BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABF08950.1 rmet0 ABF08950.1 GIB00349CH01 "Fe(II) trafficking
protein YggX"
         (114 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1yhdA [x.x.x] UPF0269 PROTEIN YGGX                                     79   5e-18
1xs8A [d.279.1] UPF0269 PROTEIN YGGX                                   79   6e-18
1t07A [d.279.1] HYPOTHETICAL UPF0269 PROTEIN PA5148                    66   4e-14

>1yhdA [x.x.x] UPF0269 PROTEIN YGGX
          Length = 92

 Score = 79.3 bits (194), Expect = 5e-18
 Identities = 38/86 (44%), Positives = 51/86 (59%)

Query: 25  ARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQTMLINENRLNMADPR 84
           +R + C  L +EAEG DF   PG+LGK+I+  +SKEAWA W   QTMLINE +LNM +  
Sbjct: 3   SRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQTMLINEKKLNMMNAE 62

Query: 85  ARQYLIKQTEKYFFGDGADQAAGYVP 110
            R+ L ++   + F        GY P
Sbjct: 63  HRKLLEQEMVNFLFEGKEVHIEGYTP 88


>1xs8A [d.279.1] UPF0269 PROTEIN YGGX
          Length = 91

 Score = 79.0 bits (193), Expect = 6e-18
 Identities = 37/87 (42%), Positives = 52/87 (59%)

Query: 24  MARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQTMLINENRLNMADP 83
           M+R + C  L ++AEG DF   PG+LGK+I+  +SK+AWA W   QTMLINE +LNM + 
Sbjct: 1   MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQTMLINEKKLNMMNA 60

Query: 84  RARQYLIKQTEKYFFGDGADQAAGYVP 110
             R+ L ++   + F        GY P
Sbjct: 61  EHRKLLEQEMVSFLFEGKDVHIEGYTP 87


>1t07A [d.279.1] HYPOTHETICAL UPF0269 PROTEIN PA5148
          Length = 75

 Score = 66.2 bits (160), Expect = 4e-14
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 4/71 (5%)

Query: 30  CIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQTMLINENRLNMADPRARQYL 89
           C K ++E  GLD PP PG  G+ I+ NVS++AW  W KHQT LINE RLN A+ R     
Sbjct: 7   CRKYHEELPGLDRPPYPGAKGEDIYNNVSRKAWDEWQKHQT-LINERRLNNAEDRK---F 62

Query: 90  IKQTEKYFFGD 100
           ++Q +K+  G+
Sbjct: 63  LQQEDKFLSGE 73


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 1,079,124,762
Number of extensions: 43633153
Number of successful extensions: 104823
Number of sequences better than 1.0e-03: 2201
Number of HSP's gapped: 103008
Number of HSP's successfully gapped: 2525
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)