BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABF09433.1 rmet0 ABF09433.1 GIB00349CH01 "Integrase, catalytic
region"
         (278 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3hphD [x.x.x] INTEGRASE                                                34   6e-04
3hphA [x.x.x] INTEGRASE                                                34   6e-04
3hpgF [x.x.x] INTEGRASE                                                34   6e-04
3hpgC [x.x.x] INTEGRASE                                                34   6e-04
3hpgB [x.x.x] INTEGRASE                                                34   6e-04

>3hphD [x.x.x] INTEGRASE
          Length = 196

 Score = 33.9 bits (76), Expect = 6e-04
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 16/97 (16%)

Query: 140 DREAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIEWL---------SDNGSAYI 190
           D+  + W  T   +SG I  + +     Q F      QT++W          SDNG A++
Sbjct: 54  DKIILVWVET---NSGLIYAERVKGETGQEFRV----QTMKWYAMFAPKSLQSDNGPAFV 106

Query: 191 DHRTRSFARELGLEPLTTPVRSPQSNGMAESFVKTMK 227
              T+   + LG+E  T    +PQS  + E   +T+K
Sbjct: 107 AESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLK 143


>3hphA [x.x.x] INTEGRASE
          Length = 194

 Score = 33.9 bits (76), Expect = 6e-04
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 16/97 (16%)

Query: 140 DREAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIEWL---------SDNGSAYI 190
           D+  + W  T   +SG I  + +     Q F      QT++W          SDNG A++
Sbjct: 53  DKIILVWVET---NSGLIYAERVKGETGQEFRV----QTMKWYAMFAPKSLQSDNGPAFV 105

Query: 191 DHRTRSFARELGLEPLTTPVRSPQSNGMAESFVKTMK 227
              T+   + LG+E  T    +PQS  + E   +T+K
Sbjct: 106 AESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLK 142


>3hpgF [x.x.x] INTEGRASE
          Length = 203

 Score = 33.9 bits (76), Expect = 6e-04
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 16/97 (16%)

Query: 140 DREAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIEWL---------SDNGSAYI 190
           D+  + W  T   +SG I  + +     Q F      QT++W          SDNG A++
Sbjct: 63  DKIILVWVET---NSGLIYAERVKGETGQEFRV----QTMKWYAMFAPKSLQSDNGPAFV 115

Query: 191 DHRTRSFARELGLEPLTTPVRSPQSNGMAESFVKTMK 227
              T+   + LG+E  T    +PQS  + E   +T+K
Sbjct: 116 AESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLK 152


>3hpgC [x.x.x] INTEGRASE
          Length = 198

 Score = 33.9 bits (76), Expect = 6e-04
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 16/97 (16%)

Query: 140 DREAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIEWL---------SDNGSAYI 190
           D+  + W  T   +SG I  + +     Q F      QT++W          SDNG A++
Sbjct: 58  DKIILVWVET---NSGLIYAERVKGETGQEFRV----QTMKWYAMFAPKSLQSDNGPAFV 110

Query: 191 DHRTRSFARELGLEPLTTPVRSPQSNGMAESFVKTMK 227
              T+   + LG+E  T    +PQS  + E   +T+K
Sbjct: 111 AESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLK 147


>3hpgB [x.x.x] INTEGRASE
          Length = 209

 Score = 33.9 bits (76), Expect = 6e-04
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 16/97 (16%)

Query: 140 DREAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIEWL---------SDNGSAYI 190
           D+  + W  T   +SG I  + +     Q F      QT++W          SDNG A++
Sbjct: 69  DKIILVWVET---NSGLIYAERVKGETGQEFRV----QTMKWYAMFAPKSLQSDNGPAFV 121

Query: 191 DHRTRSFARELGLEPLTTPVRSPQSNGMAESFVKTMK 227
              T+   + LG+E  T    +PQS  + E   +T+K
Sbjct: 122 AESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLK 158


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.316    0.131    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 922,320,590
Number of extensions: 36673885
Number of successful extensions: 86291
Number of sequences better than 1.0e-03: 2125
Number of HSP's gapped: 83504
Number of HSP's successfully gapped: 2490
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)