BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABF07996.1 rmet0 ABF07996.1 GIB00349CH01 "Orn/DAP/Arg
decarboxylase 2"
         (397 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DCDA_VIBCH RecName: Full=Diaminopimelate decarboxylase;         ...   126   4e-31
DCDA_HAEIN RecName: Full=Diaminopimelate decarboxylase;         ...   126   4e-31
DCDA_PSEAE RecName: Full=Diaminopimelate decarboxylase;         ...   122   5e-30
DCDA_NEIMA RecName: Full=Diaminopimelate decarboxylase;         ...   120   2e-29
DCDA_AQUAE RecName: Full=Diaminopimelate decarboxylase;         ...   120   3e-29
DCDA_NEIMB RecName: Full=Diaminopimelate decarboxylase;         ...   119   5e-29
DCDA_METTH RecName: Full=Diaminopimelate decarboxylase;         ...   114   1e-27
DCDA_HELPJ RecName: Full=Diaminopimelate decarboxylase;         ...   114   1e-27
DCDA_PSEFL RecName: Full=Diaminopimelate decarboxylase;         ...   113   2e-27
DCDA_ZYMMO RecName: Full=Diaminopimelate decarboxylase;         ...   111   1e-26
DCDA_HELPY RecName: Full=Diaminopimelate decarboxylase;         ...   109   5e-26
DCDA_CAMJE RecName: Full=Diaminopimelate decarboxylase;         ...   105   9e-25
DCDA_METJA RecName: Full=Diaminopimelate decarboxylase;         ...    97   3e-22
DCDA_ARCFU RecName: Full=Diaminopimelate decarboxylase;         ...    96   5e-22
DCDA_DEIRA RecName: Full=Diaminopimelate decarboxylase;         ...    92   1e-20
DCDA_ORYSJ RecName: Full=Probable diaminopimelate decarboxylase,...    89   5e-20
DCDA2_ARATH RecName: Full=Diaminopimelate decarboxylase 2, chlor...    81   1e-17
DCDA1_ARATH RecName: Full=Diaminopimelate decarboxylase 1, chlor...    81   1e-17
DCDA_SYNY3 RecName: Full=Diaminopimelate decarboxylase;         ...    79   5e-17
DCDA_ACTPA RecName: Full=Diaminopimelate decarboxylase;         ...    79   5e-17
DCDA_MYCTU RecName: Full=Diaminopimelate decarboxylase;         ...    78   2e-16
DCDA_MYCBO RecName: Full=Diaminopimelate decarboxylase;         ...    78   2e-16
DCLO_SELRU RecName: Full=Lysine/ornithine decarboxylase;        ...    77   3e-16
DCDA_MYCLE RecName: Full=Diaminopimelate decarboxylase;         ...    76   6e-16
DCDA_BACSU RecName: Full=Diaminopimelate decarboxylase;         ...    75   1e-15
DCOR_PANRE RecName: Full=Ornithine decarboxylase;         Short=...    74   2e-15
DCOR_DICDI RecName: Full=Probable ornithine decarboxylase;      ...    74   2e-15
DCOR_CAEEL RecName: Full=Ornithine decarboxylase;         Short=...    74   2e-15
DCDA_BACHD RecName: Full=Diaminopimelate decarboxylase;         ...    73   4e-15
DCDA_STRCO RecName: Full=Diaminopimelate decarboxylase;         ...    71   2e-14
DCDA_COREF RecName: Full=Diaminopimelate decarboxylase;         ...    69   5e-14
DCDA_BACMT RecName: Full=Diaminopimelate decarboxylase;         ...    69   5e-14
DCDA_ECOLI RecName: Full=Diaminopimelate decarboxylase;         ...    69   7e-14
DCDA_MYCS2 RecName: Full=Diaminopimelate decarboxylase;         ...    67   2e-13
DCDA_THEMA RecName: Full=Diaminopimelate decarboxylase;         ...    66   5e-13
TABA_PSESZ RecName: Full=Protein tabA;                                 66   6e-13
DCOR2_XENLA RecName: Full=Ornithine decarboxylase 2;         Sho...    65   1e-12
DCOR_TRYBB RecName: Full=Ornithine decarboxylase;         Short=...    64   2e-12
DCOR_MOUSE RecName: Full=Ornithine decarboxylase;         Short=...    62   7e-12
DCOR_RAT RecName: Full=Ornithine decarboxylase;         Short=OD...    58   2e-10
DCOR_MUSPA RecName: Full=Ornithine decarboxylase;         Short=...    58   2e-10
DCOR_HUMAN RecName: Full=Ornithine decarboxylase;         Short=...    56   5e-10
DCDA_BUCBP RecName: Full=Diaminopimelate decarboxylase;         ...    56   5e-10
DCOR_NEUCR RecName: Full=Ornithine decarboxylase;         Short=...    55   1e-09
DCOR_BOVIN RecName: Full=Ornithine decarboxylase;         Short=...    55   1e-09
SPEA_GEOBB RecName: Full=Biosynthetic arginine decarboxylase;   ...    54   2e-09
SPEA_GEOSM RecName: Full=Biosynthetic arginine decarboxylase;   ...    53   5e-09
DCOR_LEIDO RecName: Full=Ornithine decarboxylase;         Short=...    52   7e-09
DCOR1_XENLA RecName: Full=Ornithine decarboxylase 1;         Sho...    52   9e-09
DCDA_BUCAP RecName: Full=Diaminopimelate decarboxylase;         ...    52   9e-09
SPEA_SHEON RecName: Full=Biosynthetic arginine decarboxylase;   ...    52   1e-08
SPEA_PELPD RecName: Full=Biosynthetic arginine decarboxylase;   ...    52   1e-08
DCOR_CHICK RecName: Full=Ornithine decarboxylase;         Short=...    52   1e-08
DCDA_CORGL RecName: Full=Diaminopimelate decarboxylase;         ...    51   2e-08
SPEA_SHESW RecName: Full=Biosynthetic arginine decarboxylase;   ...    51   2e-08
SPEA_SHEPC RecName: Full=Biosynthetic arginine decarboxylase;   ...    51   2e-08
DCOR_SCHPO RecName: Full=Ornithine decarboxylase;         Short=...    50   3e-08
DCOR1_DROME RecName: Full=Ornithine decarboxylase 1;         Sho...    50   3e-08
SPEA_SHESA RecName: Full=Biosynthetic arginine decarboxylase;   ...    50   3e-08
DCOR_SOLLC RecName: Full=Ornithine decarboxylase;         Short=...    50   3e-08
DCOR_CRIGR RecName: Full=Ornithine decarboxylase;         Short=...    50   3e-08
DCOR_CAPAN RecName: Full=Ornithine decarboxylase;         Short=...    50   3e-08
SPEA_SHEB9 RecName: Full=Biosynthetic arginine decarboxylase;   ...    50   4e-08
SPEA_SHEB8 RecName: Full=Biosynthetic arginine decarboxylase;   ...    50   4e-08
SPEA_SHEB5 RecName: Full=Biosynthetic arginine decarboxylase;   ...    50   4e-08
SPEA_SHEB2 RecName: Full=Biosynthetic arginine decarboxylase;   ...    50   4e-08
SPEA_SHESR RecName: Full=Biosynthetic arginine decarboxylase;   ...    49   6e-08
SPEA_SHESM RecName: Full=Biosynthetic arginine decarboxylase;   ...    49   6e-08
DCOR_CANAL RecName: Full=Ornithine decarboxylase;         Short=...    49   6e-08
AZIN1_MOUSE RecName: Full=Antizyme inhibitor 1;         Short=AZ...    49   1e-07
DCOR_DATST RecName: Full=Ornithine decarboxylase;         Short=...    48   1e-07
AZIN1_PONAB RecName: Full=Antizyme inhibitor 1;         Short=AZ...    48   1e-07
AZIN1_HUMAN RecName: Full=Antizyme inhibitor 1;         Short=AZ...    48   1e-07
ADC_MOUSE RecName: Full=Antizyme inhibitor 2;         Short=AZI2...    48   2e-07
SPEA_YERPE RecName: Full=Biosynthetic arginine decarboxylase;   ...    47   2e-07
SPEA_SHEFN RecName: Full=Biosynthetic arginine decarboxylase;   ...    47   2e-07
DCDA_BUCAI RecName: Full=Diaminopimelate decarboxylase;         ...    46   5e-07
SPEA_SHEDO RecName: Full=Biosynthetic arginine decarboxylase;   ...    45   8e-07
SPEA_GEOMG RecName: Full=Biosynthetic arginine decarboxylase;   ...    45   1e-06
SPEA_SHEAM RecName: Full=Biosynthetic arginine decarboxylase;   ...    45   1e-06
SPEA_PROMH RecName: Full=Biosynthetic arginine decarboxylase;   ...    45   1e-06
SPEA_GEOSL RecName: Full=Biosynthetic arginine decarboxylase;   ...    44   2e-06
ADC_HUMAN RecName: Full=Arginine decarboxylase;         Short=AR...    44   2e-06
AZIN1_RAT RecName: Full=Antizyme inhibitor 1;         Short=AZI;...    43   4e-06
SPEA_PHOLL RecName: Full=Biosynthetic arginine decarboxylase;   ...    43   5e-06
SPEA_BACV8 RecName: Full=Biosynthetic arginine decarboxylase;   ...    43   5e-06
Y4YA_RHISN RecName: Full=Uncharacterized protein y4yA;                 42   7e-06
SPEA_SHEPA RecName: Full=Biosynthetic arginine decarboxylase;   ...    42   7e-06
DCOR2_DROME RecName: Full=Ornithine decarboxylase 2;         Sho...    42   9e-06
SPEA_XANCP RecName: Full=Biosynthetic arginine decarboxylase;   ...    42   1e-05
SPEA_NEIMB RecName: Full=Biosynthetic arginine decarboxylase;   ...    42   1e-05
SPEA_MARAV RecName: Full=Biosynthetic arginine decarboxylase;   ...    42   1e-05
SPEA_SHEHH RecName: Full=Biosynthetic arginine decarboxylase;   ...    41   2e-05
SPEA_NEIMA RecName: Full=Biosynthetic arginine decarboxylase;   ...    41   2e-05
SPEA_SYNPX RecName: Full=Biosynthetic arginine decarboxylase;   ...    41   2e-05
SPEA_SHESH RecName: Full=Biosynthetic arginine decarboxylase;   ...    41   2e-05
SPEA_GEOSF RecName: Full=Biosynthetic arginine decarboxylase;   ...    40   3e-05
SPEA_VIBPA RecName: Full=Biosynthetic arginine decarboxylase;   ...    40   3e-05
SPEA_SHEPW RecName: Full=Biosynthetic arginine decarboxylase;   ...    40   3e-05
SPEA_XYLFM RecName: Full=Biosynthetic arginine decarboxylase;   ...    40   5e-05
SPEA_VIBVU RecName: Full=Biosynthetic arginine decarboxylase;   ...    40   5e-05
SPEA_XYLFA RecName: Full=Biosynthetic arginine decarboxylase;   ...    39   1e-04
SPEA_XANAC RecName: Full=Biosynthetic arginine decarboxylase;   ...    39   1e-04
SPEA_PROMP RecName: Full=Biosynthetic arginine decarboxylase;   ...    39   1e-04
SPEA_XYLFT RecName: Full=Biosynthetic arginine decarboxylase;   ...    38   2e-04
SPEA_XYLF2 RecName: Full=Biosynthetic arginine decarboxylase;   ...    38   2e-04
SPEA_HAMD5 RecName: Full=Biosynthetic arginine decarboxylase;   ...    38   2e-04
SPEA_DEIRA RecName: Full=Biosynthetic arginine decarboxylase;   ...    38   2e-04
SPEA_BACFR RecName: Full=Biosynthetic arginine decarboxylase;   ...    38   2e-04
SPEA_BACFN RecName: Full=Biosynthetic arginine decarboxylase;   ...    38   2e-04
SPEA_SHELP RecName: Full=Biosynthetic arginine decarboxylase;   ...    37   3e-04
SPEA_PASMU RecName: Full=Biosynthetic arginine decarboxylase;   ...    37   3e-04
SPEA_BACTN RecName: Full=Biosynthetic arginine decarboxylase;   ...    37   4e-04
SPEA_GEOLS RecName: Full=Biosynthetic arginine decarboxylase;   ...    35   9e-04

>DCDA_VIBCH RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 417

 Score =  126 bits (316), Expect = 4e-31
 Identities = 107/355 (30%), Positives = 165/355 (46%), Gaps = 26/355 (7%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAELEGALR 106
           YAVKANS+  VL  L  +  GF++ S GE+ERV     +   + F G GKT+AE++ AL+
Sbjct: 58  YAVKANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQ 117

Query: 107 LGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANP-AYGLPGATLQMGGGATQFGIDEA 165
           L +   +VES  +L RL+ VA   G  A + LR NP         +  G    +FGI   
Sbjct: 118 LKIKCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFD 177

Query: 166 LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLN 225
               V   + ++PN+ V G+  H GS        +   DR +AL   L+   G+ +  L+
Sbjct: 178 RAAQVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLK-AEGIHIRHLD 236

Query: 226 VGGGIGIDYQN--PERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVI 283
           VGGG+G+ Y++  P +  ++ +                  +FE GR I+A  G  V +V 
Sbjct: 237 VGGGLGVVYRDELPPQPSEYAK----AXXXXXXXXXXXXXIFEPGRAIAANAGVLVTKVE 292

Query: 284 DLKRNHDKWFAVLRGGTHHFRLPV---SWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLC 340
            LK    K FA++    +    P    +WQ   P +           PR   E Q   L 
Sbjct: 293 FLKHTEHKNFAIIDAAMNDLIRPALYQAWQDIIPLR-----------PRQ-GEAQTYDLV 340

Query: 341 GELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGG 395
           G +C   D L ++  +  L+ GD +A   +GAYG+ +S  ++ + P    V + G
Sbjct: 341 GPVCETSDFLGKDRDL-VLQEGDLLAVRSSGAYGFTMS-SNYNTRPRVAEVMVDG 393


>DCDA_HAEIN RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 415

 Score =  126 bits (316), Expect = 4e-31
 Identities = 102/354 (28%), Positives = 168/354 (47%), Gaps = 23/354 (6%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAELEGALR 106
           +AVK+ S+  VL  +  +  GF++ S GE+ERV     +   + F G  K+  E+  AL 
Sbjct: 57  FAVKSCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALE 116

Query: 107 LGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANP---AYGLPGATLQMGGGATQFGID 163
           + +   +VES  +L  ++ +A   G+ A + LR NP   A+  P   +  G    +FG+ 
Sbjct: 117 VRIRCFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHP--YISTGLKENKFGVS 174

Query: 164 EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEW 223
                +V   + T+PN+++ G+  H GS   +    L   DR I L ++L++  G+TL+ 
Sbjct: 175 VNEAREVYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKE-DGITLKH 233

Query: 224 LNVGGGIGIDY--QNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAE 281
           L++GGG+G+ Y  + P    D   + + L   L+   P   I+ E GR ISA  G  VA+
Sbjct: 234 LDLGGGLGVTYTDETPPHPSD---YANALLEKLK-NYPELEIILEPGRAISANAGILVAK 289

Query: 282 VIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCG 341
           V  LK N  + FA+   G +    P  ++       +     D    R   E+    + G
Sbjct: 290 VQYLKSNESRNFAITDTGMNDMIRPALYEAYMNIVEI-----DRTLER---EKAIYDVVG 341

Query: 342 ELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGG 395
            +C   D L ++  +  +  GD IA   AGAYG  +S  ++ S      V + G
Sbjct: 342 PVCETSDFLGKQRELS-IAEGDYIAQCSAGAYGASMS-SNYNSRARTAEVLVDG 393


>DCDA_PSEAE RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 415

 Score =  122 bits (306), Expect = 5e-30
 Identities = 105/335 (31%), Positives = 156/335 (46%), Gaps = 20/335 (5%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAE-VPIAFGGPGKTDAELEGALR 106
           +AVKANS+  VL  L  +  GF++ S GE+ERV     +   + F G GKT  ++  AL 
Sbjct: 57  FAVKANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGDPAKVVFSGVGKTRDDMRRALE 116

Query: 107 LGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANP---AYGLPGATLQMGGGATQFGID 163
           +GV   +VES  +L RL  VA   G  A V LR NP   A   P  +  +        ID
Sbjct: 117 VGVHCFNVESGEELERLQRVAAELGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIAID 176

Query: 164 EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEW 223
           EA    V A++  + ++ V+G+  H GS     +  L  ++R + L  RL    G+ +  
Sbjct: 177 EA--EAVYARAAELDHLEVIGVDCHIGSQLTQLEPFLDALERLLGLVDRLAG-KGIGIRH 233

Query: 224 LNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVI 283
           L++GGG+G+ Y++ +     D   +  A   R       +VFE GR I A  G  +  V 
Sbjct: 234 LDLGGGLGVRYRDEQPPLAGD---YIRAIRERLHGRDLTLVFEPGRSIVANAGVLLTRVE 290

Query: 284 DLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGEL 343
            LK    K FA++    +    P  +Q     Q +         PR    R+   L G +
Sbjct: 291 YLKHTEHKDFAIVDAAMNDLIRPALYQAWMDVQAVR--------PRDAAPRR-YDLVGPI 341

Query: 344 CTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHIS 378
           C   D LA++  +  L  GD +A   AGAYG+ +S
Sbjct: 342 CETGDFLAKDRDL-ALAEGDLLAVRSAGAYGFVMS 375


>DCDA_NEIMA RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 406

 Score =  120 bits (302), Expect = 2e-29
 Identities = 96/332 (28%), Positives = 154/332 (46%), Gaps = 22/332 (6%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERV--RGVDAEVPIAFGGPGKTDAELEGAL 105
           YAVKAN +  +++    +  GF++ S GE+ RV   G DA   I F G GK++AE+E AL
Sbjct: 49  YAVKANGNLSIIKHFASLGSGFDIVSGGELARVLAAGGDAAKTI-FSGVGKSEAEIEFAL 107

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANP-AYGLPGATLQMGGGATQFGIDE 164
             GV   ++ES  ++ R+  VA R G+ A V LR NP         +  G  A +FGI  
Sbjct: 108 NAGVKCFNMESIPEIDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAY 167

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
           A   +    +   PN++++G+  H GS   D    +   +R + L   L    G+ LE L
Sbjct: 168 ADALEAYRHAAQQPNLKIIGIDCHIGSQLTDLSPLVEACERILILVDALA-AEGIVLEHL 226

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVID 284
           ++GGG+GI YQ+ E   D   +   +  L+       +++ E GR +    G  +  V  
Sbjct: 227 DLGGGVGIVYQD-EDVPDLGAYAQAVQKLI--GTRRLKLILEPGRSLVGNAGALLTRVEF 283

Query: 285 LKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVT--LCGE 342
           +K   +K F ++    +    P  +   H        H +   P+ +    P+T  + G 
Sbjct: 284 VKYGEEKNFVMVDAAMNDLMRPALYDAYH--------HIEAVEPKNIA---PLTANIVGP 332

Query: 343 LCTPKDVLAREVPVDRLRVGDRIAFTMAGAYG 374
           +C   D L ++  +     GD +    AGAYG
Sbjct: 333 ICETGDFLGKDRTI-ACEEGDLLLIRSAGAYG 363


>DCDA_AQUAE RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 420

 Score =  120 bits (300), Expect = 3e-29
 Identities = 94/340 (27%), Positives = 165/340 (48%), Gaps = 24/340 (7%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGAL 105
           YAVKAN +  +++ L  +  G ++ S GE+   +  G+  E  I + G GKT+ EL  A+
Sbjct: 62  YAVKANFNPHLVKLLGELGAGADIVSGGELYLAKKAGIPPE-RIVYAGVGKTEKELTDAV 120

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYG-LPGATLQMGGGATQFGIDE 164
              + + +VES  +L  L+ +A + G+ A + +R NP         +  G   ++FG+D 
Sbjct: 121 DSEILMFNVESRQELDVLNEIAGKLGKKARIAIRVNPDVDPKTHPYIATGMQKSKFGVDI 180

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
                    +  + N+ +VG+H H GS  LD   +   +++ ++L + L    G  +++L
Sbjct: 181 REAQKEYEYASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLYESLTQ-KGFDIKYL 239

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS--TRIVFECGRFISAGCGCYVAEV 282
           ++GGG+GI Y+ PE   D +     LA LL++   +   +I+ E GR I    G  + +V
Sbjct: 240 DIGGGLGIKYK-PE---DKEPAPQDLADLLKDLLENVKAKIILEPGRSIMGNAGILITQV 295

Query: 283 IDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVT--LC 340
             LK    K F ++  G +    P  +   H           +  P    ER+ V   + 
Sbjct: 296 QFLKDKGSKHFIIVDAGMNDLIRPSIYNAYH-----------HIIPVETKERKKVVADIV 344

Query: 341 GELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHH 380
           G +C   D LA +  ++ ++ G+ +A   AGAYG+ +S H
Sbjct: 345 GPICETGDFLALDREIEEVQRGEYLAVLSAGAYGFAMSSH 384


>DCDA_NEIMB RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 414

 Score =  119 bits (298), Expect = 5e-29
 Identities = 92/330 (27%), Positives = 149/330 (45%), Gaps = 18/330 (5%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERV--RGVDAEVPIAFGGPGKTDAELEGAL 105
           YAVKAN +  +++    +  GF++ S GE+ RV   G DA   I F G GK++AE+E AL
Sbjct: 49  YAVKANGNLSIIKHFASLGSGFDIVSGGELARVLAAGGDAAKTI-FSGVGKSEAEIEFAL 107

