLTTTEVVEATRRITAAAPNLCXXXX 80

Query: 92  GDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLADIDEFCGKIKAG 151
                    NV+R +R+L   G  GV +ED+++PK    + G+   +   +E   KI A 
Sbjct: 81  XXXXXXXPLNVQRFIRELISAGAKGVFLEDQVWPKKCGHMRGKA--VVPAEEHALKIAAA 138

Query: 152 KDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSKADEIVTFARE 211
           +++  D DF +VAR +A  A  G+EE +RRA  Y++AGADA  + +  +  DE+   + +
Sbjct: 139 REAIGDSDFFLVARTDAR-APHGLEEGIRRANLYKEAGADATFVEAP-ANVDELKEVSAK 196

Query: 212 WAG-RAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAASSMQAVAREIHDSQTLVN 270
             G R   +I   K      + F++ G  L+  +   +   A ++  + + + +  T  +
Sbjct: 197 TKGLRIANMIEGGKTPLHTPEEFKEMGFHLIAHSLTAVYATARALVNIMKILKEKGTTRD 256

Query: 271 VEDRIATVNEIFRLQDADEYSAAE 294
             D++AT +E   L   + +   E
Sbjct: 257 DLDQMATFSEFNELISLESWYEME 280


>1xg4A [x.x.x] PROBABLE METHYLISOCITRATE LYASE
          Length = 287

 Score = 87.0 bits (214), Expect = 1e-19
 Identities = 74/282 (26%), Positives = 140/282 (49%), Gaps = 14/282 (4%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+   N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 13  LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 71

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G AG+ IED++  K +       + 
Sbjct: 72  RITDVCSLPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKA 129

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D DF I+AR +AL A  G++ A+ RA+AY +AGA+ +L   
Sbjct: 130 IVSKEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPE 187

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA   A + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 188 AITELAMYRQFAD--AVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 245

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKI 296
            + V   +    T  +V D + T NE++  +  + Y   EK+
Sbjct: 246 AEHVYNVLRQEGTQKSVIDTMQTRNELY--ESINYYQYEEKL 285


>1xg3C [x.x.x] PROBABLE METHYLISOCITRATE LYASE
          Length = 287

 Score = 87.0 bits (214), Expect = 1e-19
 Identities = 74/282 (26%), Positives = 140/282 (49%), Gaps = 14/282 (4%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+   N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 12  LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 70

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G AG+ IED++  K +       + 
Sbjct: 71  RITDVCSLPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKA 128

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D DF I+AR +AL A  G++ A+ RA+AY +AGA+ +L   
Sbjct: 129 IVSKEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPE 186

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA   A + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 187 AITELAMYRQFAD--AVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 244

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKI 296
            + V   +    T  +V D + T NE++  +  + Y   EK+
Sbjct: 245 AEHVYNVLRQEGTQKSVIDTMQTRNELY--ESINYYQYEEKL 284


>1xg3B [x.x.x] PROBABLE METHYLISOCITRATE LYASE
          Length = 286

 Score = 87.0 bits (214), Expect = 1e-19
 Identities = 74/282 (26%), Positives = 140/282 (49%), Gaps = 14/282 (4%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+   N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 12  LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 70

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G AG+ IED++  K +       + 
Sbjct: 71  RITDVCSLPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKA 128

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D DF I+AR +AL A  G++ A+ RA+AY +AGA+ +L   
Sbjct: 129 IVSKEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPE 186

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA   A + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 187 AITELAMYRQFAD--AVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 244

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKI 296
            + V   +    T  +V D + T NE++  +  + Y   EK+
Sbjct: 245 AEHVYNVLRQEGTQKSVIDTMQTRNELY--ESINYYQYEEKL 284


>1xg3A [x.x.x] PROBABLE METHYLISOCITRATE LYASE
          Length = 288

 Score = 87.0 bits (214), Expect = 1e-19
 Identities = 74/282 (26%), Positives = 140/282 (49%), Gaps = 14/282 (4%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+   N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 13  LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 71

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G AG+ IED++  K +       + 
Sbjct: 72  RITDVCSLPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKA 129

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D DF I+AR +AL A  G++ A+ RA+AY +AGA+ +L   
Sbjct: 130 IVSKEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPE 187

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA   A + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 188 AITELAMYRQFAD--AVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 245

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKI 296
            + V   +    T  +V D + T NE++  +  + Y   EK+
Sbjct: 246 AEHVYNVLRQEGTQKSVIDTMQTRNELY--ESINYYQYEEKL 285


>1xg3D [x.x.x] PROBABLE METHYLISOCITRATE LYASE
          Length = 283

 Score = 86.3 bits (212), Expect = 2e-19
 Identities = 74/281 (26%), Positives = 139/281 (49%), Gaps = 14/281 (4%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+   N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 12  LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 70

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G AG+ IED++  K +       + 
Sbjct: 71  RITDVCSLPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRSGH--RPNKA 128

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D DF I+AR +AL A  G++ A+ RA+AY +AGA+ +L   
Sbjct: 129 IVSKEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPE 186

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA   A + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 187 AITELAMYRQFAD--AVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 244

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEK 295
            + V   +    T  +V D + T NE++  +  + Y   EK
Sbjct: 245 AEHVYNVLRQEGTQKSVIDTMQTRNELY--ESINYYQYEEK 283


>1oqfA [c.1.12] 2-METHYLISOCITRATE LYASE
          Length = 290

 Score = 85.5 bits (210), Expect = 3e-19
 Identities = 74/282 (26%), Positives = 139/282 (49%), Gaps = 14/282 (4%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+   N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 13  LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 71

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G AG+ IED++  K         + 
Sbjct: 72  RITDVCSLPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGH--RPNKA 129

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D DF I+AR +AL A  G++ A+ RA+AY +AGA+ +L   
Sbjct: 130 IVSKEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPE 187

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA   A + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 188 AITELAMYRQFAD--AVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 245

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKI 296
            + V   +    T  +V D + T NE++  +  + Y   EK+
Sbjct: 246 AEHVYNVLRQEGTQKSVIDTMQTRNELY--ESINYYQYEEKL 285


>1mumA [c.1.12] 2-METHYLISOCITRATE LYASE
          Length = 289

 Score = 85.5 bits (210), Expect = 3e-19
 Identities = 74/282 (26%), Positives = 139/282 (49%), Gaps = 14/282 (4%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+   N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 12  LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 70