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANP-AYGLPGATLQMGGGATQFGIDE 164
             GV   ++ES  ++ R+  VA R G+ A V LR NP         +  G  A +FGI  
Sbjct: 108 NAGVKCFNMESIPEIDRIQKVAARLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAY 167

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
           A   +    +   PN++++G+  H GS   D    +   +R + L   L    G+ LE L
Sbjct: 168 ADALEAYHYAAQQPNLKIIGIDCHIGSQLTDLSPLVEACERILILVDALA-AEGIVLEHL 226

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVID 284
           ++GGG+GI YQ+ E   D   +   +  L+       +++ E GR +    G  +  V  
Sbjct: 227 DLGGGVGIVYQD-ENVPDLGAYAQAVQKLI--GTRRLKLILEPGRSLVGNAGSLLTRVEF 283

Query: 285 LKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELC 344
           +K   +K F ++    +    P  +   H  + +             +      + G +C
Sbjct: 284 VKYGEEKNFVMVDAAMNDLMRPALYDAYHHIEAVETKD---------IATLTANIVGPIC 334

Query: 345 TPKDVLAREVPVDRLRVGDRIAFTMAGAYG 374
              D L ++  +     GD +    AGAYG
Sbjct: 335 ETGDFLGKDRTI-ACEEGDLLLIRSAGAYG 363


>DCDA_METTH RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 428

 Score =  114 bits (286), Expect = 1e-27
 Identities = 99/356 (27%), Positives = 160/356 (44%), Gaps = 24/356 (6%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFGEIER--VRGVDAEVPIAFGGPGKTDAELEG 103
           ++YA KAN++  V+R L     G +  S GEI    + G D +  I + G    D EL+ 
Sbjct: 59  VFYACKANTNLAVMRILEEEGSGIDAVSPGEIYTALMAGFDPD-RILYTGNNVRDDELQF 117

Query: 104 ALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGA-TQFGI 162
           AL  GV  I+V+S  QL RL  +A    R   +  R NP  G       + GG  ++FG+
Sbjct: 118 ALDSGVR-INVDSRSQLLRLSEIAPEGLR---ISFRVNPLVGAGHHEHCITGGEMSKFGV 173

Query: 163 DEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLE 222
            E   P+V   +  +     VG+H H GS  LD +  +  ++  + +A R+ +  G+  E
Sbjct: 174 MEREAPEVYRMAMDL-GFEPVGIHAHIGSGILDPEPFMLAVETLMDIAGRVHEATGVEFE 232

Query: 223 WLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS-----TRIVFECGRFISAGCGC 277
           +++ GGG+GI Y   E   D D F   +  L ++           +  E GR+I      
Sbjct: 233 FIDFGGGLGIPYTPEEEPLDIDEFASKITGLFKDKLSEYGLGRPMMCLEPGRYIVGDASY 292

Query: 278 YVAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPV 337
            +  V  +K ++ K FA +  G +    P  +   H   V      + P   P    + +
Sbjct: 293 LLTRVNTIKESYRK-FAGVDAGFNTLLRPAMYGSYHHILVA-----ERPLDEP---SEKM 343

Query: 338 TLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFI 393
            + G +C   D+ AR+  +  +  GD +A   AGAY + +S   + S P P  V +
Sbjct: 344 DVAGNVCESGDLFARDRQLPEINEGDVLAIMNAGAYSFSMS-SQYNSRPRPAEVLV 398


>DCDA_HELPJ RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 405

 Score =  114 bits (285), Expect = 1e-27
 Identities = 87/311 (27%), Positives = 145/311 (46%), Gaps = 18/311 (5%)

Query: 68  GFEVASFGEIERVRGVDAE-VPIAFGGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAV 126
           G +  S GEI+R      +   I F G GK+  E+E AL+L +  ++VES ++L  ++ +
Sbjct: 63  GADCVSIGEIQRALKAGIKPYKIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETI 122

Query: 127 ARRQGRCADVLLRANPAYGLPGAT---LQMGGGATQFGIDEALLPDVLAQSRTMPNVRVV 183
           A+  G  A + +R NP   +   T   +  G    +FG++E    ++   ++    +  V
Sbjct: 123 AQSLGIKARISIRINP--NIDAKTHPYISTGLKENKFGVEEKEALEMFLWAKKSAFLEPV 180

Query: 184 GLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDW 243
            +H H GS  LD D       +   +AK L  L G+ L + +VGGGIG+ Y+N E    +
Sbjct: 181 SVHFHIGSQLLDLDPITEASQKVAKIAKSLIAL-GIDLRFFDVGGGIGVSYENEETIKLY 239

Query: 244 DRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVIDLKRNHDKWFAVLRGGTHHF 303
           D +  G+   L+       I+ E GR I A  G  + +V+  K+  +K F ++  G + F
Sbjct: 240 D-YAQGILNSLQ--GLDLTIICEPGRSIVAESGELITQVLYEKKAQNKRFVIVDAGMNDF 296

Query: 304 RLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGD 363
             P  +   H  +V+         P    E  P  + G +C   D   ++  +  L  GD
Sbjct: 297 LRPSLYHAKHAIRVIT--------PCGGREISPCDVVGPVCESSDTFLKDANLPELEPGD 348

Query: 364 RIAFTMAGAYG 374
           ++A    GAYG
Sbjct: 349 KLAIEKVGAYG 359


>DCDA_PSEFL RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 416

 Score =  113 bits (283), Expect = 2e-27
 Identities = 100/334 (29%), Positives = 149/334 (44%), Gaps = 17/334 (5%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEV-PIAFGGPGKTDAELEGALR 106
           +AVKANS+  VL  L  +  GF++ S GE+ERV         I F G GKT  ++  AL 
Sbjct: 57  FAVKANSNLGVLNVLARLGAGFDIVSGGELERVLAAGGSADKIVFSGVGKTREDMRRALE 116

Query: 107 LGVGLIHVESTLQL-SRLDAVARRQGRCADVLLRANPAYGL-PGATLQMGGGATQFGIDE 164
           +GV   ++EST +L SRL  VA   G  A + LR NP         +  G    +FGI  
Sbjct: 117 VGVHCFNIESTDELGSRLQIVAAELGVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAI 176

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
           A   DV  ++  +PN+ V+G+  H GS     +  +                 G+ L  +
Sbjct: 177 ADAEDVYVRAAQLPNLEVLGVDCHIGSQLTTLEPFIXXXXXXXXXXXXXXXC-GIYLRHI 235

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVID 284
           ++GGG+G+ Y++ E     D   +  A   R       ++FE GR+I A  G  + +V  
Sbjct: 236 DLGGGVGVRYRDEEPPLVAD---YIKAVRERLDGRDLALMFEPGRYIVANAGVLLTQVEY 292

Query: 285 LKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELC 344
           LK    K FA++    +    P  +Q       +         PR    R    + G +C
Sbjct: 293 LKHTEHKDFAIVDAAMNDLIRPALYQAWMDVTAVR--------PRDTAARS-YDIVGPIC 343

Query: 345 TPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHIS 378
              D LA+   +  L  GD +A   AGAYG+ +S
Sbjct: 344 ETGDFLAKGREL-ALEEGDLLAVHSAGAYGFVMS 376


>DCDA_ZYMMO RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 421

 Score =  111 bits (277), Expect = 1e-26
 Identities = 88/333 (26%), Positives = 146/333 (43%), Gaps = 22/333 (6%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP---IAFGGPGKTDAELEGA 104
           +AVKAN    +L +      G +V S GEI R   V A +P   I F G GKT  E+  A
Sbjct: 60  FAVKANPSQAILASFAKEGLGADVVSAGEIRRA--VHAGIPPERIVFSGVGKTAEEMRYA 117

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYG-LPGATLQMGGGATQFGID 163
           L +G+G  ++ES  ++  L  VA   G+ A V LR NP       A +  G   T+FGI 
Sbjct: 118 LEIGIGQFNIESVSEIEMLAEVATSLGKKAAVALRINPDVDPHTHAKIATGKADTKFGIA 177

Query: 164 EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEW 223
                    +  + P++++ G+  H GS   D     A  +R   +   L +  G  +E 
Sbjct: 178 AEDALSAYEKLASYPSLKIQGIASHIGSQITDLAPFEAAAERIYEIITAL-EKAGHAIET 236

Query: 224 LNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAP--STRIVFECGRFISAGCGCYVAE 281
            ++GGG+G+ Y++ +              +++      + R++FE GR + A  G  +++
Sbjct: 237 ADLGGGLGVRYKDDQPE---PPSVEAYGEMIKRVTKGWNCRLIFEPGRSLIANAGVLLSK 293

Query: 282 VIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCG 341
           VI +K +    F +L    +    P  +   H  + +           P  +     + G
Sbjct: 294 VIRIKESKTARFVILDAAMNDLVRPTLYDAYHEIKAV----------TPSAQTYQADIVG 343

Query: 342 ELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYG 374
            +C   D+ AR   +  ++  D +A   AGAYG
Sbjct: 344 PVCETGDIFARNRSISAVKADDLMAIMSAGAYG 376


>DCDA_HELPY RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 405

 Score =  109 bits (272), Expect = 5e-26
 Identities = 85/311 (27%), Positives = 143/311 (45%), Gaps = 18/311 (5%)

Query: 68  GFEVASFGEIERVRGVDAE-VPIAFGGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAV 126
           G +  S GEI R      +   I F G GK+  E+E AL+L +  ++VES ++L+ ++ +
Sbjct: 63  GADCVSIGEIYRALKAGIKPYRIVFSGVGKSGFEIEQALKLNILFLNVESFMELTTIETI 122

Query: 127 ARRQGRCADVLLRANPAYGLPGAT---LQMGGGATQFGIDEALLPDVLAQSRTMPNVRVV 183
           A+  G  A + +R NP   +   T   +  G    +FG+ E    ++   ++    +  V
Sbjct: 123 AQSLGIKARISIRINP--NIDAKTHPYISTGLKENKFGVGEKEALEMFLWAKKSAFLEPV 180

Query: 184 GLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDW 243
            +H H GS   D +  +    +   +AK L  L G+ L + +VGGGIG+ Y+N E    +
Sbjct: 181 SVHFHIGSQLSDLEPIIEASQKVAKIAKSLIAL-GIDLRFFDVGGGIGVSYENEETIKLY 239

Query: 244 DRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVIDLKRNHDKWFAVLRGGTHHF 303
           D +  G+   L+       I+ E GR I A  G  + +V+  K+  +K F V+  G + F
Sbjct: 240 D-YAQGILNSLQ--GLDLTIICEPGRSIVAESGELITQVLYEKKAQNKRFVVVDAGMNDF 296

Query: 304 RLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGD 363
             P  +   H  +V+         P    E  P  + G +C   D   ++  +  L  GD
Sbjct: 297 LRPSLYHAKHAIRVIT--------PSKGREISPCDVVGPVCESSDTFLKDAHLPELEPGD 348

Query: 364 RIAFTMAGAYG 374
           ++     GAYG
Sbjct: 349 KLVIEKVGAYG 359


>DCDA_CAMJE RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 402

 Score =  105 bits (261), Expect = 9e-25
 Identities = 89/337 (26%), Positives = 147/337 (43%), Gaps = 19/337 (5%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEV-PIAFGGPGKTDAELEGA 104
           ++YAVKANS+  +L+ L  +  GF+  S GE++R     A+   I F G GKT  EL  A
Sbjct: 40  IFYAVKANSNLSLLQMLANLDSGFDCVSIGEVKRALKAGAKAYKIIFSGVGKTKEELRQA 99

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANP-AYGLPGATLQMGGGATQFGID 163
           L   +  I+            VA+     A + +R NP         +  G    +FG++
Sbjct: 100 LEYDILYINXXXXXXXXXXXXVAKELNLKARISIRVNPNVDAKTHPYISTGLNENKFGVE 159

Query: 164 EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGL--TL 221
             +   +   ++    +  VG+H H GS  LD      + +    +AK +R+L  L   L
Sbjct: 160 IDIARKMYLYAKNSSFLEPVGVHFHIGSQLLDIS---PIHEAAAIVAKLVRELKALQIDL 216

Query: 222 EWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAE 281
           ++ ++GGG+G+ Y+  E   D   +  G+ A L        I  E GR++ A  G +V  
Sbjct: 217 KFFDIGGGLGVAYEKNECEPDLYDYAQGILAQLH--GLDLTIGMEPGRYLVAKSGEFVCS 274

Query: 282 VIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCG 341
           V+  K+N  K F V+ G  +    P  ++  H   +LP +           E     + G
Sbjct: 275 VLYEKQNKTKRFVVVDGAMNDLIRPSLYEAYHEI-ILPYNQG---------EESLCDVVG 324

Query: 342 ELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHIS 378
            +C   D  A+   +   +  D +     GAYG+ +S
Sbjct: 325 GICESGDFFAKARSLPSTQSDDIMVIKNTGAYGFSMS 361


>DCDA_METJA RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 438

 Score = 96.7 bits (239), Expect = 3e-22
 Identities = 84/336 (25%), Positives = 147/336 (43%), Gaps = 22/336 (6%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGE--IERVRGVDAEVPIAFGGPGKTDAELEGAL 105
           YA KAN++  + R L  +  G +V S GE  I ++  V ++  I F G  KT  E+   +
Sbjct: 70  YAYKANANLAITRLLAKLGCGADVVSGGELYIAKLSNVPSK-KIVFNGNCKTKEEIIMGI 128

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYG-LPGATLQMGGGATQFGID- 163
              +   +V+S  +L  ++  A+  G  A+V  R NP         +  G    +FG+D 
Sbjct: 129 EANIRAFNVDSISELILINETAKELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDV 188

Query: 164 -EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLE 222
              +    +  +  M  V VVG+H H GS   D    +    + +     L++  G+ +E
Sbjct: 189 ESGIAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFVVELKE-EGIEIE 247

Query: 223 WLNVGGGIGIDY----QNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCY 278
            +N+GGG+GI Y    Q P +    D   + +    ++      ++ E GR + A  G  
Sbjct: 248 DVNLGGGLGIPYYKDKQIPTQKDLADAIINTMLKY-KDKVEMPNLILEPGRSLVATAGYL 306

Query: 279 VAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVT 338
           + +V  +K      + ++  G +    P  ++  H        +          E++ V+
Sbjct: 307 LGKVHHIKETPVTKWVMIDAGMNDMMRPAMYEAYHHIINCKVKN----------EKEVVS 356

Query: 339 LCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYG 374
           + G LC   DV  R+  +D++ VGD +A    GAYG
Sbjct: 357 IAGGLCESSDVFGRDRELDKVEVGDVLAIFDVGAYG 392


>DCDA_ARCFU RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 419

 Score = 95.9 bits (237), Expect = 5e-22
 Identities = 93/357 (26%), Positives = 158/357 (44%), Gaps = 21/357 (5%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFGEI--ERVRGVDAEVPIAFGGPGKTDAELEG 103
           L YAVKAN++  ++R +     G +V S GE+    + G   ++ + F G  K+  E+E 
Sbjct: 51  LLYAVKANNNLALMRIIASHGFGADVFSDGELYLASLAGFRKDM-VLFNGNSKSRKEIEM 109

Query: 104 ALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGA--TQFG 161
            +  GV    V+S  +L  +  +A+  G+  ++  R NP    P    ++  G   ++FG
Sbjct: 110 GVTAGVKF-SVDSLDELRTISKIAKEVGKEVEIAFRVNPDVD-PKTHPKIATGLRESKFG 167

Query: 162 IDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTL 221
           I   ++ +    +  +  V  VG+H H GS  LD    +  +++ + +A  +  L G+ L
Sbjct: 168 IPHEMVREAYEMALKLDGVVPVGIHCHIGSQILDLSPFVHALNKVMDIAVDIEKL-GVEL 226

Query: 222 EWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPST---RIVFECGRFISAGCGCY 278
            ++++GGG+GIDY+        D     L       A  T   ++  E GR I       
Sbjct: 227 SFVDMGGGLGIDYEGKGAPTPKDLASAILPEFEGRKADLTSDPQLWLEPGRSIVGNTTVL 286

Query: 279 VAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVT 338
           +  V  +K+ +  + AV  G     R P  +   H   V                 +  T
Sbjct: 287 ITRVNAVKKGYKNFVAVDAGFNVLIR-PAMYGSYHRVAVANK--------MDAEPEEVYT 337

Query: 339 LCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGG 395
           + G +C   DVLAR+  + ++ VGD IA   AGAYG+ +S   +   P    V + G
Sbjct: 338 VVGPICESGDVLARDRKLPKVEVGDLIAVFDAGAYGFVMS-SQYNGRPRCAEVLVSG 393


>DCDA_DEIRA RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 379

 Score = 91.7 bits (226), Expect = 1e-20
 Identities = 98/358 (27%), Positives = 150/358 (41%), Gaps = 49/358 (13%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFE-VASFGEIERVRGVDAEVPIAFGGPGKTDAELEGA 104
           ++YA+KAN +  +LR       GFE V+                +   GP K+DAE   A
Sbjct: 43  IFYAMKANPNLNLLRRYAAAGVGFECVSXXXXXXXXXXXXXXXXMILNGPAKSDAEYAAA 102

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT-LQMGGGATQFGID 163
            RLG  ++ V+   ++  L   +R       VL+R NPA  +     L  G   ++FG+ 
Sbjct: 103 ARLGATIV-VDREEEVVLLPPGSR-------VLVRVNPAMTVSTHEHLATGTARSKFGLT 154

Query: 164 EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEW 223
              +P  LA+ R   +  V+GLH+H GS    A+   A   R   L   +    GL++  
Sbjct: 155 PEQVPGTLAELRDAGH-EVLGLHMHIGSAIEQAEDFTAAFARVTELRAHIG---GLSV-- 208

Query: 224 LNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAP--STRIVFECGRFISAGCGCYVAE 281
           LNVGGG  ++               G+A    E A      +  E GR++ A  G  +  
Sbjct: 209 LNVGGGWSLNAD-----------LEGIAYEAHEAARVFGAELWVEPGRYLVASAGWLLTR 257

Query: 282 VIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHP----FQVLPNDHWDYPFPRPVVERQPV 337
           V+  KR   + F ++  G   F  P+ +  +HP    +  L  + WD             
Sbjct: 258 VVGTKRT-GRNFCLVDAGMTEFLRPMLYGASHPLYPMWDALATEVWD------------- 303

Query: 338 TLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGG 395
            + G  C   D++AR VP+   + G  +    AGAYG  +S   +LS P P  V   G
Sbjct: 304 -VAGPACESGDLIARGVPLPTPQRGHLLLIGEAGAYGASMS-STYLSRPRPAEVLWTG 359


>DCDA_ORYSJ RecName: Full=Probable diaminopimelate decarboxylase,
           chloroplastic;         Short=DAP decarboxylase;       
           EC=4.1.1.20;
          Length = 490

 Score = 89.4 bits (220), Expect = 5e-20
 Identities = 91/331 (27%), Positives = 135/331 (40%), Gaps = 18/331 (5%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIE-RVRGVDAEVPIAFGGPGKTDAELEGALR 106
           YAVKAN++  VL+ L  +  G  + S  E+   +R         F G GKT  +L  A  
Sbjct: 127 YAVKANNNLRVLQLLRELGCGAVLVSGNELRLALRAGFDPTRCIFNGNGKTLEDLVLAAE 186

Query: 107 LGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLP-GATLQMGGGATQFGIDEA 165
            GV  ++++S   L  +   AR  G+   VLLR NP         +  G   ++FGI   
Sbjct: 187 SGV-FVNIDSEFDLENIVTAARVAGKKVPVLLRINPDVDPQVHPYVATGNKTSKFGIRNE 245

Query: 166 LLPDVLAQSRTMPN-VRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
            L   L   ++  N + +VG+H H GS     D         +     +R   G  LE+L
Sbjct: 246 KLQWFLDSIKSYSNDITLVGVHCHLGSTITKVDIFRDAAGLMVNYVDEIR-AQGFELEYL 304

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS--TRIVFECGRFISAGCGCYVAEV 282
           N+GGG+GIDY + +           L   +RE   S    ++ E GR + A   C+V  V
Sbjct: 305 NIGGGLGIDYHHTDAVLPTPM---DLINTVRELVLSRDLTLIIEPGRSLIANTCCFVNRV 361

Query: 283 IDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGE 342
             +K N  K F V+ G       P  +            H +   P P  E     + G 
Sbjct: 362 TGVKSNGTKNFIVVDGSMAELIRPSLYG--------AYQHIELVSPSPDAEVATFDIVGP 413

Query: 343 LCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
           +C   D L ++  +     G  +    AGAY
Sbjct: 414 VCESADFLGKDRELPTPDKGAGLVVHDAGAY 444


>DCDA2_ARATH RecName: Full=Diaminopimelate decarboxylase 2,
           chloroplastic;         Short=DAP decarboxylase 2;       
            EC=4.1.1.20;Flags: Precursor;
          Length = 489

 Score = 81.3 bits (199), Expect = 1e-17
 Identities = 89/332 (26%), Positives = 139/332 (41%), Gaps = 19/332 (5%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIER--VRGVDAEVPIAFGGPGKTDAELEGAL 105
           YA+KAN++  +L  L  +  G  + S  E+    + G D    I F G GK+  +L  A 
Sbjct: 127 YAIKANNNLKILEHLRSLGCGAVLVSGNELRLALLAGFDPTKCI-FNGNGKSLEDLVLAA 185