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G AG+ IED++  K         + 
Sbjct: 71  RITDVCSLPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGH--RPNKA 128

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D DF I+AR +AL A  G++ A+ RA+AY +AGA+ +L   
Sbjct: 129 IVSKEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPE 186

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA   A + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 187 AITELAMYRQFAD--AVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 244

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKI 296
            + V   +    T  +V D + T NE++  +  + Y   EK+
Sbjct: 245 AEHVYNVLRQEGTQKSVIDTMQTRNELY--ESINYYQYEEKL 284


>1ujqA [c.1.12] PROBABLE METHYLISOCITRATE LYASE
          Length = 272

 Score = 84.7 bits (208), Expect = 6e-19
 Identities = 75/282 (26%), Positives = 135/282 (47%), Gaps = 25/282 (8%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+ A N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 11  LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 69

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G A + IED++              
Sbjct: 70  RITDVCPLPLLVDADIGFGSSAFNVARTVKSIAKAGAAALHIEDQV-------------A 116

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D +F I+AR +AL A  G+E AL RA+AY  AGAD +L   
Sbjct: 117 IVSKEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPE 174

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA     + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 175 AITELSMYRRFAD--VAQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 232

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKI 296
            + V   +    T  NV D + T NE++  +  + Y   EK+
Sbjct: 233 AEKVYTVLRQEGTQKNVIDIMQTRNELY--ESINYYQFEEKL 272


>1o5qC [c.1.12] PROBABLE METHYLISOCITRATE LYASE
          Length = 275

 Score = 84.7 bits (208), Expect = 6e-19
 Identities = 75/282 (26%), Positives = 135/282 (47%), Gaps = 25/282 (8%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+ A N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 11  LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 69

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G A + IED++              
Sbjct: 70  RITDVCPLPLLVDADIGFGSSAFNVARTVKSIAKAGAAALHIEDQV-------------A 116

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D +F I+AR +AL A  G+E AL RA+AY  AGAD +L   
Sbjct: 117 IVSKEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPE 174

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA     + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 175 AITELSMYRRFAD--VAQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 232

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKI 296
            + V   +    T  NV D + T NE++  +  + Y   EK+
Sbjct: 233 AEKVYTVLRQEGTQKNVIDIMQTRNELY--ESINYYQFEEKL 272


>1o5qA [c.1.12] PROBABLE METHYLISOCITRATE LYASE
          Length = 271

 Score = 84.7 bits (208), Expect = 6e-19
 Identities = 75/282 (26%), Positives = 135/282 (47%), Gaps = 25/282 (8%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+ A N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 10  LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 68

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G A + IED++              
Sbjct: 69  RITDVCPLPLLVDADIGFGSSAFNVARTVKSIAKAGAAALHIEDQV-------------A 115

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D +F I+AR +AL A  G+E AL RA+AY  AGAD +L   
Sbjct: 116 IVSKEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPE 173

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA     + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 174 AITELSMYRRFAD--VAQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 231

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKI 296
            + V   +    T  NV D + T NE++  +  + Y   EK+
Sbjct: 232 AEKVYTVLRQEGTQKNVIDIMQTRNELY--ESINYYQFEEKL 271


>1o5qD [c.1.12] PROBABLE METHYLISOCITRATE LYASE
          Length = 268

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 72/268 (26%), Positives = 129/268 (48%), Gaps = 23/268 (8%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+ A N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 11  LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 69

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G A + IED++              
Sbjct: 70  RITDVCPLPLLVDADIGFGSSAFNVARTVKSIAKAGAAALHIEDQV-------------A 116

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D +F I+AR +AL A  G+E AL RA+AY  AGAD +L   
Sbjct: 117 IVSKEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPE 174

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA     + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 175 AITELSMYRRFAD--VAQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 232

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIF 282
            + V   +    T  NV D + T NE++
Sbjct: 233 AEKVYTVLRQEGTQKNVIDIMQTRNELY 260


>1o5qB [c.1.12] PROBABLE METHYLISOCITRATE LYASE
          Length = 268

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 72/268 (26%), Positives = 129/268 (48%), Gaps = 23/268 (8%)

Query: 20  MLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVR-DNNEASWTQVVDNLE 78
           + + N L+ I+ A N   A + + AG++ I+              D   ++   V+ ++ 
Sbjct: 10  LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXPDLGISTLDDVLTDIR 68

Query: 79  FMADASDLPILLDGDTGYGNFN-NVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQP 137
            + D   LP+L+D D G+G+   NV R V+ + + G A + IED++              
Sbjct: 69  RITDVCPLPLLVDADIGFGSSAFNVARTVKSIAKAGAAALHIEDQV-------------A 115

Query: 138 LADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHS 197
           +   +E   +I+A  D++ D +F I+AR +AL A  G+E AL RA+AY  AGAD +L   
Sbjct: 116 IVSKEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPE 173

Query: 198 KLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIWANHLIRVAASS 254
            +++      FA     + P++   T++ +TP   TD  R A +++ ++     R    +
Sbjct: 174 AITELSMYRRFAD--VAQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRA 231

Query: 255 MQAVAREIHDSQTLVNVEDRIATVNEIF 282
            + V   +    T  NV D + T NE++
Sbjct: 232 AEKVYTVLRQEGTQKNVIDIMQTRNELY 259


>3b8iE [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
          Length = 283

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 56/182 (30%), Positives = 93/182 (51%), Gaps = 6/182 (3%)

Query: 15  ARLRQMLRSNELEFIMEAHNGLSARIVREAGFK-GIWASGLAISAQFGVRDNNEASWTQV 73
           A  R +L S+         + +SARI  + GF+ GI    +A        D    + ++ 
Sbjct: 8   AMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEF 67

Query: 74  VDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGG 133
           V+    +   + LP++ D D GYGN  NV R V +LE+ GIA + IED + P   +  G 
Sbjct: 68  VEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGR 124

Query: 134 EQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAI 193
           +   L  ++E  GKI+A  +++ D   +I+AR  A +    ++  ++R  AY++AGAD I
Sbjct: 125 KSTDLICVEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGI 182

Query: 194 LI 195
            +
Sbjct: 183 CL 184


>3b8iC [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
          Length = 278

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 56/182 (30%), Positives = 93/182 (51%), Gaps = 6/182 (3%)

Query: 15  ARLRQMLRSNELEFIMEAHNGLSARIVREAGFK-GIWASGLAISAQFGVRDNNEASWTQV 73
           A  R +L S+         + +SARI  + GF+ GI    +A        D    + ++ 
Sbjct: 9   AMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEF 68

Query: 74  VDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGG 133
           V+    +   + LP++ D D GYGN  NV R V +LE+ GIA + IED + P   +  G 
Sbjct: 69  VEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGR 125

Query: 134 EQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAI 193
           +   L  ++E  GKI+A  +++ D   +I+AR  A +    ++  ++R  AY++AGAD I
Sbjct: 126 KSTDLICVEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGI 183

Query: 194 LI 195
            +
Sbjct: 184 CL 185


>3b8iB [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
          Length = 283

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 56/182 (30%), Positives = 93/182 (51%), Gaps = 6/182 (3%)

Query: 15  ARLRQMLRSNELEFIMEAHNGLSARIVREAGFK-GIWASGLAISAQFGVRDNNEASWTQV 73
           A  R +L S+         + +SARI  + GF+ GI    +A        D    + ++ 
Sbjct: 9   AMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEF 68

Query: 74  VDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGG 133
           V+    +   + LP++ D D GYGN  NV R V +LE+ GIA + IED + P   +  G 
Sbjct: 69  VEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGR 125

Query: 134 EQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAI 193
           +   L  ++E  GKI+A  +++ D   +I+AR  A +    ++  ++R  AY++AGAD I
Sbjct: 126 KSTDLICVEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGI 183

Query: 194 LI 195
            +
Sbjct: 184 CL 185


>3b8iA [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
          Length = 284

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 56/182 (30%), Positives = 93/182 (51%), Gaps = 6/182 (3%)

Query: 15  ARLRQMLRSNELEFIMEAHNGLSARIVREAGFK-GIWASGLAISAQFGVRDNNEASWTQV 73
           A  R +L S+         + +SARI  + GF+ GI    +A        D    + ++ 
Sbjct: 9   AMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEF 68

Query: 74  VDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGG 133
           V+    +   + LP++ D D GYGN  NV R V +LE+ GIA + IED + P   +  G 
Sbjct: 69  VEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGR 125

Query: 134 EQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAI 193
           +   L  ++E  GKI+A  +++ D   +I+AR  A +    ++  ++R  AY++AGAD I
Sbjct: 126 KSTDLICVEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGI 183

Query: 194 LI 195
            +
Sbjct: 184 CL 185


>3ih1B [x.x.x] METHYLISOCITRATE LYASE
          Length = 283

 Score = 81.6 bits (200), Expect = 5e-18
 Identities = 78/244 (31%), Positives = 118/244 (48%), Gaps = 12/244 (4%)

Query: 16  RLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQVVD 75
           R R ++ +NE+  I  AH+  +A + R  GF  ++ SG A +A  G+ D    + T+V +
Sbjct: 10  RFRALVEANEILQIPGAHDA-AALVARNTGFLALYLSGAAYTASKGLPDLGIVTSTEVAE 68

Query: 76  NLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQ 135
               +  A+DLP+L+D DTG+G   N                 IED+  PK    + G++
Sbjct: 69  RARDLVRATDLPVLVDIDTGFGGVLNXXXXXXXXXXXXXXXQ-IEDQQLPKKCGHLNGKK 127

Query: 136 QPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILI 195
             L   +E   KIKA K  +      IVAR +A     G++EA+ RA AY +AGADAI  
Sbjct: 128 --LVTTEELVQKIKAIK--EVAPSLYIVARTDAR-GVEGLDEAIERANAYVKAGADAIFP 182

Query: 196 HSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTP-TDVFRKAGISLVIWANHLIRVAASS 254
            + L   +E   F  +    APL +  T++  TP       A    VI+    +RVAA +
Sbjct: 183 EA-LQSEEEFRLFNSK--VNAPL-LANTEFGKTPYYSAEEFANGFQVIYPVTSLRVAAKA 238

Query: 255 MQAV 258
            + V
Sbjct: 239 YENV 242


>3ih1A [x.x.x] METHYLISOCITRATE LYASE
          Length = 284

 Score = 81.6 bits (200), Expect = 5e-18
 Identities = 78/244 (31%), Positives = 118/244 (48%), Gaps = 12/244 (4%)

Query: 16  RLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQVVD 75
           R R ++ +NE+  I  AH+  +A + R  GF  ++ SG A +A  G+ D    + T+V +
Sbjct: 12  RFRALVEANEILQIPGAHDA-AALVARNTGFLALYLSGAAYTASKGLPDLGIVTSTEVAE 70

Query: 76  NLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQ 135
               +  A+DLP+L+D DTG+G   N                 IED+  PK    + G++
Sbjct: 71  RARDLVRATDLPVLVDIDTGFGGVLNXXXXXXXXXXXXXXXQ-IEDQQLPKKCGHLNGKK 129

Query: 136 QPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILI 195
             L   +E   KIKA K  +      IVAR +A     G++EA+ RA AY +AGADAI  
Sbjct: 130 --LVTTEELVQKIKAIK--EVAPSLYIVARTDAR-GVEGLDEAIERANAYVKAGADAIFP 184

Query: 196 HSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTP-TDVFRKAGISLVIWANHLIRVAASS 254
            + L   +E   F  +    APL +  T++  TP       A    VI+    +RVAA +
Sbjct: 185 EA-LQSEEEFRLFNSK--VNAPL-LANTEFGKTPYYSAEEFANGFQVIYPVTSLRVAAKA 240

Query: 255 MQAV 258
            + V
Sbjct: 241 YENV 244


>3b8iD [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
          Length = 280

 Score = 79.7 bits (195), Expect = 2e-17
 Identities = 55/182 (30%), Positives = 90/182 (49%), Gaps = 8/182 (4%)

Query: 15  ARLRQMLRSNELEFIMEAHNGLSARIVREAGFK-GIWASGLAISAQFGVRDNNEASWTQV 73
           A  R +L S+         + +SARI  + GF+ GI    +A        D    + ++ 
Sbjct: 9   AMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEF 68