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLP-GATLQMGGGATQFGIDE 164
           + GV  ++V+S   L+ +   +R  G+  +VLLR NP         +  G   ++FGI  
Sbjct: 186 QEGV-FVNVDSEFDLNNIVEASRISGKQVNVLLRINPDVDPQVHPYVATGNKNSKFGIRN 244

Query: 165 ALLPDVLAQSRTMPN-VRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEW 223
             L   L + +  P  +++VG H H GS     D         I     +R   G  + +
Sbjct: 245 EKLQWFLDEVKAHPKELKLVGAHCHLGSTITKVDIFRDAAVLMIEYIDEIRR-QGFEVSY 303

Query: 224 LNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS--TRIVFECGRFISAGCGCYVAE 281
           LN+GGG+GIDY +             L   +RE   S    ++ E GR + A   C+V  
Sbjct: 304 LNIGGGLGIDYYHAGAVLPTPM---DLINTVRELVLSRDLNLIIEPGRSLIANTCCFVNH 360

Query: 282 VIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCG 341
           V  +K N  K F V+ G       P  +      +++       P P P  E     + G
Sbjct: 361 VTGVKTNGTKNFIVIDGSMAELIRPSLYDAYQHIELVS------PTP-PEAEVTKFDVVG 413

Query: 342 ELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
            +C   D L ++  +     G  +    AGAY
Sbjct: 414 PVCESADFLGKDRELPTPPQGAGLVVHDAGAY 445


>DCDA1_ARATH RecName: Full=Diaminopimelate decarboxylase 1,
           chloroplastic;         Short=DAP decarboxylase 1;       
            EC=4.1.1.20;Flags: Precursor;
          Length = 484

 Score = 81.3 bits (199), Expect = 1e-17
 Identities = 89/332 (26%), Positives = 136/332 (40%), Gaps = 19/332 (5%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIE-RVRGVDAEVPIAFGGPGKTDAELEGALR 106
           YA+KAN++  +L  L  +  G  + S  E+   +R         F G GK+  +L  A +
Sbjct: 122 YAIKANNNLKILEHLRSLGCGAVLVSGNELRLALRAGFDPTKCIFNGNGKSLEDLVLAAQ 181

Query: 107 LGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLP-GATLQMGGGATQFGIDEA 165
            GV  ++V+S   L+ +   +R  G+  +VLLR NP         +  G   ++FGI   
Sbjct: 182 EGV-FVNVDSEFDLNNIVEASRISGKQVNVLLRINPDVDPQVHPYVATGNKNSKFGIRNE 240

Query: 166 LLPDVLAQSRTMPN-VRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
            L   L Q +  P  +++VG H H GS     D         I     +R   G  + +L
Sbjct: 241 KLQWFLDQVKAHPKELKLVGAHCHLGSTITKVDIFRDAAVLMIEYIDEIRR-QGFEVSYL 299

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS--TRIVFECGRFISAGCGCYVAEV 282
           N+GGG+GIDY +             L   +RE   S    ++ E GR + A   C+V  V
Sbjct: 300 NIGGGLGIDYYHAGAVLPTPM---DLINTVRELVLSRDLNLIIEPGRSLIANTCCFVNHV 356

Query: 283 IDLKRNHDKWFAVLRGGTHHFRLPVSWQ-HNHPFQVLPNDHWDYPFPRPVVERQPVTLCG 341
             +K N  K F V+ G       P  +  + H   V P        P    E     + G
Sbjct: 357 TGVKTNGTKNFIVIDGSMAELIRPSLYDAYQHIELVSP--------PPAEAEVTKFDVVG 408

Query: 342 ELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
            +C   D L ++  +     G  +    AGAY
Sbjct: 409 PVCESADFLGKDRELPTPPQGAGLVVHDAGAY 440


>DCDA_SYNY3 RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 469

 Score = 79.3 bits (194), Expect = 5e-17
 Identities = 92/367 (25%), Positives = 160/367 (43%), Gaps = 35/367 (9%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVADGFEVASFGEI-------ERVRGVDAEVP--IAF 91
           P    + YA KA S   V+        GF+V S GE+       +++   +AE+   I F
Sbjct: 83  PGSSQVIYASKAWSCLAVVAIAAQEGLGFDVVSGGELFTTVSALKQLGWDEAEIAEKIYF 142

Query: 92  GGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT- 150
            G  K+  EL+ A+ +   +I V++ L+L  L  +A   G    ++LR  P  G+   T 
Sbjct: 143 HGNNKSVQELQEAIAINCTII-VDNWLELETLTKLAADSGAPVKIMLRLTP--GIECHTH 199

Query: 151 --LQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIA 208
             ++ G   ++FG D   L  V       P++  +GLH H GS   +   H  L +  + 
Sbjct: 200 EYIKTGHLDSKFGFDPNQLEAVFTYIAQQPSLHCLGLHAHIGSQIFERQPHKDLGEVLVQ 259

Query: 209 -LAKRLRDLHGLTLEWLNVGGGIGIDY---QNPERHFDWDRFC--HGLAALLRETAPSTR 262
              K L   +GL L  LN+GGG+GI Y    +P    +W +        A  R+  P  +
Sbjct: 260 WFTKGL--TYGLPLTELNIGGGLGICYTESDDPPSIEEWAQVAAISVAKACDRQNIPYPK 317

Query: 263 IVFECGRFISAGCGCYVAEVIDLKR--NHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPN 320
           ++ E GR +  G  C  A  +  ++   + + +  + GG      P+++Q  +   +   
Sbjct: 318 LIAEPGRSL-VGSACVTAYRVGGRKVVPNIRTYISVDGGMSDNPRPITYQSVYRVALANR 376

Query: 321 DHWDYPFPRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHI-SH 379
            + +          + VT+ G+ C   D+L ++V +     GD +     GAY   + S+
Sbjct: 377 MNDEI--------TETVTVAGKHCESGDILVKDVALPAAEPGDIMVVAATGAYNHSMASN 428

Query: 380 HDFLSHP 386
           ++ L  P
Sbjct: 429 YNRLGRP 435


>DCDA_ACTPA RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 437

 Score = 79.3 bits (194), Expect = 5e-17
 Identities = 96/355 (27%), Positives = 139/355 (39%), Gaps = 36/355 (10%)

Query: 43  QCALYYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAEL 101
           +  + +A KA     V R +       +V S GE+   R V      +   G  KT  +L
Sbjct: 73  EAEVVFAGKALPCREVYRWVADEGLSLDVCSAGELAIARSVGFPAERVLLHGNVKTPEDL 132

Query: 102 EGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT---LQMGGGAT 158
           + AL  GVG + V+S  ++ +L A+A       DVL+R  P  G+   T   +  G    
Sbjct: 133 KAALGYGVGRVVVDSFDEIEQLGALAEGP---QDVLVRVTP--GVDPRTHRAVATGVEDQ 187

Query: 159 QFGIDEALLPDVLAQSRTM--PNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDL 216
           +FG   A    + A  R +  P++R+VGLH H GS                 L       
Sbjct: 188 KFGFSLAGGDALEAVLRVVEQPSLRLVGLHCHVGSQXXXXXXXXXXXXXXXGLIASC--- 244

Query: 217 HGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGL-AALLRETA----PSTRIVFECGRFI 271
            G+ +E L++GGG  + Y   E  FD   F H +  AL  E A    P  R+  E GR +
Sbjct: 245 -GVRIEQLDLGGGFAVPYLPGEGEFDLGGFAHRVRVALSHECALRRVPVPRLSIEPGRAV 303

Query: 272 SAGCGCYVAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPV 331
            A  G  +                  GG            ++P   L             
Sbjct: 304 VARAGVTLYXXXXXXXXXXXXXXXXDGG----------MSDNPRPALYGSXXXXXXXXXX 353

Query: 332 VERQPVTLCGELCTPKDVLAREVPV-DRLRVGDRIAFTMAGAYGWHISHHDFLSH 385
               PVT+ G  C   DVLA +VP+ + +R GD +A  + GAY     HH   S+
Sbjct: 354 XXXXPVTVVGRHCEAGDVLAEDVPLPEDVRAGDLLAVPVTGAY-----HHALASN 403


>DCDA_MYCTU RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 447

 Score = 77.8 bits (190), Expect = 2e-16
 Identities = 98/362 (27%), Positives = 155/362 (42%), Gaps = 47/362 (12%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP---IAFGGPGKTDAELE 102
           ++YA KA   + V R +       +V + GE+     + A  P   I   G  K+ +EL 
Sbjct: 67  VHYAAKAFLCSEVARWISEEGLCLDVCTGGEL--AVALHASFPPERITLHGNNKSVSELT 124

Query: 103 GALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGA---TQ 159
            A++ GVG I V+S  ++ RLDA+A   G   DVL+R     G+   T +    A    +
Sbjct: 125 AAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRL--TVGVEAHTHEFISTAHEDQK 182

Query: 160 FGIDEALLPDVLAQSRTM--PNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLH 217
           FG+  A    + A  R     ++R+VGLH H GS   D D       R I L   LRD+ 
Sbjct: 183 FGLSVASGAAMAAVRRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGL---LRDVV 239

Query: 218 G-------LTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETA-----PSTRIVF 265
           G         +  +++GGG+GI Y   +           L  ++ + +     P+ ++V 
Sbjct: 240 GEFGPEKTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVV 299

Query: 266 ECGRFISAGCGCYVAEVIDLK------RNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLP 319
           E GR I+      + EV  +K        H ++ +V  G + + R             L 
Sbjct: 300 EPGRAIAGPGTITLYEVGTVKDVDVSATAHRRYVSVDGGMSDNIR-----------TALY 348

Query: 320 NDHWDYPFPRPVVERQPV--TLCGELCTPKDVLAREVPV-DRLRVGDRIAFTMAGAYGWH 376
              +D      V +  PV   L G+ C   D++ R+  V D +R GD +A    GAY + 
Sbjct: 349 GAQYDVRLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDDIRPGDLVAVAATGAYCYS 408

Query: 377 IS 378
           +S
Sbjct: 409 LS 410


>DCDA_MYCBO RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 447

 Score = 77.8 bits (190), Expect = 2e-16
 Identities = 98/362 (27%), Positives = 155/362 (42%), Gaps = 47/362 (12%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP---IAFGGPGKTDAELE 102
           ++YA KA   + V R +       +V + GE+     + A  P   I   G  K+ +EL 
Sbjct: 67  VHYAAKAFLCSEVARWISEEGLCLDVCTGGEL--AVALHASFPPERITLHGNNKSVSELT 124

Query: 103 GALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGA---TQ 159
            A++ GVG I V+S  ++ RLDA+A   G   DVL+R     G+   T +    A    +
Sbjct: 125 AAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRL--TVGVEAHTHEFISTAHEDQK 182

Query: 160 FGIDEALLPDVLAQSRTM--PNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLH 217
           FG+  A    + A  R     ++R+VGLH H GS   D D       R I L   LRD+ 
Sbjct: 183 FGLSVASGAAMAAVRRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGL---LRDVV 239

Query: 218 G-------LTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETA-----PSTRIVF 265
           G         +  +++GGG+GI Y   +           L  ++ + +     P+ ++V 
Sbjct: 240 GEFGPEKTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVV 299

Query: 266 ECGRFISAGCGCYVAEVIDLK------RNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLP 319
           E GR I+      + EV  +K        H ++ +V  G + + R             L 
Sbjct: 300 EPGRAIAGPGTITLYEVGTVKDVDVSATAHRRYVSVDGGMSDNIR-----------TALY 348

Query: 320 NDHWDYPFPRPVVERQPV--TLCGELCTPKDVLAREVPV-DRLRVGDRIAFTMAGAYGWH 376
              +D      V +  PV   L G+ C   D++ R+  V D +R GD +A    GAY + 
Sbjct: 349 GAQYDVRLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDDIRPGDLVAVAATGAYCYS 408

Query: 377 IS 378
           +S
Sbjct: 409 LS 410


>DCLO_SELRU RecName: Full=Lysine/ornithine decarboxylase;       
           Short=LDC;         EC=4.1.1.18;         EC=4.1.1.17;
          Length = 393

 Score = 76.6 bits (187), Expect = 3e-16
 Identities = 86/346 (24%), Positives = 142/346 (41%), Gaps = 51/346 (14%)

Query: 43  QCALYYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAE 100
           +  ++YA+KAN    +L  L G+   F+VAS GE+E +   GVD    I +  P K    
Sbjct: 43  RAGVFYAMKANPTPEILSLLAGLGSHFDVASAGEMEILHELGVDGSQMI-YANPVKDARG 101

Query: 101 LEGALRLGVGLIHVESTLQLSRL-------DAVARRQGRCADVLLRANPAYGLPGATLQM 153
           L+ A    V     +   ++ ++       D + R   R    L+  N  +G P      
Sbjct: 102 LKAAADYNVRRFTFDDPSEIDKMAKAVPGADVLVRIAVRNNKALVDLNTKFGAP------ 155

Query: 154 GGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRL 213
                   ++EAL  D+L  ++    +  +G+  H GS SL      A  +  + +A+RL
Sbjct: 156 --------VEEAL--DLLKAAQD-AGLHAMGICFHVGSQSLST----AAYEEALLVARRL 200

Query: 214 RD---LHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRF 270
            D     G+ L  L++GGG  +       + D       +   +    P T +  E GR+
Sbjct: 201 FDEAEEMGMHLTDLDIGGGFPVP-DAKGLNVDLAAMMEAINKQIDRLFPDTAVWTEPGRY 259

Query: 271 ISAGCGCYVAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYP---F 327
           +       V  VI  K   ++ + +L  G +             F  +  DHW YP   F
Sbjct: 260 MCGTAVNLVTSVIGTKTRGEQPWYILDEGIYGC-----------FSGIMYDHWTYPLHCF 308

Query: 328 PRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
            +    ++P T  G  C   DVL R+     L++GD++  T  G+Y
Sbjct: 309 GKG--NKKPSTFGGPSCDGIDVLYRDFMAPELKIGDKVLVTEMGSY 352


>DCDA_MYCLE RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 472

 Score = 75.9 bits (185), Expect = 6e-16
 Identities = 95/368 (25%), Positives = 156/368 (42%), Gaps = 42/368 (11%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP---IAFGGPGKTDAELE 102
           ++YA KA     + R +       +V S GE+     + A  P   I+  G  K+ AEL+
Sbjct: 92  VHYAAKAFLCTEIARWIDEEGLSLDVCSGGEL--AVALHASFPPERISLHGNNKSVAELK 149

Query: 103 GALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGA---TQ 159
            A++ GVG I ++ST ++ RLDA+A   G   DVL+R     G+   T +    A    +
Sbjct: 150 DAVKAGVGYIVLDSTTEIERLDAIAGEAGIVQDVLVRL--TVGVEAHTHEFIATAHEDQK 207

Query: 160 FGIDEALLPDVLAQSRTM--PNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLH 217
           FG+  A    + A  R     N+R+VGLH H GS   D         R I L   L D+ 
Sbjct: 208 FGLSVASGAAMAAVRRVFATDNLRLVGLHSHIGSQIFDVAGFELAAHRVIGL---LCDIV 264

Query: 218 G-------LTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETA-----PSTRIVF 265
           G         L  +++GGG+GI Y   +           L A++   +     P  +++ 
Sbjct: 265 GEFDPEKTAQLSIVDLGGGLGISYLPDDDPPPIFELAAKLGAIVSNESAAVGLPVPKLMV 324

Query: 266 ECGRFISAGCGCYVAEV-----IDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPN 320
           E GR I+      + EV     +D+     + +  + GG         +   +  +++  
Sbjct: 325 EPGRAIAGPGTITLYEVGTIKDVDVSATAHRRYVSIDGGMSDNIRTALYDAQYDVRLVSR 384

Query: 321 DHWDYPFPRPVVERQPVTLCGELCTPKDVLAREVPV-DRLRVGDRIAFTMAGAYGWHI-S 378
              D P         P ++ G+ C   D++ R+  V D L+ GD +     GAY + + S
Sbjct: 385 TS-DAP-------AAPASIVGKHCESGDIVVRDTWVPDDLKPGDLVGVAATGAYCYSLSS 436

Query: 379 HHDFLSHP 386
            ++ L  P
Sbjct: 437 RYNMLGRP 444


>DCDA_BACSU RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 439

 Score = 75.1 bits (183), Expect = 1e-15
 Identities = 82/359 (22%), Positives = 144/359 (40%), Gaps = 25/359 (6%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERV--RGVDAEVPIAFGGPGKTDAELEGAL 105
           YA KA S   +++         +V S GE+      G  AE  I F G  K+  EL  AL
Sbjct: 63  YASKAFSSVAMIQLAEEEGLSLDVVSGGELYTAVAAGFPAE-RIHFHGNNKSREELRMAL 121

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT---LQMGGGATQFGI 162
              +G I V++  +++ L+ + +  G   DVLLR  P  G+   T   +  G   ++FG 
Sbjct: 122 EHRIGCIVVDNFYEIALLEDLCKETGHSIDVLLRITP--GVEAHTHDYITTGQEDSKFGF 179

Query: 163 D--EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLT 220
           D         + Q     +++++G+H H GS   D    +   ++        RD +   
Sbjct: 180 DLHNGQTERAIEQVLQSEHIQLLGVHCHIGSQIFDTAGFVLAAEKIFKKLDEWRDSYSFV 239

Query: 221 LEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS-----TRIVFECGRFISAGC 275
            + LN+GGG GI Y   +       +   +   ++E A         I  E GR +    
Sbjct: 240 SKVLNLGGGFGIRYTEDDEPLHATEYVEKIIEAVKENASRYGFDIPEIWIEPGRSLVGDA 299

Query: 276 GCYVAEVIDLKRNHD-KWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVER 334
           G  +  V   K     + +  + GG +         +  P                    
Sbjct: 300 GTTLYTVGSQKEVPGVRQYVAVDGGMN--------DNIRPXXXXXXXXXXXXNRIGEAHD 351

Query: 335 QPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFI 393
           + V++ G+ C   D+L  ++ +  ++ GD +A    GAYG+ ++ +++   P P  VF+
Sbjct: 352 KTVSIAGKCCESGDMLIWDIDLPEVKEGDLLAVFCTGAYGYSMA-NNYNRIPRPAVVFV 409


>DCOR_PANRE RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 435

 Score = 74.3 bits (181), Expect = 2e-15
 Identities = 90/349 (25%), Positives = 141/349 (40%), Gaps = 47/349 (13%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRL 107
           YAVK N D  +LR L  +  GF+ AS  EIE+V G+     I +  P KT   +  A   
Sbjct: 73  YAVKCNDDKVLLRTLADLGMGFDCASKAEIEKVIGLVGPEKIVYANPCKTRGFIAHAEAA 132

Query: 108 GVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGID-EAL 166
           GV  +  +S  +L+++      +   AD  L    +   P A  Q+G    +FG D E +
Sbjct: 133 GVKRMTFDSVEELTKI------KQNHADPSLILRISVSDPTAQCQLG---IKFGCDPETV 183

Query: 167 LPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLH---GLTLEW 223
            P +L ++  M  + V+G+  H GS   +  T    ++     A+ L DL    GL++  
Sbjct: 184 APKLLRKAADM-GMNVIGISFHVGSGCNEPATFRTALE----YARGLFDLGISLGLSMTL 238

Query: 224 LNVGGGI-GIDYQNPERHFDWDRFCHGLAALLRE-----TAPSTRIVFECGRFISAGCGC 277
           L++GGG  G+D      H   D     +   L E     + P   ++ E GR+ +     
Sbjct: 239 LDIGGGFPGVD----TAHISLDACAAVINPALEELFPLDSCPDVEVIAEPGRYFACAAVS 294

Query: 278 YVAEVIDLKR-------------NHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWD 324
               VI   +             N D +   +  G +       + H  P + +P    D
Sbjct: 295 VTTNVIASVKVPASRITEKADDVNRDGYMYYMNDGVYGSFNCKLFDHYQP-RGMPLAEHD 353

Query: 325 YPFPRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
              P     R PV + G  C   D +     + RL  GD + +   GAY
Sbjct: 354 ADEP-----RFPVCVWGPTCDGLDQVEESSVMPRLYEGDWLYYPDMGAY 397


>DCOR_DICDI RecName: Full=Probable ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 461

 Score = 74.3 bits (181), Expect = 2e-15
 Identities = 88/347 (25%), Positives = 155/347 (44%), Gaps = 47/347 (13%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           YYAVK N    VLR L  +   ++ AS  EIE V   GVD    I +  P K  + L+ A
Sbjct: 112 YYAVKCNPTVGVLRVLDALGTNYDCASRTEIESVLNLGVDPS-RIIYANPCKQISALKFA 170

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
               V L+  ++  +L +++         A+++LR  P      + ++ G   ++FG+  
Sbjct: 171 RAHNVKLMTFDNLSELEKIEKFFPE----AELVLRIAPDDSK--SVMRFG---SKFGVHI 221

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTH---LALIDRHIALAKRLRDLHGLTL 221
               D+L  ++ M N++VVG+  H GS     D++   L ++     +AK+L     + L
Sbjct: 222 DDCNDLLEMAKEM-NLKVVGVSFHVGSGCQSGDSYADALIMVKSVFDMAKKLN----MEL 276

Query: 222 EWLNVGGGI-GIDYQNPERHFDWDRFCHGLAALLRET-----APSTRIVFECGRFISAGC 275
             ++VGGG  G D          D   +    ++RE      +P+ +I+ E GR+ +A  
Sbjct: 277 TLVDVGGGFTGSD----------DEKFNAFTKVIREKTAELFSPNVKIIAEPGRYFAAQS 326

Query: 276 GCYVAEVID---LKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVV 332
                 VI    +K+  ++     R  +++ R    +  +  +    N  +DY    P++
Sbjct: 327 HTLAVTVISKRSIKQEDNRQHP--RRTSNNMRQYNYYLADGVYGSFNNTKFDYAKVEPLL 384

Query: 333 ------ERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
                 +  P TL G  C   DV+ ++  +  L++GD + F   GAY
Sbjct: 385 LKPSTKQPTPCTLFGPTCDSIDVVLKDTQIPELKIGDWLYFQDMGAY 431


>DCOR_CAEEL RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 422

 Score = 73.9 bits (180), Expect = 2e-15
 Identities = 83/345 (24%), Positives = 148/345 (42%), Gaps = 41/345 (11%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERV--RGVDAEVPIAFGGPGKTDAELEGA 104
           +YAVK N+D  ++R L  +  GF+ AS  EI+ V   GV AE  I +  P KT + +  A
Sbjct: 67  FYAVKCNTDLVLIRILASLGCGFDCASKDEIDIVMGTGVSAE-RIIYANPCKTRSFIAHA 125

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
           +   V ++  ++  +L ++  +       A+++LR   A   P AT  +     +FG D 
Sbjct: 126 MDRDVKMMTFDNPEELLKIAKLHPN----AEMILRI--AVSDPTATCPLN---LKFGADP 176

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
            +    L ++ +   + VVG+  H GS   DA  +   + +H      + +  G  ++ +
Sbjct: 177 IIAAPQLLKTASEEGINVVGISFHVGSGCNDASAYRNAL-QHAKNLCEIGEGLGFKMDII 235

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPST--RIVFECGRFISAGCGCYVAEV 282
           ++GGG    +   E H  +++    +   L E  P T  R++ E GRF +AG    VA +
Sbjct: 236 DMGGG----FPGAEHHNPFEKIAETIRDALDEFFPDTNKRLIAEPGRFFAAGPFSLVANI 291

Query: 283 IDLKR--------------NHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFP 328
           I                  +H   + +  G    F   + + H HP            F 
Sbjct: 292 IHATEVPASKITKDPKDCADHGYMYYINDGVYGSFNC-ILFDHAHPI-------GSPLFD 343

Query: 329 RPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
               E+   T+ G  C   D++  +  + ++ VG+ + +   GAY
Sbjct: 344 TDRNEKFMSTIWGPTCDSLDLVEDKKLMPKMNVGEWLYYPDMGAY 388


>DCDA_BACHD RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 439

 Score = 73.2 bits (178), Expect = 4e-15
 Identities = 88/369 (23%), Positives = 156/369 (42%), Gaps = 35/369 (9%)

Query: 43  QCALYYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAE 100
           Q  + YA KA S   + +    +    +V S GE+   +  GV  E  I F G  K+ AE
Sbjct: 58  QAQVAYASKAFSCIAMFQLAEELGLSLDVVSGGELYTAQQAGVSME-RIHFHGNNKSRAE 116

Query: 101 LEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT---LQMGGGA 157
           +E A+  G+G   V++  +L  L  +  ++   A++LLR  P  G+   T   +  G   
Sbjct: 117 IEMAVEAGIGCFVVDNFYELDLLADICEQKRATANILLRITP--GVEAHTHDYISTGQED 174

Query: 158 TQFGIDEALLPDVLAQSRTMP--NVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRD 215
           ++FG D       LA  + +   ++ ++G+H H GS   +    +  +++        R+
Sbjct: 175 SKFGFDLVSGQATLAVKKALAVDSIHLLGVHSHIGSQIFETTGFVMAVEKIFEHLVTWRE 234

Query: 216 LHGLTLEWLNVGGGIGIDY---QNPERHFDWDRFCHGLAALLRETA----PSTRIVFECG 268
            HG     LN+GGG GI Y     P    D+ +    + A+ ++ A        I  E G
Sbjct: 235 DHGFEPSVLNLGGGFGIRYIEGDTPRPVGDYVK--EMIRAVKQQIAEHEMSMPEIWIEPG 292

Query: 269 RFISAGCGCYVAEVIDLKR-NHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPF 327
           R +    G  +  +   K   + + +  + GG      P  +Q  +   +          
Sbjct: 293 RSLVGDAGTTLYTIGSRKEIPNVRHYLSVDGGMSDNLRPALYQAEYEGALANR------- 345

Query: 328 PRPVVERQPV---TLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLS 384
               V  QPV   ++ G+ C   D+L  ++P+      D +A    GAYG+ ++ +++  
Sbjct: 346 ----VNEQPVGMFSVAGKCCESGDMLIWDLPLPEANHEDILAVFCTGAYGYSMA-NNYNR 400

Query: 385 HPHPERVFI 393
            P P  VF+
Sbjct: 401 IPRPPVVFV 409


>DCDA_STRCO RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 440

 Score = 70.9 bits (172), Expect = 2e-14
 Identities = 97/365 (26%), Positives = 142/365 (38%), Gaps = 34/365 (9%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEV-----PIAFGGPGKTDAELE 102
           YA KA S+  +LR +       +  S GEIER       V     PI F       + L 
Sbjct: 58  YAQKACSNLHILRLMREEGVHVDAVSEGEIERALAAGYRVGGDDEPIVFTADLLNRSTLR 117

Query: 103 GALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT-LQMGGGATQFG 161
             + LG+  ++  S   L ++   A        V +R NP +G   +     GG  ++ G
Sbjct: 118 RVVELGIP-VNAGSPQMLDQVGRAAPGH----PVWIRINPGFGHGHSRKTNTGGEHSKHG 172

Query: 162 IDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTL 221
           I    L + LA       + +VGLH+H GS  +D   HL  +     + K++R + G  +
Sbjct: 173 IWHEHLEESLALV-DRHGLDLVGLHMHIGSG-VDYG-HLESVCE--TMVKQVR-MAGRDI 226

Query: 222 EWLNVGGGIGIDYQNPERHFDWDRFCH----GLAALLRETAPSTRIVFECGRFISAGCGC 277
             ++ GGG+ + Y   +   D DR+          L+ E     R+  E GRF       
Sbjct: 227 RAISAGGGLSVPYTPGDPEIDTDRYFELWDAARRELVSELGHPVRLEIEPGRFXXXXXXX 286

Query: 278 YVAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPV 337
              EV   K     +F ++  G +    P  +  NH   VL  D      PR    R  V
Sbjct: 287 XXXEVRAQKPVGSNYFVLVDAGFNDLMRPAMYGSNHRVSVLDAD----GAPRASDARDTV 342

Query: 338 TLCGELCTPKDVLAR-------EVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPER 390
            L G LC   DV  +            R  VGD + F   GAYG  +S   + S P    
Sbjct: 343 -LAGPLCESGDVFTQXXXXXXXXXXXXRTDVGDLVVFHDTGAYGASMS-STYNSRPLIPE 400

Query: 391 VFIGG 395
           V + G
Sbjct: 401 VLVDG 405


>DCDA_COREF RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 459

 Score = 69.3 bits (168), Expect = 5e-14
 Identities = 85/351 (24%), Positives = 136/351 (38%), Gaps = 29/351 (8%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAELEGA 104
           ++YA KA     V R +       ++AS  E+      D     I   G  K  + L   
Sbjct: 84  VHYASKAFLSKTVARWVDEEGLSLDIASENELGIALAADFPGERITAHGNNKDASFLRAC 143

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQ----- 159
           +R  +G + ++S  +L  LD +A  +G+   VL+R  P  G+   T +    + +     
Sbjct: 144 VRNNLGHVVLDSAQELELLDYIAAGEGKVQPVLIRVKP--GIEAHTHEFIATSHEDQKFG 201

Query: 160 FGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGL 219
           F +                N+ +VGLH H GS   DA       +R + L  R+ D  G+
Sbjct: 202 FSLXXXXXXXXXXXXXXXENLELVGLHCHVGSQVFDAQGFSLAAERVLELYSRIHDELGV 261

Query: 220 TLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETA-----PSTRIVFECGRFISAG 274
           TL  L++GGG GI Y   E   +     H L   + +TA      +  ++ E GR I+  
Sbjct: 262 TLAELDLGGGYGIAYTAAEEPLNVVEVAHDLLTAVGKTAAELGIEAPTVLVEPGRAIAGP 321

Query: 275 CGCYVAEV-----IDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPR 329
               V EV     +D+     + +  + GG      P  +   +  +V+        F  
Sbjct: 322 STVTVYEVGTIKDVDVDDETTRRYISVDGGMSDNIRPALYGAEYDARVVSR------FTE 375

Query: 330 PVVERQPVTLCGELCTPKDVLAREV--PVDRLRVGDRIAFTMAGAYGWHIS 378
              E     + G  C   D+L  E   P D +  GD       GAY + +S
Sbjct: 376 G--ETTNTRVVGSHCESGDILINEATYPSD-IHTGDXXXXXXTGAYCYAMS 423


>DCDA_BACMT RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 432

 Score = 69.3 bits (168), Expect = 5e-14
 Identities = 83/359 (23%), Positives = 149/359 (41%), Gaps = 25/359 (6%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEV-PIAFGGPGKTDAELEGALR 106
           YA KA S   +++         +V S GE+         V  I F G  K+ AELE AL 
Sbjct: 63  YASKAFSTVAMIQLAEEEGLSLDVVSGGELYTALVAGFPVHKIHFHGNNKSRAELEMALE 122

Query: 107 LGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT---LQMGGGATQFGID 163
             +G I V++  +L  +D++   +    ++LLR  P  G+   T   +  G   ++FG D
Sbjct: 123 HQIGCIVVDNFHELDLIDSICSEKNVKTNILLRVTP--GIEAHTHDYILTGQEDSKFGFD 180

Query: 164 --EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTL 221
                    L  +     V V+G+H H GS   D    +    +     K  +D      
Sbjct: 181 LQNGQAEKALQIALNSNFVEVLGVHCHIGSQIFDTTGFVLAARKIFEKLKEWKDRLSYEP 240

Query: 222 EWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS-----TRIVFECGRFISAGCG 276
           + LN+GGG GI Y   +      ++   +   +++   +       I  E GR +    G
Sbjct: 241 KVLNLGGGFGIRYTEEDDPIPASQYVKEIINEVKKQVSAYSMKMPEIWIEPGRSLVGDAG 300

Query: 277 CYVAEVIDLKR-NHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVER- 334
             + ++   K   + + +  + GG      P  +   +   VL N        +P+ +  
Sbjct: 301 TTLYQIGSRKDVPNVRHYVAVDGGMSDNIRPALYNAKYE-AVLAN--------KPLAKAD 351

Query: 335 QPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFI 393
           + V++ G+ C   D+L  ++P+ +    D +A    GAYG+ ++ +++   P P  VF+
Sbjct: 352 ETVSIAGKCCESGDMLIWDLPLPKADSDDILAVFCTGAYGYSMA-NNYNRIPRPAVVFV 409


>DCDA_ECOLI RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 420

 Score = 68.9 bits (167), Expect = 7e-14
 Identities = 95/370 (25%), Positives = 156/370 (42%), Gaps = 40/370 (10%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIERV--RGVDAEV---PIAFGGPGKTDAELE 102
           +A KA S+  +LR +       +  S GEIER    G + +     I F       A LE
Sbjct: 51  FAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLE 110

Query: 103 --GALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT-LQMGGGATQ 159
               L++ V    V+   QL ++    R       V LR NP +G   +     GG  ++
Sbjct: 111 RVSELQIPVNAGSVDMLDQLGQVSPGHR-------VWLRVNPGFGHGHSQKTNTGGENSK 163

Query: 160 FGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGL 219
            GI    LP  L   +   ++++VG+H+H GS    A  HL  +    A+ +++ +  G 
Sbjct: 164 HGIWYTDLPAALDVIQRH-HLQLVGIHMHIGSGVDYA--HLEQVCG--AMVRQVIEF-GQ 217

Query: 220 TLEWLNVGGGIGIDYQNPERHFDWDRFCHGL-----AALLRETAPSTRIVFECGRFISAG 274
            L+ ++ GGG+ + YQ  E   D + + +GL       + R      ++  E GRF+ A 
Sbjct: 218 DLQAISAGGGLSVPYQQGEEAVDTEHY-YGLWNAAREQIARHLGHPVKLEIEPGRFLVAQ 276

Query: 275 CGCYVAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVER 334
            G  + +V  +K+   + F ++  G +    P  +   H    L  D        P VE 
Sbjct: 277 SGVLITQVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEH-APTVE- 334

Query: 335 QPVTLCGELCTPKDVLAREV-------PVDRLRVGDRIAFTMAGAYGWHISHHDFLSHP- 386
               + G LC   DV  ++         +  ++ GD +     GAYG  +S  ++ S P 
Sbjct: 335 --TVVAGPLCESGDVFTQQEGGNVETRALPEVKAGDYLVLHDTGAYGASMS-SNYNSRPL 391

Query: 387 HPERVFIGGQ 396
            PE +F  GQ
Sbjct: 392 LPEVLFDNGQ 401


>DCDA_MYCS2 RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 474

 Score = 67.4 bits (163), Expect = 2e-13
 Identities = 95/369 (25%), Positives = 156/369 (42%), Gaps = 44/369 (11%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP---IAFGGPGKTDAELE 102
           ++YA KA   + + R +       +VA+ GE+     + A  P   I   G  K+ AEL 
Sbjct: 92  VHYAAKAFLCSEIARWVDEEGLSLDVATGGEL--AVALHAGFPASRITVHGNNKSVAELT 149

Query: 103 GALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGA---TQ 159
            A++ GVG + ++S +++ RLD +A   G   DVL+R     G+   T +    A    +
Sbjct: 150 AAVQAGVGHVVLDSEIEIERLDQIAGAAGVVQDVLVRV--TVGVEAHTHEFISTAHEDQK 207

Query: 160 FGIDEALLPDVLAQSRTM--PNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLH 217
           FG+  A    + A  R     N+R+VGLH H GS   D         R I L + +    
Sbjct: 208 FGLSLATGAAMNAIRRVFATDNLRLVGLHSHIGSQIFDVAGFEIAAHRVIGLLRDVVAEF 267

Query: 218 GL----TLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETA-----PSTRIVFECG 268
           G+     +  +++GGG+GI Y   +           L  ++R  +     P+ ++V E G
Sbjct: 268 GVEKTSQMSIVDLGGGLGISYLPHDDPPPMKELADKLLEIVRTESAAVGLPTPKLVVEPG 327

Query: 269 RFISAGCGCY-------VAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPND 321
           R I AG G         V +V   +  H ++ +V  G + + R             L   
Sbjct: 328 RAI-AGPGTITLYEVGTVKDVAVSQTAHRRYVSVDGGMSDNIRTS-----------LYAA 375

Query: 322 HWDYPFPRPVVERQP--VTLCGELCTPKDVLAREVPV-DRLRVGDRIAFTMAGAYGWHI- 377
            +D      V +  P    + G+ C   D++ R+  V D +  GD I     GAY + + 
Sbjct: 376 QYDARLVSRVSDAPPALARIVGKHCESGDIVVRDTWVSDDIAPGDLIGVAATGAYCYSMS 435

Query: 378 SHHDFLSHP 386
           S ++ L  P
Sbjct: 436 SRYNLLCRP 444


>DCDA_THEMA RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 386

 Score = 66.2 bits (160), Expect = 5e-13
 Identities = 80/349 (22%), Positives = 138/349 (39%), Gaps = 32/349 (9%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEI--ERVRGVDAEVPIAFGGPGKTDAELEGAL 105
           +AVKAN++  +L+ L     G +V + GE+   ++ GV +   + + G GK+  ++E  L
Sbjct: 43  FAVKANNNPVLLKILREEGFGMDVVTKGELLAAKLAGVPSHT-VVWNGNGKSRDQMEHFL 101

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT-LQMGGGATQFGIDE 164
           R  V +++V+S      ++          +  +R NP         +  G    +FGI  
Sbjct: 102 REDVRIVNVDS---FEEMEIWRELNPEGVEYFIRVNPEVDAKTHPHISTGLKKHKFGIPL 158

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
             L   + + R+M N+R  GLHVH GS     +  +    + +  ++R            
Sbjct: 159 EDLDSFMERFRSM-NIR--GLHVHIGSQITRVEPFVEAFSKVVRASERYXXXXXXXXXXX 215

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVID 284
                            D   +   +   L+      R++ E GR+I A  G        
Sbjct: 216 XXXXXXXX--------LDLSSYREKVVPDLKRFK---RVIVEIGRYIVAPSGYXXXXXXX 264

Query: 285 LKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELC 344
               H+K F V+ GG +    P  +   H   VL              +     + G LC
Sbjct: 265 XXXXHNKAFVVVDGGMNVLIRPALYSAYHRIFVLGKQG----------KEMRADVVGPLC 314

Query: 345 TPKDVLAREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFI 393
              DV+A +  +  +  GD IA   AGAYG+ +S +++ S   P  V +
Sbjct: 315 ESGDVIAYDRELPEVEPGDIIAVENAGAYGYTMS-NNYNSTTRPAEVLV 362


>TABA_PSESZ RecName: Full=Protein tabA;
          Length = 420

 Score = 65.9 bits (159), Expect = 6e-13
 Identities = 68/246 (27%), Positives = 116/246 (47%), Gaps = 21/246 (8%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEI---ERV--RGVDAEVPIAFGGPGKTDAEL 101
           Y+AVKA     +L  LL    G + +S  E+   ER+  RG D    I F     + +E 
Sbjct: 53  YFAVKALPTPAILSLLLKEGSGLDCSSPVELMLAERLGARGDD----IVFTSNNTSLSEY 108

Query: 102 EGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGA-TQF 160
           + AL+ G  L+  +    L ++ A+         V  R +P +G+   + QMG    ++F
Sbjct: 109 QMALQAGA-LVTFDDRSMLEQVIALPDI------VAFRVSP-HGVIARSSQMGNAQQSKF 160

Query: 161 GIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLT 220
           GI EA L     ++      R  G+H    +N L  +  +    + I +  R+    G+ 
Sbjct: 161 GIPEAELVQSYREAWDR-GARRFGIHGMMCANELSLEAAVQAGVQVIEVGARVAREAGIE 219

Query: 221 LEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAP--STRIVFECGRFISAGCGCY 278
           LE++N+GGG+GI Y+  ++  D   +   L   L++  P  + +++ E GR+IS   G  
Sbjct: 220 LEYINIGGGLGIPYRIDDQALDLTAYADALKRALKQAFPHNTPKLLMELGRYISGPHGVL 279

Query: 279 VAEVID 284
           V+ VI+
Sbjct: 280 VSRVIN 285


>DCOR2_XENLA RecName: Full=Ornithine decarboxylase 2;       
           Short=ODC 2;         Short=xODC2;         EC=4.1.1.17;
          Length = 456

 Score = 65.1 bits (157), Expect = 1e-12
 Identities = 81/337 (24%), Positives = 137/337 (40%), Gaps = 24/337 (7%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVD-AEVPIAFGGPGKTDAELEGAL 105
           +YAVK NS   V++ L  +  GF+ AS  EIE V+ V  A   I +  P K  ++++ A 
Sbjct: 64  FYAVKCNSSKGVVKILAELGAGFDCASKTEIELVQDVGVAPERIIYANPCKQISQIKYAA 123

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEA 165
           + GV ++  ++ ++LS++     R    A ++LR         A L     + +FG    
Sbjct: 124 KNGVQMMTFDNEVELSKVS----RSHPNARMVLRIATDDSKSSARL-----SVKFGAPLK 174

Query: 166 LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLN 225
               +L  ++ + +V V+G+  H GS   D+  +   I     L   +    G  +  L+
Sbjct: 175 SCRRLLEMAKNL-SVDVIGVSFHVGSGCTDSKAYTQAIS-DARLVFEMASEFGYKMWLLD 232

Query: 226 VGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVIDL 285
           +GGG      +  R  +     +    +    +   +I+ E GR+  A        VI  
Sbjct: 233 IGGGFPGTEDSKIRFEEIAGVINPALDMYFPESSDVQIIAEPGRYYVASAFSLAVNVIAK 292

Query: 286 KR-NHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQP-------- 336
           K   H          +      V+      F  L  DH     P+P++ ++P        
Sbjct: 293 KEVEHSVSDDEENESSKSIMYYVNDGVYGSFNCLVFDH---AHPKPILHKKPSPDQPLYT 349

Query: 337 VTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
            +L G  C   D +A  V +  L VGD + F   GAY
Sbjct: 350 SSLWGPTCDGLDQIAERVQLPELHVGDWLLFENMGAY 386


>DCOR_TRYBB RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 423

 Score = 64.3 bits (155), Expect = 2e-12
 Identities = 87/347 (25%), Positives = 140/347 (40%), Gaps = 42/347 (12%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDA-EVPIAFGGPGKTDAELEGAL 105
           +YAVK N D  VL  L  +  GF+ AS  EI+RVRG+      I +  P K  + +  A 
Sbjct: 63  FYAVKCNDDWRVLGTLAALGTGFDCASNTEIQRVRGIGVPPEKIIYANPCKQISHIRYAR 122