Query: 74  VDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGG 133
           V+    +   + LP++ D D GYGN  NV R V +LE+ GIA + IED + P        
Sbjct: 69  VEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQ-----F 123

Query: 134 EQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAI 193
               L  ++E  GKI+A  +++ D   +I+AR  A +    ++  ++R  AY++AGAD I
Sbjct: 124 RSTDLICVEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGI 181

Query: 194 LI 195
            +
Sbjct: 182 CL 183


>1jylA [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
          Length = 228

 Score = 70.1 bits (170), Expect = 2e-14
 Identities = 38/112 (33%), Positives = 61/112 (54%), Gaps = 4/112 (3%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID- 365
           A++LAAG G  L  LTE+ PK ++ V  KPL+ + ++  K +GINDI ++ GY  E  D 
Sbjct: 5   AIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFDY 64

Query: 366 ---AAGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMFRSYILRDL 414
                G++LV N+++A      SL    + L    V+   + +F++    DL
Sbjct: 65  LKEKYGVRLVFNDKYADYNNFYSLYLVKEELANSYVIDADNYLFKNMFRNDL 116


>3eooJ [x.x.x] METHYLISOCITRATE LYASE
          Length = 288

 Score = 69.7 bits (169), Expect = 2e-14
 Identities = 55/236 (23%), Positives = 109/236 (46%), Gaps = 10/236 (4%)

Query: 12  SRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQ-FGVRDNNEASW 70
           S  A+ R  + + +   ++ A    +A++    GFK ++ SG  ++A   G+ D   ++ 
Sbjct: 4   SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANSLGIPDLGISTM 63

Query: 71  TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSF 130
             V+ +   + +A++LP+L+D DTG+G   N+ R +R   + G+  V +ED++  K    
Sbjct: 64  DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGH 123

Query: 131 IGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGA 190
             G++       E   +IKA  D++ D+ F ++                     Y +AGA
Sbjct: 124 RPGKE--CVPAGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGA 180

Query: 191 DAILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIW 243
           D I   + +   D+   F    A + P++   T++ STP    D  + A + + ++
Sbjct: 181 DMIFPEA-MKTLDDYRRFKE--AVKVPILANLTEFGSTPLFTLDELKGANVDIALY 233


>3eooI [x.x.x] METHYLISOCITRATE LYASE
          Length = 289

 Score = 69.7 bits (169), Expect = 2e-14
 Identities = 55/236 (23%), Positives = 109/236 (46%), Gaps = 10/236 (4%)

Query: 12  SRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQ-FGVRDNNEASW 70
           S  A+ R  + + +   ++ A    +A++    GFK ++ SG  ++A   G+ D   ++ 
Sbjct: 3   SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANSLGIPDLGISTM 62

Query: 71  TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSF 130
             V+ +   + +A++LP+L+D DTG+G   N+ R +R   + G+  V +ED++  K    
Sbjct: 63  DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGH 122

Query: 131 IGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGA 190
             G++       E   +IKA  D++ D+ F ++                     Y +AGA
Sbjct: 123 RPGKE--CVPAGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGA 179

Query: 191 DAILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIW 243
           D I   + +   D+   F    A + P++   T++ STP    D  + A + + ++
Sbjct: 180 DMIFPEA-MKTLDDYRRFKE--AVKVPILANLTEFGSTPLFTLDELKGANVDIALY 232


>3eooE [x.x.x] METHYLISOCITRATE LYASE
          Length = 288

 Score = 69.7 bits (169), Expect = 2e-14
 Identities = 55/236 (23%), Positives = 109/236 (46%), Gaps = 10/236 (4%)

Query: 12  SRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQ-FGVRDNNEASW 70
           S  A+ R  + + +   ++ A    +A++    GFK ++ SG  ++A   G+ D   ++ 
Sbjct: 3   SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANSLGIPDLGISTM 62

Query: 71  TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSF 130
             V+ +   + +A++LP+L+D DTG+G   N+ R +R   + G+  V +ED++  K    
Sbjct: 63  DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGH 122

Query: 131 IGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGA 190
             G++       E   +IKA  D++ D+ F ++                     Y +AGA
Sbjct: 123 RPGKE--CVPAGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGA 179

Query: 191 DAILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIW 243
           D I   + +   D+   F    A + P++   T++ STP    D  + A + + ++
Sbjct: 180 DMIFPEA-MKTLDDYRRFKE--AVKVPILANLTEFGSTPLFTLDELKGANVDIALY 232


>3eooD [x.x.x] METHYLISOCITRATE LYASE
          Length = 287

 Score = 69.7 bits (169), Expect = 2e-14
 Identities = 55/236 (23%), Positives = 109/236 (46%), Gaps = 10/236 (4%)

Query: 12  SRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQ-FGVRDNNEASW 70
           S  A+ R  + + +   ++ A    +A++    GFK ++ SG  ++A   G+ D   ++ 
Sbjct: 3   SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANSLGIPDLGISTM 62

Query: 71  TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSF 130
             V+ +   + +A++LP+L+D DTG+G   N+ R +R   + G+  V +ED++  K    
Sbjct: 63  DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGH 122

Query: 131 IGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGA 190
             G++       E   +IKA  D++ D+ F ++                     Y +AGA
Sbjct: 123 RPGKE--CVPAGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGA 179

Query: 191 DAILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIW 243
           D I   + +   D+   F    A + P++   T++ STP    D  + A + + ++
Sbjct: 180 DMIFPEA-MKTLDDYRRFKE--AVKVPILANLTEFGSTPLFTLDELKGANVDIALY 232


>3eooC [x.x.x] METHYLISOCITRATE LYASE
          Length = 287

 Score = 69.7 bits (169), Expect = 2e-14
 Identities = 55/236 (23%), Positives = 109/236 (46%), Gaps = 10/236 (4%)

Query: 12  SRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQ-FGVRDNNEASW 70
           S  A+ R  + + +   ++ A    +A++    GFK ++ SG  ++A   G+ D   ++ 
Sbjct: 2   SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANSLGIPDLGISTM 61

Query: 71  TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSF 130
             V+ +   + +A++LP+L+D DTG+G   N+ R +R   + G+  V +ED++  K    
Sbjct: 62  DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGH 121