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEA 165
             GV ++  +    +  L+ VA+   + A ++LR +    L    L     + +FG    
Sbjct: 123 DSGVDVMTFDC---VDELEKVAKTHPK-AKMVLRISTDDSLARCRL-----SVKFGAKVE 173

Query: 166 LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLN 225
               +L Q++ + N+ V G+  H GS S DA T    I     +     +L G  +  L+
Sbjct: 174 DCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVFDMGTEL-GFNMHILD 231

Query: 226 VGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTR--IVFECGRFISAGCGCYVAEVI 283
           +GGG       P +  +     +   AL +   P  +  IV E GR+  A        VI
Sbjct: 232 IGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKLTIVAEPGRYYVASAFTLAVNVI 289

Query: 284 DLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDH---------WDYPFPRPVVER 334
             K        V   G H      +  +   F    ND          +D+   RP+ +R
Sbjct: 290 AKKVTPGVQTDV---GAH------AESNAQSFMYYVNDGVYGSFNCILYDHAVVRPLPQR 340

Query: 335 QPV--------TLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
           +P+        ++ G  C   D +     +  ++VG+ + F   GAY
Sbjct: 341 EPIPNEKLYPSSVWGPTCDGLDQIVERYYLPEMQVGEWLLFEDMGAY 387


>DCOR_MOUSE RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 461

 Score = 62.4 bits (150), Expect = 7e-12
 Identities = 74/345 (21%), Positives = 135/345 (39%), Gaps = 38/345 (11%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAELEGAL 105
           +YAVK N    ++  L  +  GF+ AS  EI+ V+G+      + +  P K  ++++ A 
Sbjct: 65  FYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAA 124

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEA 165
             GV ++  +S ++L +   VAR   + A ++LR           L +  GAT       
Sbjct: 125 SNGVQMMTFDSEIELMK---VARAHPK-AKLVLRIATDDSKAVCRLSVKFGAT------L 174

Query: 166 LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLN 225
               +L +     N+ V+G+  H GS   D DT +  +     +     ++ G ++  L+
Sbjct: 175 KTSRLLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMATEV-GFSMHLLD 233

Query: 226 VGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS---TRIVFECGRFISAGCGCYVAEV 282
           +GGG      + +    ++     +   L +  PS    RI+ E GR+  A        +
Sbjct: 234 IGGGFP---GSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNI 290

Query: 283 IDLK--------------RNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFP 328
           I  K               N   +   +  G +     + + H H   +L         P
Sbjct: 291 IAKKTVWKEQPGSDDEDESNEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKR------P 344

Query: 329 RPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
           +P  +    ++ G  C   D +     +  + VGD + F   GAY
Sbjct: 345 KPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAY 389


>DCOR_RAT RecName: Full=Ornithine decarboxylase;         Short=ODC; 
                  EC=4.1.1.17;
          Length = 461

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 76/347 (21%), Positives = 136/347 (39%), Gaps = 42/347 (12%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP---IAFGGPGKTDAELEG 103
           +YAVK N    ++  L  +  GF+ AS  EI+ V+G+   VP   I +  P K  ++++ 
Sbjct: 65  FYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLG--VPPERIIYANPCKQVSQIKY 122

Query: 104 ALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGID 163
           A   GV ++  +S ++L +   VAR   + A ++LR           L +  GAT     
Sbjct: 123 AASNGVQMMTFDSEIELMK---VARAHPK-AKLVLRIATDDSKAVCRLSVKFGAT----- 173

Query: 164 EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEW 223
                 +L +     N+ V+G+  H GS   D +T +  +     +     ++ G ++  
Sbjct: 174 -LKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMGTEV-GFSMYL 231

Query: 224 LNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS---TRIVFECGRFISAGCGCYVA 280
           L++GGG      + +    ++     +   L +  PS    RI+ E GR+  A       
Sbjct: 232 LDIGGGFP---GSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAV 288

Query: 281 EVIDLK--------------RNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYP 326
            +I  K               N       +  G +     + + H H   +L        
Sbjct: 289 NIIAKKTVWKEQTGSDDEDESNEQTLMYYVNDGVYGSFNCILYDHAHVKALLQKR----- 343

Query: 327 FPRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
            P+P  +    ++ G  C   D +     +  + VGD + F   GAY
Sbjct: 344 -PKPDEKYYSSSIWGPTCDGLDRIVERCSLPEMHVGDWMLFENMGAY 389


>DCOR_MUSPA RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 461

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 76/347 (21%), Positives = 136/347 (39%), Gaps = 42/347 (12%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP---IAFGGPGKTDAELEG 103
           +YAVK N    ++  L     GF+ AS  EI+ V+G+   VP   I +  P K  ++++ 
Sbjct: 65  FYAVKCNDSRAIVSTLAATGTGFDCASKTEIQLVQGLG--VPPERIIYANPCKQVSQIKY 122

Query: 104 ALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGID 163
           A   GV ++  +S ++L +   VAR   + A ++LR           L +  GAT     
Sbjct: 123 AASSGVQMMTFDSEIELMK---VARAHPK-AKLVLRIATDDSKAVCRLSVKFGAT----- 173

Query: 164 EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEW 223
                 +L +     N+ V+G+  H GS   D +T +  +     +     ++ G ++  
Sbjct: 174 -LKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMGTEV-GFSMYL 231

Query: 224 LNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS---TRIVFECGRFISAGCGCYVA 280
           L++GGG      + +    ++     +   L +  PS    RI+ E GR+  A       
Sbjct: 232 LDIGGGFP---GSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAV 288

Query: 281 EVIDLK--------------RNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYP 326
            +I  K               N   +   +  G +     + + H H   +L        
Sbjct: 289 NIIAKKTVWKEQPGSDDEDESNEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKR----- 343

Query: 327 FPRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
            P+P  +    ++ G  C   D +     +  + VGD + F   GAY
Sbjct: 344 -PKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAY 389


>DCOR_HUMAN RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 461

 Score = 56.2 bits (134), Expect = 5e-10
 Identities = 83/349 (23%), Positives = 143/349 (40%), Gaps = 46/349 (13%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +YAVK N    +++ L     GF+ AS  EI+ V+  GV  E  I +  P K  ++++ A
Sbjct: 65  FYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPE-RIIYANPCKQVSQIKYA 123

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
              GV ++  +S ++L +   VAR   + A ++LR           L +  GAT      
Sbjct: 124 ANNGVQMMTFDSEVELMK---VARAHPK-AKLVLRIATDDSKAVCRLSVKFGAT------ 173

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
                +L +     N+ VVG+  H GS   D +T +  I     +     ++ G ++  L
Sbjct: 174 LRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEV-GFSMYLL 232

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS---TRIVFECGRFISAGCGCYVAE 281
           ++GGG      + +    ++     +   L +  PS    RI+ E GR+       YVA 
Sbjct: 233 DIGGGFP---GSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRY-------YVAS 282

Query: 282 VIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDH---------WDYPFPRPVV 332
              L  N      VL+  T       S +    + V  ND          +D+   +P++
Sbjct: 283 AFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYV--NDGVYGSFNCILYDHAHVKPLL 340

Query: 333 ERQP--------VTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
           +++P         ++ G  C   D +     +  + VGD + F   GAY
Sbjct: 341 QKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAY 389


>DCDA_BUCBP RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 418

 Score = 56.2 bits (134), Expect = 5e-10
 Identities = 64/264 (24%), Positives = 114/264 (43%), Gaps = 40/264 (15%)

Query: 135 DVLLRANPAYGLPGAT-LQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNS 193
           ++ LR NP +G   +     GG  ++ GI +  L        T  N +++GLH+H GS  
Sbjct: 136 NIWLRINPKFGHGHSKKTNTGGENSKHGIWDINLAFPYI---TKYNFKLIGLHMHIGSG- 191

Query: 194 LDADTHL-----ALIDRHIALAKRLRDLHGLTLEWLNVGGGIGIDYQ------NPERHFD 242
           +D   HL     A+ID+ +    ++  +        + GGG+ + Y       N + +F 
Sbjct: 192 VDY-CHLKRVCKAMIDQVLQCKFKIHVI--------SAGGGLTVPYHCNDEPVNVKNYFF 242

Query: 243 -WDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVIDLKRNHDKWFAVLRGGTH 301
            W++    ++  L       R+  E GRF+ A  G  V+E+  +K+ +++ F ++  G +
Sbjct: 243 LWNKARKIISNYLNRPI---RLEIEPGRFLVAESGILVSEIRVIKKTNNRTFILVDSGFN 299

Query: 302 HFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVLAREVPVD---- 357
               P  +   H   V+P D     +   +       +CG LC   DV  +    D    
Sbjct: 300 DLIRPAMYGSYHHISVIPRDGRCVNYDDTI----EAVVCGPLCESGDVFTQNEYGDIKTR 355

Query: 358 ---RLRVGDRIAFTMAGAYGWHIS 378
               +++GD + F   GAYG  +S
Sbjct: 356 ILPNVQIGDFLVFHDTGAYGASMS 379


>DCOR_NEUCR RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 484

 Score = 55.1 bits (131), Expect = 1e-09
 Identities = 63/243 (25%), Positives = 110/243 (45%), Gaps = 26/243 (10%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERV--RGVDAEVPIAFGGPGKTDAELEGA 104
           +YAVK + D  +L+ L  +  GF+ AS  EIE+V   GVD    I +  P KT++ L   
Sbjct: 110 FYAVKCHPDERLLQLLAALGTGFDCASKAEIEQVLRMGVDPS-RIIYAQPCKTNSYLRYV 168

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
            + GV  +  ++  +L ++     R    A++ LR      L   +  +   + +FG   
Sbjct: 169 AQQGVRQMTFDNADELRKI----ARLYPDAELFLRI-----LTDDSSSLCRFSMKFGASL 219

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHL-ALIDRHIALAKRLRDLHGLTLEW 223
                +L  +R +  + VVG+  H GS + D    L A+ D H+   +     +G +L+ 
Sbjct: 220 DSTDGLLGLARQL-GLNVVGVSFHVGSGASDPTAFLKAVQDAHVVFQQAA--AYGYSLKT 276

Query: 224 LNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS---TRIVFECGRFISAGCGCYVA 280
           L+VGGG   D         +++  + L A L E  P+     ++ E GR+ ++       
Sbjct: 277 LDVGGGFCSD-------DSFEQMANVLRAALDEYFPAHTGVNLIAEPGRYYASSAFTLAC 329

Query: 281 EVI 283
            +I
Sbjct: 330 NII 332


>DCOR_BOVIN RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 461

 Score = 55.1 bits (131), Expect = 1e-09
 Identities = 77/346 (22%), Positives = 139/346 (40%), Gaps = 40/346 (11%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +YAVK N    +++ L  +  GF+ AS  EI+ V+  GV  E  I +  P K  ++++ A
Sbjct: 65  FYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQLVQSLGVPPE-RIIYANPCKQVSQIKYA 123

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
              GV ++  +S ++L +   VAR   + A ++LR           L +  GAT      
Sbjct: 124 ANNGVQMMTFDSEVELMK---VARAHPK-AKLVLRIATDDSKAVCRLSVKFGAT------ 173

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
                +L +     ++ V+G+  H GS   D +T +  I     +     ++ G  +  L
Sbjct: 174 LKTSRLLLERAKELDIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEV-GFNMYLL 232

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS---TRIVFECGRFISAGCGCYVAE 281
           ++GGG      + +    ++     +   L +  PS    RI+ E GR+  A        
Sbjct: 233 DIGGGFP---GSEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVN 289

Query: 282 VI-------------DLKRNHDKWFA-VLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPF 327
           +I             D + + D+ F   +  G +     + + H H   +L         
Sbjct: 290 IIAKKLVLKEQTGSDDEEESTDRTFMYYVNDGVYGSFNCILYDHAHVKPLLQKR------ 343

Query: 328 PRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
           P+P  +    ++ G  C   D +     +  + VGD + F   GAY
Sbjct: 344 PKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAY 389


>SPEA_GEOBB RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 635

 Score = 54.3 bits (129), Expect = 2e-09
 Identities = 55/206 (26%), Positives = 92/206 (44%), Gaps = 15/206 (7%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGVDA--EVPIAFGGP 94
           P +   +Y +K N    V+ A+         G EV S  E+     +     +PI   G 
Sbjct: 90  PAKYQTFYPIKVNQQRQVVEAIANFGKKYNIGLEVGSKPELVAAISMSTGNNLPILCNGY 149

Query: 95  GKTD--AELEGALRLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATL 151
             T+    +  A R+G  + I VE   +L ++  V++R G    + +R   +    G   
Sbjct: 150 KDTEFIETVLFATRVGYDITIVVEKLFELEKIVEVSKRTGIVPKLGIRVKLSSKGIGKWS 209

Query: 152 QMGGGATQFG--IDEALLP-DVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIA 208
             GG   +FG  I E +   D+L Q+  + +V++  LH H GS     D     +     
Sbjct: 210 TSGGDDAKFGLRISELIAAIDMLKQNDMLDSVKL--LHFHVGSQITKIDKIKNALIEGTR 267

Query: 209 LAKRLRDLHGLTLEWLNVGGGIGIDY 234
           +   +R L G+ LE+L++GGG+G+DY
Sbjct: 268 IYAEMRKL-GVNLEFLDIGGGLGVDY 292


>SPEA_GEOSM RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 635

 Score = 52.8 bits (125), Expect = 5e-09
 Identities = 54/206 (26%), Positives = 92/206 (44%), Gaps = 15/206 (7%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGVDA--EVPIAFGGP 94
           P +   +Y +K N    V+ A+         G EV S  E+     +     +PI   G 
Sbjct: 90  PAKYQTFYPIKVNQQRQVVEAIANFGKKYNIGLEVGSKPELVAAISMSTGNNLPILCNGY 149

Query: 95  GKTD--AELEGALRLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATL 151
             T+    +  A R+G  + I VE   +L ++  V++R G    + +R   +    G   
Sbjct: 150 KDTEFIETVLFATRVGYDITIVVEKLFELEKIVEVSKRTGIVPKLGIRVKLSSKGIGKWS 209

Query: 152 QMGGGATQFG--IDEALLP-DVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIA 208
             GG   +FG  I E +   ++L Q+  + +V++  LH H GS     D     +     
Sbjct: 210 TSGGDDAKFGLRISELIAAIEMLKQNDMLDSVKL--LHFHVGSQITKIDKIKNALIEGTR 267

Query: 209 LAKRLRDLHGLTLEWLNVGGGIGIDY 234
           +   +R L G+ LE+L++GGG+G+DY
Sbjct: 268 IYAEMRKL-GVNLEFLDIGGGLGVDY 292


>DCOR_LEIDO RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 707

 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 59/236 (25%), Positives = 103/236 (43%), Gaps = 23/236 (9%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRG---VDAEVPIAFGGPGKTDAELEG 103
           Y+AVK+N    VL  L  +  GF+ AS  EI  V G   V +   I F  P K   +L  
Sbjct: 284 YFAVKSNPQPAVLEVLSALGAGFDCASKEEIHMVLGRQLVASPDDIIFANPCKQLGDLRE 343

Query: 104 ALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGID 163
           A   GV  + V++ L++ ++  +       A + ++ N +             +T+FG  
Sbjct: 344 AQACGVTYVTVDNPLEMEKISRL--MPSAHAIIRIKTNDSKA-------QCSFSTKFG-- 392

Query: 164 EALLPDV--LAQSRTMPNVRVVGLHVHAGSNSLDADTHLALI-DRHIALAKRLRDLHGLT 220
            A L DV  L ++    NV V G+  H GS + D   +++ + D +    + ++  +G  
Sbjct: 393 -APLEDVEGLLEAARQFNVTVCGVSFHVGSGNDDQSAYVSAVRDAYQVFQQAVQ--YGFK 449

Query: 221 LEWLNVGGGI-GIDYQNPERHFDWDRFCHGLAALLRET--APSTRIVFECGRFISA 273
              L++GGG  G +      +  ++     +  +L E        I+ E GR+ +A
Sbjct: 450 CTILDIGGGFPGTEVVEGSGNTSFEAIARTIRPVLAELFGGGDVTIISEPGRYFTA 505


>DCOR1_XENLA RecName: Full=Ornithine decarboxylase 1;       
           Short=ODC 1;         Short=xODC1;         EC=4.1.1.17;
          Length = 460

 Score = 52.0 bits (123), Expect = 9e-09
 Identities = 77/347 (22%), Positives = 134/347 (38%), Gaps = 41/347 (11%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +YAVK N    +++ L  +  GF+ AS  EI+ V+  GV  E  I +  P K  ++++ A
Sbjct: 65  FYAVKCNDGKAIVKTLSILGAGFDCASKTEIQLVQSIGVSPE-RIIYANPCKQVSQIKYA 123

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
              GV  +  +S ++L +   VAR     A ++LR           L +  GAT      
Sbjct: 124 ASCGVEKMTFDSEVELMK---VARNHPN-AKLVLRIATDDSKAVCRLSVKFGAT------ 173

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
                +L +     NV ++G+  H GS   D  T++  +     +     +L G  +  L
Sbjct: 174 LKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAEL-GFNMHLL 232

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPS---TRIVFECGRFISAGCGCYVAE 281
           ++GGG      + +    ++     +   L +  P+    +I+ E GR+  A        
Sbjct: 233 DIGGGFP---GSEDVKLKFEEITSVINPALDKYFPADSGVKIIAEPGRYYVASSFTLAVN 289

Query: 282 VIDLK---------------RNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYP 326
           +I  K                N       +  G +     + + H H   VL        
Sbjct: 290 IIAKKVMVNEQSGSDDEEDAANDKTLMYYVNDGVYGSFNCILFDHAHVKPVLTKK----- 344

Query: 327 FPRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
            P+P  +    ++ G  C   D +     +  L+VGD + F   GAY
Sbjct: 345 -PKPDEKFYSSSIWGPTCDGLDRIVERFELPELQVGDWMLFENMGAY 390


>DCDA_BUCAP RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 415

 Score = 52.0 bits (123), Expect = 9e-09
 Identities = 81/349 (23%), Positives = 141/349 (40%), Gaps = 38/349 (10%)

Query: 48  YAVKANSDAPVLRALLGVADGFEVASFGEIER--VRGVDAEV-PIAFGGPGKTDAELEGA 104
           +A KA S+  +LR +       +  S GEIER  V G       I F      +  L   
Sbjct: 51  FAQKACSNIHILRLMKQKNIKVDAVSLGEIERALVAGFKPNSNEIIFTADLFDEETLSKV 110

Query: 105 L--RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT-LQMGGGATQFG 161
           +  ++ V    ++   QL +L            V LR NP +G   +     GG  ++ G
Sbjct: 111 IDFKIPVNAGSIDMLEQLGKLSPGHH-------VWLRINPGFGHGHSKKTNTGGENSKHG 163

Query: 162 IDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTL 221
           I     P                 H+H GS       HL  + +  A+ ++  +++   L
Sbjct: 164 IWN---PRXXXXXXXXXXXXXXXXHMHIGSGV--NYKHLKKVGQ--AMIEKAMEINEKIL 216

Query: 222 EWLNVGGGIGIDYQNPERHFD-------WDRFCHGLAALLRETAPSTRIVFECGRFISAG 274
            +++ GGG+ I Y   E+  D       WD     ++  L       ++  E GRF+ A 
Sbjct: 217 -FISAGGGLPIPYTFNEKPIDTKKYFIIWDEARKKISRFLNTPI---QLEIEPGRFLVAE 272

Query: 275 CGCYVAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPV--V 332
            G  +++V  +K+  DK F ++  G +    P  +   H   V+  D  +      +  +
Sbjct: 273 SGILISQVRAIKKMGDKNFVLIDAGFNDLMRPTMYGSYHHVSVVTKDDRNIHETETIDTI 332

Query: 333 ERQPVTLCGELCTPKD---VLAREVPVDRLRVGDRIAFTMAGAYGWHIS 378
              P+   G++ T K+   +  R++P+  L++GD + F   GAYG  +S
Sbjct: 333 IGGPLCESGDIFTQKEGGNITTRKLPI--LKIGDYLIFHDVGAYGASMS 379


>SPEA_SHEON RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 62/264 (23%), Positives = 105/264 (39%), Gaps = 29/264 (10%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQKTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVKPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA 210
           GG  ++FG+  A    + D L QS  + ++++  LH H GS   +       +       
Sbjct: 216 GGEKSKFGLSAAQILTVVDQLKQSDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAARFY 273

Query: 211 KRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA-----P 259
             LR+L G ++   +VGGG+ +DY       N   ++    + + +  +L +       P
Sbjct: 274 CELREL-GASINCFDVGGGLAVDYDGTRSQSNNSMNYGLSEYANNIVNVLTDICNEYEQP 332

Query: 260 STRIVFECGRFISAGCGCYVAEVI 283
             RI+ E GR ++A     + +VI
Sbjct: 333 MPRIISESGRHLTAHHAVLITDVI 356


>SPEA_PELPD RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 635

 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 51/206 (24%), Positives = 91/206 (44%), Gaps = 15/206 (7%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGVDAE--VPIAFGGP 94
           P Q   +Y +K N    V+ A+         G EV S  E+     +     +PI   G 
Sbjct: 90  PAQYQTFYPIKVNQQRQVVEAIANFGKKYNIGLEVGSKPELVAAISISTNNSLPIICNGY 149

Query: 95  GKTD--AELEGALRLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATL 151
             T+    +  A ++G  + I +E   +L ++  ++R+ G    + +R   +    G   
Sbjct: 150 KDTEFIETVLYATKIGYNITIVIEKLFELEKVIELSRKTGITPKLGIRVKLSSKGTGKWA 209

Query: 152 QMGGGATQFG--IDEALLP-DVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIA 208
             GG   +FG  I E +   D+L Q   + +V++  LH H GS     D     +     
Sbjct: 210 TSGGEDAKFGLRISEIITAIDLLKQYNLIDSVKL--LHSHIGSQVTKIDKIKNALIEGAR 267

Query: 209 LAKRLRDLHGLTLEWLNVGGGIGIDY 234
           +   ++ L G+ LE++++GGG+G+DY
Sbjct: 268 IYVEMKKL-GVNLEYIDIGGGLGVDY 292


>DCOR_CHICK RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;Flags: Fragment;
          Length = 450

 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 75/340 (22%), Positives = 139/340 (40%), Gaps = 28/340 (8%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +YAVK N    V++ L  +  GF+ AS  EI+ V+  GV  E  I +  P K  ++++ A
Sbjct: 55  FYAVKCNDSEAVVKTLAVLGAGFDCASKTEIQLVQSIGVPPE-RIIYANPCKQLSQIKHA 113

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
              GV ++  +S ++L +   +AR   + A +LLR           L +  GAT      
Sbjct: 114 ANSGVRMMTFDSEVELMK---IARPHPK-AKLLLRITTDDSKAVCRLSVKFGAT------ 163

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
                +L +     ++ +VG+  H GS   D +T +  I     +     +L G  +  L
Sbjct: 164 LKTSRLLLERAKELDLAIVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEL-GFNMYLL 222

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAP---STRIVFECGRFISAGCGCYVAE 281
           ++GGG      + +    ++     +   L +  P      I+ E GR+  A        
Sbjct: 223 DIGGGFP---GSEDVKLKFEEITSVINPALDKYFPLDSEVTIIAEPGRYYVASAFTLAVN 279

Query: 282 VIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQP----- 336
           +I  K    +          + +  + + ++  +       +D+   +PV++++P     
Sbjct: 280 IIAKKIVSKEQTGSDDEDDVNDKTLMYYVNDGVYGSFNCILYDHAHVKPVLQKRPKPDDG 339

Query: 337 ---VTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
               ++ G  C   D +     +  L+VGD I F   GAY
Sbjct: 340 CYSCSIWGPTCDGLDRIVERCNMPELQVGDWILFENMGAY 379


>DCDA_CORGL RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 445

 Score = 51.2 bits (121), Expect = 2e-08
 Identities = 84/356 (23%), Positives = 130/356 (36%), Gaps = 39/356 (10%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFGE--IERVRGVDAEVPIAFGGPGKTDAELEG 103
           ++YA KA     + R +       ++AS  E  I    G  A    A G   K    L  
Sbjct: 70  VHYASKAFLTKTIARWVDEEGLALDIASINELGIALAAGFPASRITAHGN-NKGVEFLRA 128

Query: 104 ALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQ---- 159
            ++ GVG + ++S  +L  LD VA  +G+  DVL+R  P  G+   T +    + +    
Sbjct: 129 LVQNGVGHVVLDSAQELELLDYVAAGEGKIQDVLIRVKP--GIEAHTHEFIATSHEDQKF 186

Query: 160 -FGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHG 218
            F                         H H GS   DA+      +R + L  ++    G
Sbjct: 187 GFSXXXXXXXXXXXXXXXXXXXXXXXXHCHVGSQVFDAEGFKLAAERVLGLYSQIHSELG 246

Query: 219 LTLEWLNVGGGIGIDYQNPERHFDWDRFCHGL-------AALLRETAPSTRIVFECGRFI 271
           + L  L++GGG GI Y   E   +       L       AA L   AP+  ++ E GR I
Sbjct: 247 VALPELDLGGGYGIAYTAAEEPLNVAEVASDLLTAVGKMAAELGIDAPT--VLVEPGRAI 304

Query: 272 SAGCGCYVAEV------IDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDY 325
           +      + EV              ++ AV  G + + R             L    +D 
Sbjct: 305 AGPSTVTIYEVGXXXXXXXXXXXXRRYIAVDGGMSDNIR-----------PALYGSEYDA 353

Query: 326 PFPRPVVERQPVT--LCGELCTPKDVLAR-EVPVDRLRVGDRIAFTMAGAYGWHIS 378
                  E  PV+  + G  C   D+L   E+    +  GD +A    GAY + +S
Sbjct: 354 RVVSRFAEGDPVSTRIVGSHCESGDILINDEIYPSDITSGDFLALAATGAYCYAMS 409


>SPEA_SHESW RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 61/264 (23%), Positives = 106/264 (40%), Gaps = 29/264 (10%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVTPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA 210
           GG  ++FG+  A    + D L Q+  + ++++  LH H GS   +       +       
Sbjct: 216 GGEKSKFGLSAAQILTVVDQLKQNDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 211 KRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRE-----TAP 259
             LR+L G ++   +VGGG+ +DY       N   ++    + + +  +L +       P
Sbjct: 274 CELREL-GASVNCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDICNEYAQP 332

Query: 260 STRIVFECGRFISAGCGCYVAEVI 283
             RI+ E GR+++A     + +VI
Sbjct: 333 MPRIISESGRYLTAHHAVLITDVI 356


>SPEA_SHEPC RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 61/264 (23%), Positives = 106/264 (40%), Gaps = 29/264 (10%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVTPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA 210
           GG  ++FG+  A    + D L Q+  + ++++  LH H GS   +       +       
Sbjct: 216 GGEKSKFGLSAAQILTVVDQLKQNDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 211 KRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRE-----TAP 259
             LR+L G ++   +VGGG+ +DY       N   ++    + + +  +L +       P
Sbjct: 274 CELREL-GASVNCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDICNEYAQP 332

Query: 260 STRIVFECGRFISAGCGCYVAEVI 283
             RI+ E GR+++A     + +VI
Sbjct: 333 MPRIISESGRYLTAHHAVLITDVI 356


>DCOR_SCHPO RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 432

 Score = 50.4 bits (119), Expect = 3e-08
 Identities = 79/337 (23%), Positives = 130/337 (38%), Gaps = 33/337 (9%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAELEGAL 105
           +YAVK N D  VL  L     GF+ AS GE+E++ G+      I +  P K    +  A 
Sbjct: 94  FYAVKCNPDPKVLALLNKFGTGFDCASKGELEQILGLGVSPDRIVYANPCKAITYVRYAA 153

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEA 165
             G+ L+  ++  +L ++    ++    + +LLR +         L +  GA+    D  
Sbjct: 154 SKGINLMTFDNADELYKV----KQHHPNSRLLLRISTDDSNSLCRLSLKFGASL--DDTG 207

Query: 166 LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLN 225
            L D+         +              D    L  I R   +  +  +  G   + L+
Sbjct: 208 KLLDIAKSL----ELNXXXXXXXXXXXXYDPSAFLDAIQRSRQVFDQGLE-RGFNFDLLD 262

Query: 226 VGGGIGIDYQNPERHFDWDRFCHGLAALLRETA-----PSTRIVFECGRFISAGCGCYVA 280
           +GGG   D       FD      G+A L+R        PS R++ E GRF  +       
Sbjct: 263 IGGGFMND------SFD------GVADLIRSALDTYFDPSIRVISEPGRFFVSSSFTLAV 310

Query: 281 EVIDLKR--NHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPV-VERQPV 337
            VI  ++  + +K    +  G +     + + H HP   +      + +   V   +   
Sbjct: 311 NVIAKRKLDDEEKVMYYVNDGVYGSLNCILFDHQHPVARVLKCGSRFVYNDLVGTGQHRC 370

Query: 338 TLCGELCTPKDVLAREVPVD-RLRVGDRIAFTMAGAY 373
            + G  C   DV+A +  +   L VGD I F  AGAY
Sbjct: 371 FIWGPTCDSLDVIANDAHLPYELNVGDWIYFEDAGAY 407


>DCOR1_DROME RecName: Full=Ornithine decarboxylase 1;       
           Short=ODC;         EC=4.1.1.17;
          Length = 394

 Score = 50.4 bits (119), Expect = 3e-08
 Identities = 81/341 (23%), Positives = 131/341 (38%), Gaps = 40/341 (11%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAELEGAL 105
           +YAVK N D  V+R L  +  GF+ AS  E++ V G D     I F  P +  + LE A 
Sbjct: 58  FYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAK 117

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEA 165
              V    V++  ++ +L                A  A    G          +FG    
Sbjct: 118 EHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPLG---------DKFGCXXX 168

Query: 166 LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRL---RDLHGLTLE 222
                         ++V G   H GS      + L   DR I  AK L     L G  ++
Sbjct: 169 XXXXXXXXXXKSLELKVTGTSFHVGSGC----SELQAYDRAIKKAKNLFKFGALLGYDMD 224

Query: 223 WLNVGGGI-GIDYQNPERHFDWDRFCHGLAALLRETAPSTR--IVFECGR-FISAGCG-- 276
           +L++GGG  G D         +++    +   ++   P  R  I+ E GR F++A C   
Sbjct: 225 FLDIGGGFPGSD------DVKFEKIAESVNTSVQRHFPDERVHIIAEPGRFFVAAACTLV 278

Query: 277 CYVAEVIDLKRNHDKWFAV---LRGGTHHFRLPVSWQHNHPFQVLPNDHW-DYPFPRPVV 332
           C +    +++    K   V   L  G +     + + H    QV+  +H+ D     P +
Sbjct: 279 CKIHAKREIRNEAGKLDTVMYYLNDGVYGSFNCILYDH----QVVIAEHYLDNAESLPHL 334

Query: 333 ERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
           +     + G  C   D ++ ++ +  L  GD + F   GAY
Sbjct: 335 KS---LIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAY 372


>SPEA_SHESA RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 50.1 bits (118), Expect = 3e-08
 Identities = 61/264 (23%), Positives = 104/264 (39%), Gaps = 29/264 (10%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQKTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVKPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA 210
           GG  ++FG+  A    + D L Q   + ++++  LH H GS   +       +       
Sbjct: 216 GGEKSKFGLSAAQILTVVDQLKQEDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAARFY 273

Query: 211 KRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA-----P 259
             LR+L G ++   +VGGG+ +DY       N   ++    + + +  +L +       P
Sbjct: 274 CELREL-GASINCFDVGGGLAVDYDGTRSQSNNSMNYGLSEYANNIVNVLTDICNEYEQP 332

Query: 260 STRIVFECGRFISAGCGCYVAEVI 283
             RI+ E GR ++A     + +VI
Sbjct: 333 MPRIISESGRHLTAHHAVLITDVI 356


>DCOR_SOLLC RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;AltName: Full=LeODC;
          Length = 431

 Score = 50.1 bits (118), Expect = 3e-08
 Identities = 48/194 (24%), Positives = 83/194 (42%), Gaps = 18/194 (9%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERV--RGVDAEVPIAFGGPGKTDAELEGA 104
           +YAVK N +   L  L  +   F+ AS  EIE V   G+  +  I F  P K ++++  A
Sbjct: 90  FYAVKCNPEPSFLSMLSAMGSNFDCASRAEIEYVLSHGISPD-RIVFANPCKPESDIIFA 148

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
            ++GV L   +S  ++ ++    R+     ++LLR  P        +  G      G   
Sbjct: 149 EKIGVNLTTYDSEDEVYKI----RKHHPKCELLLRIKP--------MTDGNARCPMGPKY 196

Query: 165 ALLP---DVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTL 221
             LP   + L ++     + V G+  H GS   D++ +L  I     + +    L    +
Sbjct: 197 GALPEEIEPLLRTAQAARLTVSGVSFHIGSGDADSNAYLGAIAAAKQVFETAAQLGMPKM 256

Query: 222 EWLNVGGGIGIDYQ 235
             L++GGG    +Q
Sbjct: 257 TVLDIGGGFTSGHQ 270


>DCOR_CRIGR RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 455

 Score = 50.1 bits (118), Expect = 3e-08
 Identities = 73/346 (21%), Positives = 135/346 (39%), Gaps = 44/346 (12%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAELEGAL 105
           +YAVK N    ++  L  +    + AS  EI+ V+G+      + +  P K  ++++ A 
Sbjct: 63  FYAVKCNDSRALVNTLAAIT--VDCASKTEIQLVQGLGVPPERVIYANPCKQVSQIKYAA 120

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEA 165
             GV ++  +S ++L +   VAR   +   ++LR           L +  GAT       
Sbjct: 121 SNGVQMMTFDSEIELMK---VARAHPKVTKLVLRIATDDSKAVCRLSVKFGAT------L 171

Query: 166 LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHL-ALIDRHIALAKRLRDLH---GLTL 221
               +L +     N+ V+G+  H GS   D +T + AL D     A+ + D+    G ++
Sbjct: 172 RTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQALSD-----ARCVFDMGTEVGFSM 226

Query: 222 EWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAP---STRIVFECGRFISAGCGCY 278
             L++GGG      + +    ++     +   L +  P     R++ E GR+  A     
Sbjct: 227 YLLDIGGGFP---GSEDTKLKFEEITSVINPALDKYFPPDSGVRVIAEPGRYYVASAFTL 283

Query: 279 VAEVIDLK-----------RNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPF 327
              +I  K                +   +  G +     + + H H   +LP        
Sbjct: 284 AVNIIAKKIVSKGXXXXXXXXXQTFMYYVNDGVYGSFNCILYDHAHVKPLLPKR------ 337

Query: 328 PRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
           P+P  +    ++ G  C   D +     +  + VGD + F   GAY
Sbjct: 338 PKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAY 383


>DCOR_CAPAN RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;AltName:
           Full=CapODC;AltName: Full=CaODC1;
          Length = 435

 Score = 50.1 bits (118), Expect = 3e-08
 Identities = 75/339 (22%), Positives = 126/339 (37%), Gaps = 35/339 (10%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERV--RGVDAEVPIAFGGPGKTDAELEGA 104
           +YAVK N +   L  L  +   F  AS  EIE V   G+  E  I F  P K ++++  A
Sbjct: 94  FYAVKCNPEPSFLSMLAAMGSNFVCASRAEIEYVLSLGISPE-RIVFANPCKPESDIIFA 152

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
            ++GV L   +S  ++ +   + +   +C ++LLR  P        +  G      G   
Sbjct: 153 EKVGVNLTTYDSEDEVYK---IKKHHPKC-ELLLRIKP--------MNDGNARCPMGPKY 200

Query: 165 ALLP---DVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTL 221
             LP   + L +      + V G+  H GS   D++ +L  I     + +         +
Sbjct: 201 GALPEEIEPLLRIAQASRLTVSGVSFHIGSGDADSNAYLGAIAAAKQVFETAAKFGMSKM 260

Query: 222 EWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRE---TAPSTRIVFECGRFISAGCGCY 278
             L++GGG    +Q       +      + + L++     P   I+ E GR         
Sbjct: 261 NVLDIGGGFTSGHQ-------FTTAATAVKSALQQHFSNEPELTIIAEPGRXXXXXXXXX 313

Query: 279 VAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQH----NHPFQVLPNDHWDYPFPRPVVER 334
              +I  +   D     +  G +     V + H      P   + N            + 
Sbjct: 314 XXXIIGKRVRGDLREYWINDGLYGSMNCVLYDHATVTATPLACMSN---RVNLNCSGSKM 370

Query: 335 QPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
            P T+ G  C   D + R+  V  L+V D + F   GAY
Sbjct: 371 FPSTIFGPTCDALDTVLRDYHVPELQVNDWVIFPNMGAY 409


>SPEA_SHEB9 RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 49.7 bits (117), Expect = 4e-08
 Identities = 62/267 (23%), Positives = 108/267 (40%), Gaps = 35/267 (13%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVTPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHI 207
           GG  ++FG+  A   L+ + L Q+  + ++++  LH H GS   N  D    ++   R  
Sbjct: 216 GGEKSKFGLSAAQILLVVEQLKQNDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 208 ALAKRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA--- 258
              + L    G ++   +VGGG+ +DY       N   ++    + + +  +L +     
Sbjct: 274 CELRAL----GASVNCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDICNEY 329

Query: 259 --PSTRIVFECGRFISAGCGCYVAEVI 283
             P  RI+ E GR+++A     + +VI
Sbjct: 330 EQPMPRIISESGRYLTAHHAVLITDVI 356


>SPEA_SHEB8 RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 49.7 bits (117), Expect = 4e-08
 Identities = 62/267 (23%), Positives = 108/267 (40%), Gaps = 35/267 (13%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVTPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHI 207
           GG  ++FG+  A   L+ + L Q+  + ++++  LH H GS   N  D    ++   R  
Sbjct: 216 GGEKSKFGLSAAQILLVVEQLKQNDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 208 ALAKRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA--- 258
              + L    G ++   +VGGG+ +DY       N   ++    + + +  +L +     
Sbjct: 274 CELRAL----GASVNCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDICNEY 329

Query: 259 --PSTRIVFECGRFISAGCGCYVAEVI 283
             P  RI+ E GR+++A     + +VI
Sbjct: 330 EQPMPRIISESGRYLTAHHAVLITDVI 356


>SPEA_SHEB5 RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 49.7 bits (117), Expect = 4e-08
 Identities = 62/267 (23%), Positives = 108/267 (40%), Gaps = 35/267 (13%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVTPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHI 207
           GG  ++FG+  A   L+ + L Q+  + ++++  LH H GS   N  D    ++   R  
Sbjct: 216 GGEKSKFGLSAAQILLVVEQLKQNDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 208 ALAKRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA--- 258
              + L    G ++   +VGGG+ +DY       N   ++    + + +  +L +     
Sbjct: 274 CELRAL----GASVNCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDICNEY 329

Query: 259 --PSTRIVFECGRFISAGCGCYVAEVI 283
             P  RI+ E GR+++A     + +VI
Sbjct: 330 EQPMPRIISESGRYLTAHHAVLITDVI 356


>SPEA_SHEB2 RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 49.7 bits (117), Expect = 4e-08
 Identities = 62/267 (23%), Positives = 108/267 (40%), Gaps = 35/267 (13%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVTPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHI 207
           GG  ++FG+  A   L+ + L Q+  + ++++  LH H GS   N  D    ++   R  
Sbjct: 216 GGEKSKFGLSAAQILLVVEQLKQNDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 208 ALAKRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA--- 258
              + L    G ++   +VGGG+ +DY       N   ++    + + +  +L +     
Sbjct: 274 CELRAL----GASVNCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDICNEY 329

Query: 259 --PSTRIVFECGRFISAGCGCYVAEVI 283
             P  RI+ E GR+++A     + +VI
Sbjct: 330 EQPMPRIISESGRYLTAHHAVLITDVI 356


>SPEA_SHESR RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 49.3 bits (116), Expect = 6e-08
 Identities = 60/264 (22%), Positives = 105/264 (39%), Gaps = 29/264 (10%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQKTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVKPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA 210
           GG  ++FG+  A    + D L ++  + ++++  LH H GS   +       +       
Sbjct: 216 GGEKSKFGLSAAQILTVVDQLKENDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAARFY 273

Query: 211 KRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA-----P 259
             LR+L G ++   +VGGG+ +DY       N   ++    + + +  +L +       P
Sbjct: 274 CELREL-GASINCFDVGGGLAVDYDGTRSQSNNSMNYGLSEYANNIVNVLTDICNEYEQP 332

Query: 260 STRIVFECGRFISAGCGCYVAEVI 283
             RI+ E GR ++A     + +VI
Sbjct: 333 MPRIISESGRHLTAHHAVLITDVI 356


>SPEA_SHESM RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 49.3 bits (116), Expect = 6e-08
 Identities = 60/264 (22%), Positives = 105/264 (39%), Gaps = 29/264 (10%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQKTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  + A ++R G    + LRA  A+   G     
Sbjct: 156 NEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVKPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA 210
           GG  ++FG+  A    + D L ++  + ++++  LH H GS   +       +       
Sbjct: 216 GGEKSKFGLSAAQILTVVDQLKENDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAARFY 273

Query: 211 KRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA-----P 259
             LR+L G ++   +VGGG+ +DY       N   ++    + + +  +L +       P
Sbjct: 274 CELREL-GASINCFDVGGGLAVDYDGTRSQSNNSMNYGLSEYANNIVNVLTDICNEYEQP 332

Query: 260 STRIVFECGRFISAGCGCYVAEVI 283
             RI+ E GR ++A     + +VI
Sbjct: 333 MPRIISESGRHLTAHHAVLITDVI 356


>DCOR_CANAL RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 473

 Score = 49.3 bits (116), Expect = 6e-08
 Identities = 52/188 (27%), Positives = 89/188 (47%), Gaps = 17/188 (9%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGV---DAEVPIAFGGPGKTDAELEG 103
           YYAVK NS+  +L  L  +   F+ AS  EI+ V  +    A   I +  P KT++ +  
Sbjct: 102 YYAVKCNSNPQILTTLSELGVNFDCASKNEIDLVLSLGIHQAHERIIYANPCKTNSFIRH 161

Query: 104 ALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGID 163
           A    V L  V++  +L +L   A+    C  +L+R           L     +T+FG D
Sbjct: 162 AADENVNLTTVDNVHELYKL---AKFHPHC-KILIRLITDDSTAQCQL-----STKFGCD 212