Query: 131 IGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGA 190
             G++       E   +IKA  D++ D+ F ++                     Y +AGA
Sbjct: 122 RPGKE--CVPAGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGA 178

Query: 191 DAILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIW 243
           D I   + +   D+   F    A + P++   T++ STP    D  + A + + ++
Sbjct: 179 DMIFPEA-MKTLDDYRRFKE--AVKVPILANLTEFGSTPLFTLDELKGANVDIALY 231


>3eooB [x.x.x] METHYLISOCITRATE LYASE
          Length = 286

 Score = 69.7 bits (169), Expect = 2e-14
 Identities = 55/236 (23%), Positives = 109/236 (46%), Gaps = 10/236 (4%)

Query: 12  SRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQ-FGVRDNNEASW 70
           S  A+ R  + + +   ++ A    +A++    GFK ++ SG  ++A   G+ D   ++ 
Sbjct: 2   SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANSLGIPDLGISTM 61

Query: 71  TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSF 130
             V+ +   + +A++LP+L+D DTG+G   N+ R +R   + G+  V +ED++  K    
Sbjct: 62  DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGH 121

Query: 131 IGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGA 190
             G++       E   +IKA  D++ D+ F ++                     Y +AGA
Sbjct: 122 RPGKE--CVPAGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGA 178

Query: 191 DAILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIW 243
           D I   + +   D+   F    A + P++   T++ STP    D  + A + + ++
Sbjct: 179 DMIFPEA-MKTLDDYRRFKE--AVKVPILANLTEFGSTPLFTLDELKGANVDIALY 231


>3eooA [x.x.x] METHYLISOCITRATE LYASE
          Length = 290

 Score = 69.7 bits (169), Expect = 2e-14
 Identities = 55/236 (23%), Positives = 109/236 (46%), Gaps = 10/236 (4%)

Query: 12  SRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQ-FGVRDNNEASW 70
           S  A+ R  + + +   ++ A    +A++    GFK ++ SG  ++A   G+ D   ++ 
Sbjct: 3   SAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAVYLSGGGVAANSLGIPDLGISTM 62

Query: 71  TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSF 130
             V+ +   + +A++LP+L+D DTG+G   N+ R +R   + G+  V +ED++  K    
Sbjct: 63  DDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGH 122

Query: 131 IGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGA 190
             G++       E   +IKA  D++ D+ F ++                     Y +AGA
Sbjct: 123 RPGKE--CVPAGEMVDRIKAAVDARTDETF-VIMXXXXXXXXXXXXXXXXXXXXYVEAGA 179

Query: 191 DAILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTP---TDVFRKAGISLVIW 243
           D I   + +   D+   F    A + P++   T++ STP    D  + A + + ++
Sbjct: 180 DMIFPEA-MKTLDDYRRFKE--AVKVPILANLTEFGSTPLFTLDELKGANVDIALY 232


>1jykA [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
          Length = 227

 Score = 69.3 bits (168), Expect = 3e-14
 Identities = 41/121 (33%), Positives = 66/121 (54%), Gaps = 6/121 (4%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID- 365
           A++LAAG G  L  LTE+ PK ++ V  KPL+ + ++  K +GINDI ++ GY  E  D 
Sbjct: 6   AIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFDY 65

Query: 366 ---AAGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMFRSYILRDLLETDAPFS 422
                G++LV N+++A      SL    + L    V+   + +F+++  R+ L     FS
Sbjct: 66  LKEKYGVRLVFNDKYADYNNFYSLYLVKEELANSYVIDADNYLFKNF--RNDLTRSTYFS 123

Query: 423 V 423
           V
Sbjct: 124 V 124


>2ze3A [x.x.x] DFA0005
          Length = 275

 Score = 58.5 bits (140), Expect = 5e-11
 Identities = 61/239 (25%), Positives = 96/239 (40%), Gaps = 21/239 (8%)

Query: 37  SARIVREAGFKGIWASGLAISAQFGVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGY 96
           SAR++  AGF  I  +   I+   G  D    +  ++   +E +  A  +P+  D + GY
Sbjct: 28  SARLLEAAGFTAIGTTSAGIAHARGRTDGQTLTRDEMGREVEAIVRAVAIPVNADIEAGY 87

Query: 97  GNF-NNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLADIDEFCGKIKAGKDSQ 155
           G+   +VRR V      G+AGV +ED          G     L D+D             
Sbjct: 88  GHAPEDVRRTVEHFAALGVAGVNLEDA--------TGLTPTELYDLDSQLXXXXXXXXXX 139

Query: 156 ADDDFSIV--ARVEALIAGWG------MEEALRRAEAYRQAGADAILIHSKLSKADEIVT 207
                 +   AR +  + G G      + E +RR +AY  AGAD I +   L   D    
Sbjct: 140 XXSGVPVFLNARTDTFLKGHGATDEERLAETVRRGQAYADAGADGIFVPLALQSQD---I 196

Query: 208 FAREWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAASSMQAVAREIHDSQ 266
            A   A R PL ++       P  +   AG + V +   L+      +Q +A E+H ++
Sbjct: 197 RALADALRVPLNVMAFPGSPVPRALL-DAGAARVSFGQSLMLATLGLVQRMAAELHAAE 254


>2ggoA [x.x.x] 401AA LONG HYPOTHETICAL GLUCOSE-1-PHOSPHATE
          Length = 401

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 29/100 (29%), Positives = 49/100 (49%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAIDA 366
           A +LAAG G+ LE +T  +PK  +P+  KPL+ + ++  +  GI DITV+   K +    
Sbjct: 3   AFILAAGSGERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGIRDITVIVSSKNKEYFE 62

Query: 367 AGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMF 406
             +K +         +    A  +     + ++ YGDL F
Sbjct: 63  KKLKEISIVTQKDDIKGTGAAILSAKFNDEALIIYGDLFF 102


>3fa4L [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 288

 Score = 52.0 bits (123), Expect = 4e-09
 Identities = 59/266 (22%), Positives = 112/266 (42%), Gaps = 18/266 (6%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 23  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 82

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLADIDEF--CGKI 148
           D DTGYG    V R   +  + G+A   IED++  K    + G  + L D D +      
Sbjct: 83  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVDTDTYVTXXXX 140

Query: 149 KAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSK--ADEIV 206
                     D  ++AR ++L    G EE+                +    S+  A +++
Sbjct: 141 XXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSREMARQVI 199