Query: 164 -EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLD-ADTHLALIDRHIALAKRLRDLHGLTL 221
               + ++L +++ +  ++V G+  H GS + D +  + A+ D  I   + L    G T 
Sbjct: 213 LNTAIGEILPKAKEL-GLQVHGVAFHVGSGAKDFSSIYQAIKDSRILFDEMLS--MGFTP 269

Query: 222 EWLNVGGG 229
           + L++GGG
Sbjct: 270 KLLDIGGG 277


>AZIN1_MOUSE RecName: Full=Antizyme inhibitor 1;       
           Short=AZI;AltName: Full=Ornithine decarboxylase antizyme
           inhibitor;
          Length = 448

 Score = 48.5 bits (114), Expect = 1e-07
 Identities = 78/349 (22%), Positives = 138/349 (39%), Gaps = 42/349 (12%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +Y VK NS   VL  L  +  GF  +S  E+  V+  GV  E  I F  P K  ++++ A
Sbjct: 65  FYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPE-NIIFTSPCKQVSQIKYA 123

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
            ++GV ++  ++ ++L ++     R    A VLL       + G       G  +FG   
Sbjct: 124 AKVGVNIMTCDNEIELKKI----ARNHPNAKVLLHIATEDNIGGE-----DGNMKFGTTL 174

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHL-ALIDRHIALAKRLRDLHGLTLEW 223
                +L  ++ + +V+++G+  H  S   +   ++ AL D        +    G T+  
Sbjct: 175 KNCRHLLECAKEL-DVQIIGVKFHVSSACKEYQVYVHALSDARCVF--DMAGEFGFTMNM 231

Query: 224 LNVGGGI-GIDYQNPERHFDWDRFCHGLAALLRETAP---STRIVFECGRFISAGCGCYV 279
           L++GGG  G + Q  E +       H ++ LL    P     +I+ E G +  +      
Sbjct: 232 LDIGGGFTGTEIQLEEVN-------HVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLA 284

Query: 280 AEVIDLKRNHDKWFA--VLRGGTHHFRL----------PVSWQHNHPFQVLPNDHWDYPF 327
             +I  K   +  F+  V + G+                 + + +     +P  H  Y  
Sbjct: 285 VNIIAKKVVENDKFSSGVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKYKE 344

Query: 328 PRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWH 376
             P+      +L G  C   D +     +  L VGD + F   GA  +H
Sbjct: 345 DEPLFTS---SLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFH 390


>DCOR_DATST RecName: Full=Ornithine decarboxylase;       
           Short=ODC;         EC=4.1.1.17;
          Length = 431

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 46/193 (23%), Positives = 79/193 (40%), Gaps = 16/193 (8%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAELEGAL 105
           +YAVK N +   L  L  +   F+ AS  EIE V  +      I F  P K ++++  A 
Sbjct: 90  FYAVKCNPEPSFLSMLSAMGSNFDCASRAEIEYVLSLGISPDRIVFANPCKPESDIIFAA 149

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEA 165
           ++GV L   +S  ++ ++    R+     ++LLR  P        +  G      G    
Sbjct: 150 KVGVNLTTFDSEDEVYKI----RKHHPKCELLLRIKP--------MDDGNARCPMGPKYG 197

Query: 166 LLP---DVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLE 222
            LP   + L ++     + V G+  H GS   D+  +L  I     + +         + 
Sbjct: 198 ALPEEVEPLLRTAQAARLTVSGVSFHIGSGDADSKAYLGAIAAAKGVFETAARFGMSKMT 257

Query: 223 WLNVGGGIGIDYQ 235
            L++GGG    +Q
Sbjct: 258 VLDIGGGFTSGHQ 270


>AZIN1_PONAB RecName: Full=Antizyme inhibitor 1;       
           Short=AZI;AltName: Full=Ornithine decarboxylase antizyme
           inhibitor;
          Length = 448

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 75/348 (21%), Positives = 141/348 (40%), Gaps = 40/348 (11%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +Y VK NS   VL  L  +  GF  +S  E+  V+  GV  E  I +  P K  ++++ A
Sbjct: 65  FYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPE-NIIYISPCKQVSQIKYA 123

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
            ++GV ++  ++ ++L ++     R    A VLL       + G       G  +FG   
Sbjct: 124 AKVGVNIMTCDNEIELKKI----ARNHPNAKVLLHIATEDNIGGEE-----GNMKFGTTL 174

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
                +L  ++ + +V+++G+  H  S   ++  ++  +     +     ++ G T+  L
Sbjct: 175 KNCRHLLECAKEL-DVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEI-GFTMNML 232

Query: 225 NVGGGI-GIDYQNPERHFDWDRFCHGLAALLRETAP---STRIVFECGRFISAGCGCYVA 280
           ++GGG  G ++Q  E +       H ++ LL    P     +I+ E G +  +       
Sbjct: 233 DIGGGFTGTEFQLEEVN-------HVISPLLDVYFPEGSGVKIISEPGSYYVSSAFTLAV 285

Query: 281 EVIDLK-RNHDKW-FAVLRGGTHHFRL----------PVSWQHNHPFQVLPNDHWDYPFP 328
            +I  K   +DK+   V + G+                 + + +     +P  H  Y   
Sbjct: 286 NIIAKKVVENDKFPSGVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKED 345

Query: 329 RPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWH 376
            P+      +L G  C   D +     +  L VGD + F   GA  +H
Sbjct: 346 EPLFTS---SLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFH 390


>AZIN1_HUMAN RecName: Full=Antizyme inhibitor 1;       
           Short=AZI;AltName: Full=Ornithine decarboxylase antizyme
           inhibitor;
          Length = 448

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 75/348 (21%), Positives = 141/348 (40%), Gaps = 40/348 (11%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +Y VK NS   VL  L  +  GF  +S  E+  V+  GV  E  I +  P K  ++++ A
Sbjct: 65  FYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPE-NIIYISPCKQVSQIKYA 123

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
            ++GV ++  ++ ++L ++     R    A VLL       + G       G  +FG   
Sbjct: 124 AKVGVNILTCDNEIELKKI----ARNHPNAKVLLHIATEDNIGGEE-----GNMKFGTTL 174

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
                +L  ++ + +V+++G+  H  S   ++  ++  +     +     ++ G T+  L
Sbjct: 175 KNCRHLLECAKEL-DVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEI-GFTMNML 232

Query: 225 NVGGGI-GIDYQNPERHFDWDRFCHGLAALLRETAP---STRIVFECGRFISAGCGCYVA 280
           ++GGG  G ++Q  E +       H ++ LL    P     +I+ E G +  +       
Sbjct: 233 DIGGGFTGTEFQLEEVN-------HVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAV 285

Query: 281 EVIDLK-RNHDKW-FAVLRGGTHHFRL----------PVSWQHNHPFQVLPNDHWDYPFP 328
            +I  K   +DK+   V + G+                 + + +     +P  H  Y   
Sbjct: 286 NIIAKKVVENDKFPSGVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKED 345

Query: 329 RPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWH 376
            P+      +L G  C   D +     +  L VGD + F   GA  +H
Sbjct: 346 EPLFTS---SLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFH 390


>ADC_MOUSE RecName: Full=Antizyme inhibitor 2;       
           Short=AZI2;AltName: Full=Arginine decarboxylase-like
           protein;         Short=ARGDC;
          Length = 459

 Score = 47.8 bits (112), Expect = 2e-07
 Identities = 73/337 (21%), Positives = 133/337 (39%), Gaps = 23/337 (6%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +YAV  NS   VL+ L  +  GF  A+  E+E V+  GV A   I    P K  A+++ A
Sbjct: 66  FYAVGCNSSLGVLKVLAELGLGFSCANKAEMELVQHIGVPAS-KIICANPCKQVAQIKYA 124

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
            + GV L+  ++ ++L+++  V         + +    ++ L   +L+ G          
Sbjct: 125 AKHGVRLLSFDNEVELAKV--VKSHPSAKMVLCIATQDSHSLNHLSLRFGASLKSC---- 178

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
                 L ++    +V VVG+  H GS   D   +   I     L  ++ +  G T+  L
Sbjct: 179 ----RHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSI-ADARLVFQMGEELGHTMNIL 233

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVID 284
           ++GGG         R  +     +    L         I+ E GR+           ++ 
Sbjct: 234 DLGGGFPGLEGAKVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVA 293

Query: 285 LKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQP-------- 336
            +   D+     + G     + V +     + V  +  +D   P P ++++P        
Sbjct: 294 KREVLDQASREEQTGAAPKSI-VYYLDEGVYGVFNSVLFDNTCPTPALQKKPSADQPLYS 352

Query: 337 VTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
            +L G      D +A  + + +L+VGD + F   GAY
Sbjct: 353 SSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGAY 389


>SPEA_YERPE RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 659

 Score = 47.4 bits (111), Expect = 2e-07
 Identities = 62/267 (23%), Positives = 105/267 (39%), Gaps = 30/267 (11%)

Query: 46  LYYAVKANSDAPVLRALLGVAD--GFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEG 103
           L Y +K N    V+ +L+   +  G E  S  E+  V              G  D E   
Sbjct: 123 LVYPIKVNQHRRVIESLVNSGEPLGLEAGSKAEMMAVLAHAGMTRSVIVCNGYKDREYIR 182

Query: 104 ALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGAT 158
              +G  L H     +E   ++  +   A R      + +RA  A    G     GG  +
Sbjct: 183 LALIGEKLGHKVYLVIEKMSEIKMVLEEAERLNVVPRLGVRARLASQGSGKWQASGGEKS 242

Query: 159 QFGIDEAL---LPDVLAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHIALAKR 212
           +FG+       L D+L ++ ++ ++++  LH H GS   N  D  T +    R      +
Sbjct: 243 KFGLSATQVLQLVDMLREANSLESLQL--LHFHLGSQLSNIRDISTGVRESARFYVELHK 300

Query: 213 LRDLHGLTLEWLNVGGGIGIDYQNPERHFDW----------DRFCHGLAALLRETA-PST 261
           L    G+ ++  +VGGG+G+DY+      D           +    G+     E   P  
Sbjct: 301 L----GVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNVIWGIGDACNEHGLPHP 356

Query: 262 RIVFECGRFISAGCGCYVAEVIDLKRN 288
            ++ E GR ++A     V+ VI ++RN
Sbjct: 357 TVITESGRAVTAHHTVLVSNVIGVERN 383


>SPEA_SHEFN RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 636

 Score = 47.4 bits (111), Expect = 2e-07
 Identities = 58/262 (22%), Positives = 102/262 (38%), Gaps = 25/262 (9%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQKTVVEEILASQKSKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  +   A + G    + LR   A+   G     
Sbjct: 156 KEYIRLALIGEKLGHKVYIVLEKMSELKMVLIEAEKLGITPRLGLRVRLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEALLPDVLAQSRTMPNVRVVGL-HVHAGSNSLDADTHLALIDRHIALAKR 212
           GG  ++FG+  A +  V+A+ ++   +  + L H H GS   +       +         
Sbjct: 216 GGEKSKFGLSAAQVLKVIAELKSANMLDSLQLLHFHLGSQIANIRDIRQGVSEAGRFYCE 275

Query: 213 LRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA-----PST 261
           LR L G +++  +VGGG+ +DY       N   ++  + + + +  +L +       P  
Sbjct: 276 LRQL-GASIDCFDVGGGLAVDYDGTRSQSNNSMNYGLNEYANNIVNVLTDLCNEYEQPMP 334

Query: 262 RIVFECGRFISAGCGCYVAEVI 283
           RI+ E GR ++A     + +VI
Sbjct: 335 RIISESGRHLTAHHAVLITDVI 356


>DCDA_BUCAI RecName: Full=Diaminopimelate decarboxylase;       
           Short=DAP decarboxylase;         EC=4.1.1.20;
          Length = 415

 Score = 46.2 bits (108), Expect = 5e-07
 Identities = 62/252 (24%), Positives = 102/252 (40%), Gaps = 26/252 (10%)

Query: 136 VLLRANPAYGLPGAT-LQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSL 194
           V LR NP +G   +     GG  ++ GI     P+                H+H GS   
Sbjct: 137 VWLRINPRFGYGHSKKTNTGGENSKHGIWH---PEQAXXXXXXXXXXXXXXHMHIGSGV- 192

Query: 195 DADTHLALIDRHIALAKRLRDLHGLTLEWLNVGGGIGIDYQNPERHFD-------WDRFC 247
               +L L     A+ K    L+   +  ++VGGG+ I Y+  ++  D       WD   
Sbjct: 193 ---NYLHLKKVSQAMIKYAFQLNQ-KISSISVGGGLPIPYKFNDQPIDIKKYFMLWDIAR 248

Query: 248 HGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVIDLKRNHDKWFAVLRGGTHHFRLPV 307
             ++  L E      +  E GRF+ A  G  +++V   K+  +K F ++  G +    P 
Sbjct: 249 KKISKFLGE---KIELEIEPGRFLVAESGILISKVWATKKMGNKNFVLVDVGFNDLMRPT 305

Query: 308 SWQHNHPFQVLPNDHWDYPFPRPV--VERQPVTLCGELCTPKD---VLAREVPVDRLRVG 362
            +   H   V+  D         +  V   P+   G++ T K+   V  R++P   ++VG
Sbjct: 306 MYGSYHHISVIYGDDRKMNEKETIDTVVAGPLCESGDIFTQKEGGTVQTRKLPT--IKVG 363

Query: 363 DRIAFTMAGAYG 374
           D + F   GAYG
Sbjct: 364 DYLIFHDTGAYG 375


>SPEA_SHEDO RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 636

 Score = 45.4 bits (106), Expect = 8e-07
 Identities = 59/264 (22%), Positives = 101/264 (38%), Gaps = 29/264 (10%)

Query: 46  LYYAVKANSDAPVLRALLGVADGFEVASFG-------EIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L      EV   G       E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQKTVVEEILASQVSKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  +   AR  G    + LR   A+   G     
Sbjct: 156 KEYVRLALIGEKLGHKVYIVLEKMSELKMVLEEARELGVTPRLGLRTRLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEALL---PDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA 210
           GG  ++FG+  A +    D L ++  + ++++  LH H GS   +       +       
Sbjct: 216 GGEKSKFGLSAAQVLKVVDELKEANMLESLQL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 211 KRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA-----P 259
             LR L G ++   +VGGG+ +DY       N   ++    + + +  +L +       P
Sbjct: 274 CELRQL-GASINCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDLCNEYEQP 332

Query: 260 STRIVFECGRFISAGCGCYVAEVI 283
             RI+ E GR ++A     + +VI
Sbjct: 333 MPRIISESGRHLTAHHAVLITDVI 356


>SPEA_GEOMG RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 635

 Score = 45.1 bits (105), Expect = 1e-06
 Identities = 50/209 (23%), Positives = 94/209 (44%), Gaps = 21/209 (10%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGVDAE----VPIAFG 92
           P     +Y +K N    V+ A+         G EV S  E+  V G+       +PI   
Sbjct: 90  PSTYQTFYPIKVNQQRQVVEAIAKFGKRYNIGIEVGSKPEL--VIGISFATGNGIPIICN 147

Query: 93  GPGKTDAELEGAL---RLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPG 148
           G  K    +E  L   ++G  + I VE   +L ++ A++++ G    + +R   +    G
Sbjct: 148 GY-KDKEYIETVLYATKIGYDITIVVEKMFELEKIIALSKKTGIKPKLGIRVKLSSKGTG 206

Query: 149 ATLQMGGGATQFGIDEALLP---DVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDR 205
                GG   +FG+  + +     +L Q+  + +V+++  H H GS     D   + +  
Sbjct: 207 KWATSGGEDAKFGLRMSEIIAAIGLLEQNELLDSVKLI--HFHIGSQITKIDKIKSALIE 264

Query: 206 HIALAKRLRDLHGLTLEWLNVGGGIGIDY 234
              +   +R L G+ +E++++GGG+G+DY
Sbjct: 265 GTRVYAEMRKL-GVGIEYVDIGGGLGVDY 292


>SPEA_SHEAM RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 636

 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 57/262 (21%), Positives = 101/262 (38%), Gaps = 25/262 (9%)

Query: 46  LYYAVKANSDAPVLRALLGVAD-------GFEVASFGEIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L           G E  S  E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQVSKTVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  +   +++ G    + LRA  A+   G     
Sbjct: 156 KEYIRLALIGEKLGHSVYIVLEKMSELQMVLEESKKLGVTPRLGLRARLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEALLPDVLAQSRTMPNVRVVGL-HVHAGSNSLDADTHLALIDRHIALAKR 212
           GG  ++FG+  A +  V+ + +    +  + L H H GS   +       +         
Sbjct: 216 GGEKSKFGLSAAQILKVVERLKDEDMLESLQLLHFHLGSQIANIRDIRHGVGEAARFYCE 275

Query: 213 LRDLHGLTLEWLNVGGGIGIDYQ------NPERHFDWDRFCHGLAALLRETA-----PST 261
           LR L G  +   +VGGG+ +DY       N   ++    + + + ++L +       P  
Sbjct: 276 LRKL-GAKVNCFDVGGGLAVDYDGTRSQSNNSMNYALAEYANNIVSVLTDVCNQNEQPMP 334

Query: 262 RIVFECGRFISAGCGCYVAEVI 283
           RI+ E GR+++A     + +VI
Sbjct: 335 RIISESGRYLTAHHAVLITDVI 356


>SPEA_PROMH RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 635

 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 57/264 (21%), Positives = 102/264 (38%), Gaps = 24/264 (9%)

Query: 46  LYYAVKANSDAPVLRALLGVAD--GFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEG 103
           L Y +K N    V+ +L+   +  G E  S  E+  V              G  D E   
Sbjct: 98  LVYPIKVNQQRRVIESLINAGEPLGLEAGSKAELMAVLAHANMTSSVIVCNGYKDREYIR 157

Query: 104 ALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGAT 158
               G  L H     +E   ++  +   A R      + +RA  A    G     GG  +
Sbjct: 158 LALTGEKLGHKVFLVIEKMSEIKMVLEEAERLEVIPRLGVRARLASQGSGKWQASGGEKS 217

Query: 159 QFGIDEAL---LPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRD 215
           +FG+       L D L Q+  + ++++  LH H GS   +       +         L  
Sbjct: 218 KFGLAATQVLQLIDTLRQAGRLDSLQL--LHFHLGSQMANIRDIATGVRESARFYVELHK 275

Query: 216 LHGLTLEWLNVGGGIGIDYQNPERHFD------WDRFCHGLAALLRETA-----PSTRIV 264
           L G+ +++ +VGGG+G+DY+      D       + + + +   + +       P   ++
Sbjct: 276 L-GVNIQYFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNVIWAIGDACDENELPHPTVI 334

Query: 265 FECGRFISAGCGCYVAEVIDLKRN 288
            E GR ++A     ++ VI ++RN
Sbjct: 335 TESGRALTAHHTVLISNVIGVERN 358


>SPEA_GEOSL RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 635

 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 49/208 (23%), Positives = 92/208 (44%), Gaps = 19/208 (9%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGVDAE----VPIAFG 92
           P     +Y +K N    V+ A+         G EV S  E+  V G+       +PI   
Sbjct: 90  PATYQTFYPIKVNQQRQVVEAIAKFGKRYNIGLEVGSKPEL--VIGISFATGNGIPIICN 147

Query: 93  GPGKTD--AELEGALRLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGA 149
           G   T+    +  A ++G  + I VE   +L ++ A++++ G    + +R   +    G 
Sbjct: 148 GYKDTEYIETVLYATKIGYDITIVVEKMFELEKIIALSKKTGIKPKLGIRVKLSSKGTGK 207

Query: 150 TLQMGGGATQFGIDEALLP---DVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRH 206
               GG   +FG+  + +     +L Q+  +  V++  LH H GS     D   + +   
Sbjct: 208 WATSGGEDAKFGLRMSEIIAAIGLLEQNDLLDRVKL--LHFHIGSQITKIDKIKSALIEG 265

Query: 207 IALAKRLRDLHGLTLEWLNVGGGIGIDY 234
             +   +R L G+ + ++++GGG+G+DY
Sbjct: 266 TRIYAEMRKL-GVGIRYVDIGGGLGVDY 292


>ADC_HUMAN RecName: Full=Arginine decarboxylase;       
           Short=ARGDC;         Short=ADC;       
           EC=4.1.1.19;AltName: Full=Ornithine decarboxylase-like
           protein;
          Length = 460

 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 73/344 (21%), Positives = 134/344 (38%), Gaps = 36/344 (10%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +YAVK NS   VL+ L  +  GF  A+  E+E V+  G+ A   I    P K  A+++ A
Sbjct: 66  FYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPAS-KIICANPCKQIAQIKYA 124

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
            + G+ L+  ++ ++L+++  V         + +  + ++ L   +L       +FG+  
Sbjct: 125 AKHGIQLLSFDNEMELAKV--VKSHPSAKMVLCIATDDSHSLSCLSL-------KFGVSL 175

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWL 224
                +L  ++   +V VVG+  H GS   D   +   I     L   +    G  +  L
Sbjct: 176 KSCRHLLENAK-KHHVEVVGVSFHIGSGCPDPQAYAQSI-ADARLVFEMGTELGHKMHVL 233

Query: 225 NVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVAEVI- 283
           ++GGG         R  +     +    L         I  E GR+           +I 
Sbjct: 234 DLGGGFPGTEGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIA 293