Query: 207 TFAREWAGRAPLVIVPTKYYSTPTDVFRKA---GISLVIWANHLIRVAASSMQAVAREIH 263
                W    PL++   ++ +TP+    +A   G  ++I+    +  A ++M+    ++ 
Sbjct: 200 QDLAGW----PLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKL- 254

Query: 264 DSQTLVNVEDRIATVNEIFRLQDADE 289
             +  +   D+  T   +FR+   DE
Sbjct: 255 -KRDGIPGLDKEMTPQMLFRVCGLDE 279


>3fa3L [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 300

 Score = 52.0 bits (123), Expect = 4e-09
 Identities = 59/266 (22%), Positives = 112/266 (42%), Gaps = 18/266 (6%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 25  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 84

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLADIDEF--CGKI 148
           D DTGYG    V R   +  + G+A   IED++  K    + G  + L D D +      
Sbjct: 85  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVDTDTYVTXXXX 142

Query: 149 KAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSK--ADEIV 206
                     D  ++AR ++L    G EE+                +    S+  A +++
Sbjct: 143 XXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSREMARQVI 201

Query: 207 TFAREWAGRAPLVIVPTKYYSTPTDVFRKA---GISLVIWANHLIRVAASSMQAVAREIH 263
                W    PL++   ++ +TP+    +A   G  ++I+    +  A ++M+    ++ 
Sbjct: 202 QDLAGW----PLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKL- 256

Query: 264 DSQTLVNVEDRIATVNEIFRLQDADE 289
             +  +   D+  T   +FR+   DE
Sbjct: 257 -KRDGIPGLDKEMTPQMLFRVCGLDE 281


>3fa3I [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 300

 Score = 52.0 bits (123), Expect = 4e-09
 Identities = 59/266 (22%), Positives = 112/266 (42%), Gaps = 18/266 (6%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 26  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 85

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLADIDEF--CGKI 148
           D DTGYG    V R   +  + G+A   IED++  K    + G  + L D D +      
Sbjct: 86  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVDTDTYVTXXXX 143

Query: 149 KAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSK--ADEIV 206
                     D  ++AR ++L    G EE+                +    S+  A +++
Sbjct: 144 XXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSREMARQVI 202

Query: 207 TFAREWAGRAPLVIVPTKYYSTPTDVFRKA---GISLVIWANHLIRVAASSMQAVAREIH 263
                W    PL++   ++ +TP+    +A   G  ++I+    +  A ++M+    ++ 
Sbjct: 203 QDLAGW----PLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKL- 257

Query: 264 DSQTLVNVEDRIATVNEIFRLQDADE 289
             +  +   D+  T   +FR+   DE
Sbjct: 258 -KRDGIPGLDKEMTPQMLFRVCGLDE 282


>3fa3B [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 302

 Score = 52.0 bits (123), Expect = 4e-09
 Identities = 59/266 (22%), Positives = 112/266 (42%), Gaps = 18/266 (6%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 26  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 85

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLADIDEF--CGKI 148
           D DTGYG    V R   +  + G+A   IED++  K    + G  + L D D +      
Sbjct: 86  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVDTDTYVTXXXX 143

Query: 149 KAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSK--ADEIV 206
                     D  ++AR ++L    G EE+                +    S+  A +++
Sbjct: 144 XXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSREMARQVI 202

Query: 207 TFAREWAGRAPLVIVPTKYYSTPTDVFRKA---GISLVIWANHLIRVAASSMQAVAREIH 263
                W    PL++   ++ +TP+    +A   G  ++I+    +  A ++M+    ++ 
Sbjct: 203 QDLAGW----PLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKL- 257

Query: 264 DSQTLVNVEDRIATVNEIFRLQDADE 289
             +  +   D+  T   +FR+   DE
Sbjct: 258 -KRDGIPGLDKEMTPQMLFRVCGLDE 282


>3fa3A [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 301

 Score = 52.0 bits (123), Expect = 4e-09
 Identities = 59/266 (22%), Positives = 112/266 (42%), Gaps = 18/266 (6%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 26  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 85

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLADIDEF--CGKI 148
           D DTGYG    V R   +  + G+A   IED++  K    + G  + L D D +      
Sbjct: 86  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTKRCGHLAG--KILVDTDTYVTXXXX 143

Query: 149 KAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSK--ADEIV 206
                     D  ++AR ++L    G EE+                +    S+  A +++
Sbjct: 144 XXXXXXXXGSDIVVIARTDSL-QTHGYEESXXXXXXXXXXXXXXXFLEGITSREMARQVI 202

Query: 207 TFAREWAGRAPLVIVPTKYYSTPTDVFRKA---GISLVIWANHLIRVAASSMQAVAREIH 263
                W    PL++   ++ +TP+    +A   G  ++I+    +  A ++M+    ++ 
Sbjct: 203 QDLAGW----PLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKL- 257

Query: 264 DSQTLVNVEDRIATVNEIFRLQDADE 289
             +  +   D+  T   +FR+   DE
Sbjct: 258 -KRDGIPGLDKEMTPQMLFRVCGLDE 282


>3fa4I [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 282

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 25  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 84

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPK 126
           D DTGYG    V R   +  + G+A   IED++  K
Sbjct: 85  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK 120


>3fa4H [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 282

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 26  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 85

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIED---KIFPKTNSFI 131
           D DTGYG    V R   +  + G+A   IED   KI   T++++
Sbjct: 86  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQKILVDTDTYV 129


>3fa4F [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 285

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 26  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 85

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPK 126
           D DTGYG    V R   +  + G+A   IED++  K
Sbjct: 86  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK 121


>3fa4D [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 284

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 26  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 85

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPK 126
           D DTGYG    V R   +  + G+A   IED++  K
Sbjct: 86  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK 121


>3fa4C [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 284

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 25  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 84

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPK 126
           D DTGYG    V R   +  + G+A   IED++  K
Sbjct: 85  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK 120


>3fa4B [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 288

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 26  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 85

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPK 126
           D DTGYG    V R   +  + G+A   IED++  K
Sbjct: 86  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK 121


>3fa3J [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 292

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 25  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 84

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPK 126
           D DTGYG    V R   +  + G+A   IED++  K
Sbjct: 85  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTK 120


>3fa4K [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 280

 Score = 49.3 bits (116), Expect = 3e-08
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 24  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 83

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKI 123
           D DTGYG    V R   +  + G+A   IED++
Sbjct: 84  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQV 116


>3fa4J [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 280

 Score = 49.3 bits (116), Expect = 3e-08
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 25  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 84

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKI 123
           D DTGYG    V R   +  + G+A   IED++
Sbjct: 85  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQV 117


>3fa4E [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 286

 Score = 49.3 bits (116), Expect = 3e-08
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 26  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 85

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKI 123
           D DTGYG    V R   +  + G+A   IED++
Sbjct: 86  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQV 118


>3fa4A [x.x.x] 2,3-DIMETHYLMALATE LYASE
          Length = 284

 Score = 49.3 bits (116), Expect = 3e-08
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 33  HNGLSARIVREAGFKGIWASGLAISAQF-GVRDNNEASWTQVVDNLEFMADAS-DLPILL 90
           ++GLSAR+   AGF  ++ +G   +A   G  D    +   +  N E +++ S   P++ 
Sbjct: 26  YDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIA 85

Query: 91  DGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKI 123
           D DTGYG    V R   +  + G+A   IED++
Sbjct: 86  DADTGYGGPIMVARTTEQYSRSGVAAFHIEDQV 118


>3fwwA [x.x.x] BIFUNCTIONAL PROTEIN GLMU
          Length = 445

 Score = 45.4 bits (106), Expect = 4e-07
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 7/103 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           S V+LAAG+G  + +   D PK++ P+AGKP+++ ++D     G   + +V G+  E + 
Sbjct: 4   SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGGELLK 60

Query: 366 AA----GIKLVRNERHAATGELASLACAADSLETDTVVSYGDL 404
                  +  V       TG     A    + + D ++ YGD+
Sbjct: 61  KTLADPSLNWVLQAEQLGTGHAMQQAAPHFADDEDILMLYGDV 103


>1wvcA [c.68.1] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE
          Length = 254

 Score = 44.3 bits (103), Expect = 9e-07
 Identities = 24/60 (40%), Positives = 32/60 (53%)

Query: 305 SSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAI 364
           S AV+LA G G  L   T  KPK M+ + GKP+L  ++  +   GI D  +  GYK   I
Sbjct: 2   SKAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVI 61


>2v0jA [x.x.x] BIFUNCTIONAL PROTEIN GLMU
          Length = 449

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 43/204 (21%), Positives = 86/204 (42%), Gaps = 13/204 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           SAV+LAAG+G  + +   D PK++  +AGKP+++ ++D     G  +I ++ G+  + + 
Sbjct: 4   SAVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGDLMR 60

Query: 366 A----AGIKLVRNERHAATGELASLACAADSLETDTVVSYGDL-MFRSYILRDLLETDAP 420
                  +  V       T      A        + VV YGD  +     L  L+E    
Sbjct: 61  THLANEQVNWVLQTEQLGTAHAVQQAAPFFKDNENIVVLYGDAPLITKETLEKLIEAKPE 120

Query: 421 FSV---VVDSSESAPSNQSVRDFAWCSA-ADDRDLFGQKVLLRKISDTPAATDGEPHGRW 476
             +    V+        + +R+     A  + +D   +++ +++++     +DG    +W
Sbjct: 121 NGIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANAEQLNIKEVNTGVMVSDGASFKKW 180

Query: 477 IGLL-NVRGEGRARLQKLLAELRQ 499
           +  + N   +G   L  L+A   Q
Sbjct: 181 LARVGNNNAQGEYYLTDLIALANQ 204


>2v0hA [x.x.x] BIFUNCTIONAL PROTEIN GLMU
          Length = 450

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 43/204 (21%), Positives = 86/204 (42%), Gaps = 13/204 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           SAV+LAAG+G  + +   D PK++  +AGKP+++ ++D     G  +I ++ G+  + + 
Sbjct: 4   SAVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGDLMR 60

Query: 366 A----AGIKLVRNERHAATGELASLACAADSLETDTVVSYGDL-MFRSYILRDLLETDAP 420
                  +  V       T      A        + VV YGD  +     L  L+E    
Sbjct: 61  THLANEQVNWVLQTEQLGTAHAVQQAAPFFKDNENIVVLYGDAPLITKETLEKLIEAKPE 120

Query: 421 FSV---VVDSSESAPSNQSVRDFAWCSA-ADDRDLFGQKVLLRKISDTPAATDGEPHGRW 476
             +    V+        + +R+     A  + +D   +++ +++++     +DG    +W
Sbjct: 121 NGIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANAEQLNIKEVNTGVMVSDGASFKKW 180

Query: 477 IGLL-NVRGEGRARLQKLLAELRQ 499
           +  + N   +G   L  L+A   Q
Sbjct: 181 LARVGNNNAQGEYYLTDLIALANQ 204


>2oi6B [x.x.x] BIFUNCTIONAL PROTEIN GLMU
          Length = 452

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           S V+LAAG+G  + +   D PK++  +AGK +++ ++D     G   + +V G+  + + 
Sbjct: 5   SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLK 61

Query: 366 AA----GIKLVRNERHAATGELASLACAADSLETDTVVSYGDL 404
            A     +  V       TG     A    + + D ++ YGD+
Sbjct: 62  QALKDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV 104


>2oi6A [x.x.x] BIFUNCTIONAL PROTEIN GLMU
          Length = 450

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           S V+LAAG+G  + +   D PK++  +AGK +++ ++D     G   + +V G+  + + 
Sbjct: 4   SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLK 60

Query: 366 AA----GIKLVRNERHAATGELASLACAADSLETDTVVSYGDL 404
            A     +  V       TG     A    + + D ++ YGD+
Sbjct: 61  QALKDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV 103


>1hv9B [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
          Length = 450

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           S V+LAAG+G  + +   D PK++  +AGK +++ ++D     G   + +V G+  + + 
Sbjct: 5   SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLK 61

Query: 366 AA----GIKLVRNERHAATGELASLACAADSLETDTVVSYGDL 404
            A     +  V       TG     A    + + D ++ YGD+
Sbjct: 62  QALKDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV 104


>1hv9A [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
          Length = 449

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           S V+LAAG+G  + +   D PK++  +AGK +++ ++D     G   + +V G+  + + 
Sbjct: 4   SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLK 60

Query: 366 AA----GIKLVRNERHAATGELASLACAADSLETDTVVSYGDL 404
            A     +  V       TG     A    + + D ++ YGD+
Sbjct: 61  QALKDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV 103


>1fxjA [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
          Length = 327

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           S V+LAAG+G  + +   D PK++  +AGK +++ ++D     G   + +V G+  + + 
Sbjct: 5   SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLK 61

Query: 366 AA----GIKLVRNERHAATGELASLACAADSLETDTVVSYGDL 404
            A     +  V       TG     A    + + D ++ YGD+
Sbjct: 62  QALKDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV 104


>1fwyB [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
          Length = 324

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           S V+LAAG+G  + +   D PK++  +AGK +++ ++D     G   + +V G+  + + 
Sbjct: 5   SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLK 61

Query: 366 AA----GIKLVRNERHAATGELASLACAADSLETDTVVSYGDL 404
            A     +  V       TG     A    + + D ++ YGD+
Sbjct: 62  QALKDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV 104


>1fwyA [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
          Length = 326

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 306 SAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           S V+LAAG+G  + +   D PK++  +AGK +++ ++D     G   + +V G+  + + 
Sbjct: 5   SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLK 61

Query: 366 AA----GIKLVRNERHAATGELASLACAADSLETDTVVSYGDL 404
            A     +  V       TG     A    + + D ++ YGD+
Sbjct: 62  QALKDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDV 104


>1dquA [c.1.12] ISOCITRATE LYASE
          Length = 513

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 34/113 (30%), Positives = 52/113 (46%), Gaps = 12/113 (10%)

Query: 60  FGVRDNNEASWTQVVDNLEFMADASDL-PILLDGDTGYGNFNNVRRLVRKLEQRGIAGVC 118
           F  R   E   T   D    +A+   L PI+ D DTG+G    V +L +   +RG AG+ 
Sbjct: 135 FHDRKQREERMTTPKDQRHKVANVDYLRPIIADADTGHGGLTAVMKLTKLFVERGAAGIH 194

Query: 119 IEDKIFPKTNSFIGGEQQPLADIDEFCGKIKAGKDSQAD---DDFSIVARVEA 168
           IED+         G + + L  I E   ++ A + +QAD    D   +AR ++
Sbjct: 195 IEDQA-------PGTKGKVLVPISEHINRLVAIR-AQADIMGTDLLAIARTDS 239


>1tzfA [c.68.1] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE
          Length = 251

 Score = 37.7 bits (86), Expect = 8e-05
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 305 SSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAI 364
           S AV+LA G G         KPK M+ + GKP+L  ++  +   GI D  +  GYK   I
Sbjct: 3   SKAVILAGGLGV--------KPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVI 54


>2ux8H [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 244

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           AV   AG G      T+  PK MLPV  +PL+++ VD     GI  +  V G    A++
Sbjct: 8   AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALE 66


>2ux8G [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 288

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           AV   AG G      T+  PK MLPV  +PL+++ VD     GI  +  V G    A++
Sbjct: 8   AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALE 66


>2ux8F [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 282

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           AV   AG G      T+  PK MLPV  +PL+++ VD     GI  +  V G    A++
Sbjct: 8   AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALE 66


>2ux8E [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 280

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           AV   AG G      T+  PK MLPV  +PL+++ VD     GI  +  V G    A++
Sbjct: 8   AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALE 66


>2ux8D [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 281

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           AV   AG G      T+  PK MLPV  +PL+++ VD     GI  +  V G    A++
Sbjct: 8   AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALE 66


>2ux8C [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 282

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           AV   AG G      T+  PK MLPV  +PL+++ VD     GI  +  V G    A++
Sbjct: 9   AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALE 67


>2ux8B [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 280

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           AV   AG G      T+  PK MLPV  +PL+++ VD     GI  +  V G    A++
Sbjct: 8   AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALE 66


>2ux8A [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 255

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYKAEAID 365
           AV   AG G      T+  PK MLPV  +PL+++ VD     GI  +  V G    A++
Sbjct: 8   AVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALE 66


>2qiwA [x.x.x] PEP PHOSPHONOMUTASE
          Length = 250

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 37  SARIVREAGFKGIWASGLAISAQFGVRD--NNEASWTQVVDNLEFMADASDLPILLDGDT 94
           SA +V EAGF G+      ++   G  D  NN A +  V    + +  A  +P+ +D ++
Sbjct: 31  SAGLVEEAGFSGLTIGSHPVADATGSSDGENNFADYAVV----KKITSAVSIPVSVDVES 86

Query: 95  GYGNFNNVRRLVRKLEQRGIAGVCIEDKI 123
           GYG   +   L+ ++ + G  G+ +ED +
Sbjct: 87  GYG--LSPADLIAQILEAGAVGINVEDVV 113


>2e3dD [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 278

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVV 356
           AV+  AG G  +   T+  PK MLP+  KPL++++V+     GI +I +V
Sbjct: 6   AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV 55


>2e3dC [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 288

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVV 356
           AV+  AG G  +   T+  PK MLP+  KPL++++V+     GI +I +V
Sbjct: 8   AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV 57


>2e3dB [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 281

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVV 356
           AV+  AG G  +   T+  PK MLP+  KPL++++V+     GI +I +V
Sbjct: 7   AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV 56


>2e3dA [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
          Length = 286

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 307 AVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVV 356
           AV+  AG G  +   T+  PK MLP+  KPL++++V+     GI +I +V
Sbjct: 7   AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV 56


>3brkX [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE
          Length = 386

 Score = 34.3 bits (77), Expect = 0.001
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 303 APSSAVVLAAGRGKGLEALTEDKPKIMLPVAGKP-LLRWLVDGFKNQGINDITVVGGYKA 361
           A  +A VLA GRG  L+ LT+ + K  +   GK  ++ + +    N GI  I V   YKA
Sbjct: 4   ARDAAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKA 63

Query: 362 EAI 364
            ++
Sbjct: 64  HSL 66


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.131    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 939,075,133
Number of extensions: 37653294
Number of successful extensions: 89164
Number of sequences better than 1.0e-03: 1822
Number of HSP's gapped: 87538
Number of HSP's successfully gapped: 2348
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)