Query: 284 ------DLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPV 337
                 D     ++  +  +   +H    V       + +  +  +D   P P+++++P 
Sbjct: 294 KKEVLLDQPGREEENGSTSKTIVYHLDEGV-------YGIFNSVLFDNICPTPILQKKPS 346

Query: 338 T--------LCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAY 373
           T        L G      D +A  + + +L VGD + F   GAY
Sbjct: 347 TEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAY 390


>AZIN1_RAT RecName: Full=Antizyme inhibitor 1;       
           Short=AZI;AltName: Full=Ornithine decarboxylase antizyme
           inhibitor;
          Length = 448

 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 76/349 (21%), Positives = 135/349 (38%), Gaps = 42/349 (12%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVR--GVDAEVPIAFGGPGKTDAELEGA 104
           +Y VK NS   VL  L  +  GF  ++  E+  V+  GV  E  I +  P K  ++++ A
Sbjct: 65  FYMVKCNSTPAVLEILAALGTGFACSTKNEMALVQELGVSPE-NIIYTSPCKQASQIKYA 123

Query: 105 LRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDE 164
            ++GV ++  ++ ++L ++     R    A VLL       + G       G  +FG   
Sbjct: 124 AKVGVNIMTCDNEVELKKI----ARNHPNAKVLLHIATEDNIGGE-----DGNMKFGTTL 174

Query: 165 ALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHL-ALIDRHIALAKRLRDLHGLTLEW 223
                +L  ++ + +V+++G+  H  S   +   ++ AL D        +    G T+  
Sbjct: 175 KNCRHLLECAKEL-DVQIIGVKFHISSACKEYQVYVHALSDARCVF--DMAGEFGFTMNM 231

Query: 224 LNVGGGI-GIDYQNPERHFDWDRFCHGLAALLRETAP---STRIVFECGRFISAGCGCYV 279
           L++GGG  G + Q  E +       H ++ LL    P     +I+ E G +  +      
Sbjct: 232 LDIGGGFTGTEIQLEEVN-------HVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLA 284

Query: 280 AEVIDLK--RNHDKWFAVLRGGTHHFRL----------PVSWQHNHPFQVLPNDHWDYPF 327
             +I  K   N      V + G+                 + + +     +P  H  Y  
Sbjct: 285 VNIIAKKVVENDKLSSGVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTVPEVHKKYKE 344

Query: 328 PRPVVERQPVTLCGELCTPKDVLAREVPVDRLRVGDRIAFTMAGAYGWH 376
             P+      +L G  C   D +     +  L VGD + F   GA   H
Sbjct: 345 DEPLFTS---SLWGPSCDELDQIVESCLLPELSVGDWLIFDNMGADSLH 390


>SPEA_PHOLL RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 634

 Score = 42.7 bits (99), Expect = 5e-06
 Identities = 60/265 (22%), Positives = 101/265 (38%), Gaps = 26/265 (9%)

Query: 46  LYYAVKANSDAPVLRALLGVAD--GFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEG 103
           L Y +K N    V+ +L    +  G E  S  E+  V              G  D E   
Sbjct: 98  LVYPIKVNQQRRVIESLASSGEPLGLEAGSKAELMAVLAHAGMTRTVIVCNGYKDREYIR 157

Query: 104 ALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGAT 158
              +G  L H     +E   +++++   A R      + +RA  A    G     GG  +
Sbjct: 158 LALIGEKLGHKVYLVIEKMSEIAQVLEEAERLNVIPRLGVRARLASQGSGKWQASGGEKS 217

Query: 159 QFGIDEALLPDVLAQSRTMPNVRVVGL-HVHAGS---NSLDADTHLALIDRHIALAKRLR 214
           +FG+    +  ++   R +  +  + L H H GS   N  D  T +    R      +L 
Sbjct: 218 KFGLAATQVLQLVETLRAVDRLDSLQLLHFHLGSQLANIRDIATGVRESARFYVELHKL- 276

Query: 215 DLHGLTLEWLNVGGGIGIDYQNPERHFDW----------DRFCHGLAALLRETA-PSTRI 263
              G+ ++  +VGGG+G+DY+      D           +    G+     E   P   +
Sbjct: 277 ---GVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNVIWGIGDACDEHGLPHPTV 333

Query: 264 VFECGRFISAGCGCYVAEVIDLKRN 288
           + E GR ++A     V+ VI ++RN
Sbjct: 334 ITESGRALTAHHTVLVSNVIGVERN 358


>SPEA_BACV8 RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 630

 Score = 42.7 bits (99), Expect = 5e-06
 Identities = 63/266 (23%), Positives = 116/266 (43%), Gaps = 33/266 (12%)

Query: 46  LYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGV--DAEVPIAFGGPGKTDA 99
           + Y +K N   PV+  ++        G E  S  E+  V  V  D++  I   G  K ++
Sbjct: 94  IIYPIKVNQMRPVVEEIISHGKKFNLGLEAGSKPELHAVIAVNTDSDSLIICNGY-KDES 152

Query: 100 ELEGAL---RLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGG 155
            +E AL   ++G  + + VE   +L  +  +A++     ++ +R   A    G     GG
Sbjct: 153 YIELALLAQKMGKRIFLVVEKMNELRLIAKMAKQLNVRPNIGIRIKLASSGSGKWEDSGG 212

Query: 156 GATQFGIDEALLPDVL--AQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRL 213
            A++FG+  + L + L   + + M +   + +H H GS      T +  I   +  A + 
Sbjct: 213 DASKFGLTSSELLEALDFLEKKDMKDCLKL-IHFHIGSQV----TKIRRIKTALREASQF 267

Query: 214 R-DLH--GLTLEWLNVGGGIGIDYQ-----NPERHFDW-------DRFCHGLAALLRETA 258
              LH  G  +E++++GGG+G+DY      N E   ++       D     + A  +   
Sbjct: 268 YVQLHVMGFNVEFVDIGGGLGVDYDGTRSANSESSVNYSIQEYVNDSISTLVDASDKNGI 327

Query: 259 PSTRIVFECGRFISAGCGCYVAEVID 284
           P   I+ E GR ++A     + EV++
Sbjct: 328 PHPNIITESGRSLTAHHSVLIFEVLE 353


>Y4YA_RHISN RecName: Full=Uncharacterized protein y4yA;
          Length = 457

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 50/200 (25%), Positives = 79/200 (39%), Gaps = 21/200 (10%)

Query: 45  ALYYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVPIAFG-GPGKTDAELEG 103
           A+YY  KAN    +++A L    G +V+S  E                 GP KT A  + 
Sbjct: 69  AIYYGAKANKSPGLMQAALSAGAGLDVSSLYEXXXXXXXXXXXXXXVATGPAKTSAFHQE 128

Query: 104 ALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGID 163
            +     LI V+S  +L  L            +LLR  P               ++FG+ 
Sbjct: 129 LINCN-ALISVDSPEELEDLIHGLPADAGQQSILLRLRP----------RDQSKSRFGMP 177

Query: 164 EALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRH---IALAKRLRDLHGLT 220
              +   LA+      VR  GLH H   +    +T +A +      IA A+R+    G+ 
Sbjct: 178 PDAVVHCLARLAGEGRVRFDGLHFHL--SGYRRETRVAALREAADLIAEARRMGFFPGM- 234

Query: 221 LEWLNVGGGIGIDYQNPERH 240
              +++GGG+ I Y +  R+
Sbjct: 235 ---IDIGGGLPIQYVDRARY 251


>SPEA_SHEPA RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 61/267 (22%), Positives = 106/267 (39%), Gaps = 35/267 (13%)

Query: 46  LYYAVKANSDAPVLRALLG--VAD-----GFEVASFGEIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L   VA      G E  S  E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQVAKEVPQLGLEAGSKPELMAVLAMAQKASSVIICNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  +   A+  G    + LR   A+   G     
Sbjct: 156 KEYIRLALIGEKLGHKVYIVLEKMSELKVVLEQAKELGVTPRLGLRVRLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEALLPDV---LAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHI 207
           GG  ++FG+  A +  V   L Q   + ++ +  LH H GS   N  D    ++   R  
Sbjct: 216 GGEKSKFGLSAAQVLQVINSLKQENMLESLEL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 208 ALAKRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA--- 258
               +L    G +++  +VGGG+ +DY       +   ++    + + + ++L +     
Sbjct: 274 CELMKL----GASVKCFDVGGGLAVDYDGTRSQSSHSMNYGLTEYANNIVSVLTDMCKEY 329

Query: 259 --PSTRIVFECGRFISAGCGCYVAEVI 283
             P  RI+ E GR+++A     + +VI
Sbjct: 330 EQPMPRIISESGRYLTAHHAVLLTDVI 356


>DCOR2_DROME RecName: Full=Ornithine decarboxylase 2;       
           Short=ODC;         EC=4.1.1.17;AltName: Full=dODC2;
          Length = 393

 Score = 42.0 bits (97), Expect = 9e-06
 Identities = 57/229 (24%), Positives = 96/229 (41%), Gaps = 22/229 (9%)

Query: 47  YYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP-IAFGGPGKTDAELEGAL 105
           +YAVK N D  V++ L  +  GF+ AS  E++ V G+      I F  P +  + L  A 
Sbjct: 58  HYAVKCNDDPVVVKFLADLGTGFDCASKNELKLVLGLGVSPERIIFAHPCRPASHLRYAK 117

Query: 106 RLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEA 165
              V    V++  ++ +L    R+    +++++R         A   +G    ++G D  
Sbjct: 118 EQQVVNGTVDNEYEIYKL----RKHYPDSNLIVRFKSE--AKKALCPLG---DKYGCDXX 168

Query: 166 LLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAK---RLRDLHGLTLE 222
                          +V G   H GS   + + +    DR I  A+   ++ ++ G  +E
Sbjct: 169 XXXXXXXXXXXXXXXKVTGTSFHVGSGCSEVEAY----DRAIEKAENIFKVGEMIGHKME 224

Query: 223 WLNVGGGI-GIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRF 270
            L+VGGG  GID    +  F+        +  LR      RI+ E GRF
Sbjct: 225 LLDVGGGFPGID----DEMFEEIAQSVNTSVELRFPDKRIRIISEPGRF 269


>SPEA_XANCP RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 628

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 41/149 (27%), Positives = 61/149 (40%), Gaps = 19/149 (12%)

Query: 154 GGGATQFGIDEALLPDVLAQSRTMPNVRVVGL-HVHAGS---NSLDADTHLALIDRHIAL 209
           GG   +FG+    + D+    R       + L H H GS   N  D    +    R+   
Sbjct: 209 GGDKAKFGLSPRQVLDLWKSLRDTEYADSLNLLHFHMGSQISNVRDIANGMREATRYFVE 268

Query: 210 AKRLRDLHGLTLEWLNVGGGIGIDYQ----------NPERHFDWDRFCHGLAALLRETA- 258
             RL    G  +  ++VGGG+GIDY+          N   H         LA+   E   
Sbjct: 269 LSRL----GAKISHVDVGGGLGIDYEGTRSRSYCSINYGLHSYASNIVQPLASACEEHGL 324

Query: 259 PSTRIVFECGRFISAGCGCYVAEVIDLKR 287
           P  RIV ECGR ++A     +A V ++++
Sbjct: 325 PPPRIVTECGRAMTAHHAVLIANVSEVEQ 353


>SPEA_NEIMB RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 630

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 64/266 (24%), Positives = 98/266 (36%), Gaps = 30/266 (11%)

Query: 46  LYYAVKANSDAPVLRALL--GVADGFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEG 103
           L Y +K N    V+ +L+  G   G E  S  E+  V              G  D E   
Sbjct: 94  LVYPIKVNQHRRVIESLMSSGQPHGLEAGSKAELMAVLAHAGNRQTLIVCNGYKDREYIR 153

Query: 104 ALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGAT 158
              +G  L H     +E   ++  +   A + G    + +RA  A               
Sbjct: 154 FALMGEKLGHQVYLVIEKLSEIQMVLEEAEKLGIKPRLGVRARLAXXXXXXXXXXXXXXX 213

Query: 159 QFGIDEAL---LPDVLAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHIALAKR 212
            FG+  +    L D+L Q   +  +++  LH H GS   N  D  T +    R      +
Sbjct: 214 XFGLSASQVLQLVDILKQKNRLDCLQL--LHFHLGSQLGNIRDVATGVHESARFYVELHK 271

Query: 213 LRDLHGLTLEWLNVGGGIGIDYQNPERHFDWD----------RFCHGLA-ALLRETAPST 261
           L    G+ +   +VGGG+G+DY+      D                G++ A L    P  
Sbjct: 272 L----GVNIRCFDVGGGLGVDYEGNRTQSDCSVNYSLNEYAATVVWGISQACLEHGLPHP 327

Query: 262 RIVFECGRFISAGCGCYVAEVIDLKR 287
            I+ E GR I+A     VA VI ++R
Sbjct: 328 TIITESGRGITAHHAVLVANVIGVER 353


>SPEA_MARAV RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 58/241 (24%), Positives = 98/241 (40%), Gaps = 32/241 (13%)

Query: 68  GFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRLGVGLIH-----VESTLQLSR 122
           G E  S  E+  V  +  +        G  D E      +G  L H     VE   +L  
Sbjct: 125 GLEAGSKPELMAVLALAKQAGSVIVCNGYKDREYIRLALIGQKLGHRVFIVVEKQSELPL 184

Query: 123 LDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEALLPDV---LAQSRTMPN 179
           +   A++ G    + +RA  A    G     GG  ++FG+  + + DV   L Q+  +  
Sbjct: 185 ILEEAKKLGISPLIGVRARLATIGKGNWQNTGGEKSKFGLSASQVLDVVDTLKQAGALGT 244

Query: 180 VRVVGLHVHAGS---NSLDADTHLALIDRHIALAKRLRDLH--GLTLEWLNVGGGIGIDY 234
           +++  LH H GS   N  D  T L         A+   +LH  G  +  +++GGG+G+DY
Sbjct: 245 LQL--LHFHLGSQIANIRDIQTGLR------ECARFYTELHAMGAPIGTVDIGGGLGVDY 296

Query: 235 QNP------ERHFDWDRFCHGLAALL-----RETAPSTRIVFECGRFISAGCGCYVAEVI 283
           +          ++    + + +  +L     R+  P   ++ E GR ++A     V  VI
Sbjct: 297 EGTRSRSSCSMNYSVFEYAYNVVHVLQSECDRQGIPHPDLISESGRALTAHHSVLVTNVI 356

Query: 284 D 284
           D
Sbjct: 357 D 357


>SPEA_SHEHH RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 59/267 (22%), Positives = 103/267 (38%), Gaps = 35/267 (13%)

Query: 46  LYYAVKANSDAPVLRALLGVAD-------GFEVASFGEIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L           G E  S  E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQVEKEVPQLGLEAGSKPELMAVLAMAQKASSVIICNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  +   A+  G    + LR   A+   G     
Sbjct: 156 KEYIRLALIGEKLGHKVYIVLEKISELKVVLEQAKELGVTPRLGLRVRLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEALLPDV---LAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHI 207
           GG  ++FG+  A +  V   L Q   + ++ +  LH H GS   N  D    ++   R  
Sbjct: 216 GGEKSKFGLSAAQVLQVITSLKQENMLDSLEL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 208 ALAKRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA--- 258
               +L    G  ++  +VGGG+ +DY       +   ++    + + + ++L +     
Sbjct: 274 CELMKL----GANVKCFDVGGGLAVDYDGTRSQSSHSMNYGLTEYANNIVSVLTDMCKEY 329

Query: 259 --PSTRIVFECGRFISAGCGCYVAEVI 283
             P  RI+ E GR+++A     + +VI
Sbjct: 330 EQPMPRIISESGRYLTAHHAVLLTDVI 356


>SPEA_NEIMA RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 630

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 64/266 (24%), Positives = 98/266 (36%), Gaps = 30/266 (11%)

Query: 46  LYYAVKANSDAPVLRALL--GVADGFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEG 103
           L Y +K N    V+ +L+  G   G E  S  E+  V              G  D E   
Sbjct: 94  LVYPIKVNQHRRVIESLMSSGQPHGLEAGSKAELMAVLAHAGTRQTLIVCNGYKDREYIR 153

Query: 104 ALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGAT 158
              +G  L H     +E   ++  +   A + G    + +RA  A               
Sbjct: 154 FALMGEKLGHQVYLVIEKLSEIQMVLEEAEKLGIKPRLGVRARLAXXXXXXXXXXXXXXX 213

Query: 159 QFGIDEAL---LPDVLAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHIALAKR 212
            FG+  +    L D+L Q   +  +++  LH H GS   N  D  T +    R      +
Sbjct: 214 XFGLSASQVLQLVDILKQKNRLDCLQL--LHFHLGSQLGNIRDVATGVHESARFYVELHK 271

Query: 213 LRDLHGLTLEWLNVGGGIGIDYQNPERHFDWD----------RFCHGLA-ALLRETAPST 261
           L    G+ +   +VGGG+G+DY+      D                G++ A L    P  
Sbjct: 272 L----GVNIRCFDVGGGLGVDYEGNRTQSDCSVNYSLNEYAATVVWGISQACLEHGLPHP 327

Query: 262 RIVFECGRFISAGCGCYVAEVIDLKR 287
            I+ E GR I+A     VA VI ++R
Sbjct: 328 TIITESGRGITAHHAVLVANVIGVER 353


>SPEA_SYNPX RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 644

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 47/198 (23%), Positives = 85/198 (42%), Gaps = 24/198 (12%)

Query: 104 ALRLG-VGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGI 162
           A RLG   ++ +E   ++ R+   ++  G    + +RA  +    G      G   +FG+
Sbjct: 166 ARRLGRQPVVVIEQPDEVDRIIEASKSLGAAPYIGVRAKLSSRSTGRWGSSVGDKAKFGL 225

Query: 163 DEALLPDVLA------QSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDL 216
               +P++LA      +S  +P++R+  LH H GS   D       +     +   L  L
Sbjct: 226 S---IPELLATVERLRESNLLPDLRL--LHFHIGSQINDIAVLKDALQEAGQIYVELTRL 280

Query: 217 HGLTLEWLNVGGGIGIDYQN------PERHFDWDRFCHGLAALLRETAPSTRI-----VF 265
            G  + +L+VGGG+GIDY           ++    + + + A +RE      +     V 
Sbjct: 281 -GAPMGFLDVGGGLGIDYDGSRTASAASTNYSLQNYANDVVATVRECCEPNAVAVPTLVS 339

Query: 266 ECGRFISAGCGCYVAEVI 283
           E GR I++     V +V+
Sbjct: 340 ESGRAIASHFSLLVFDVL 357


>SPEA_SHESH RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 38/162 (23%), Positives = 73/162 (45%), Gaps = 23/162 (14%)

Query: 139 RANPAYGLPGATLQMGGGATQFGIDEA---LLPDVLAQSRTMPNVRVVGLHVHAGS---N 192
           R   A+   G     GG  ++FG+  +    + D L QS+ + ++++  LH H GS   N
Sbjct: 201 RVRLAFQGKGKWQASGGEKSKFGLSASQVLTVIDSLKQSQMLDSLQL--LHFHLGSQIAN 258

Query: 193 SLDADTHLALIDRHIALAKRLRDLHGLTLEWLNVGGGIGIDYQ------NPERHFDWDRF 246
             D    ++   R     ++L    G  ++  +VGGG+ +DY       +   ++    +
Sbjct: 259 IRDIRQGVSEAGRFYCELQKL----GANVKCFDVGGGLAVDYDGTRSQSSSSMNYGLTEY 314

Query: 247 CHGLAALLRETA-----PSTRIVFECGRFISAGCGCYVAEVI 283
            + + ++L +       P  RI+ E GRF++A     + +VI
Sbjct: 315 ANNIVSVLTDLCNEYKEPMPRIISESGRFLTAHHAVLITDVI 356


>SPEA_GEOSF RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 635

 Score = 40.4 bits (93), Expect = 3e-05
 Identities = 46/209 (22%), Positives = 91/209 (43%), Gaps = 21/209 (10%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGVDAE----VPIAFG 92
           P +   ++ +K N    V+ A+         G EV S  E+  V G+       +PI   
Sbjct: 90  PAKYQTFFPIKVNQQRQVVEAIASYGKRYNIGLEVGSKPEL--VAGISISSGNNLPIICN 147

Query: 93  GPGKTDAELEGAL---RLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPG 148
           G  K    +E  L    +G  + + +E   +L ++  + ++ G    + +R   +    G
Sbjct: 148 GY-KDSEYIETVLYATAIGYDITLVIEKLFELEKVIELVKKTGIQPRLGIRVKLSSKGTG 206

Query: 149 ATLQMGGGATQFGIDEALLP---DVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDR 205
                GG   +FG+  + +    D+L ++  +  V+++  H H GS     D     +  
Sbjct: 207 KWATSGGEDAKFGLRMSEIIAAIDLLEENGLLDRVKLI--HFHIGSQITKIDKIKTALIE 264

Query: 206 HIALAKRLRDLHGLTLEWLNVGGGIGIDY 234
              +   LR + G+ +E++++GGG+G+DY
Sbjct: 265 GARVYTELRKM-GMGIEFVDIGGGLGVDY 292


>SPEA_VIBPA RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 640

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 63/268 (23%), Positives = 101/268 (37%), Gaps = 27/268 (10%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVAD-------GFEVASFGEIERVRGVDAEVPIAFGG 93
           P +  L Y +K N    V+  +L           G E  S  E+  V  +  +       
Sbjct: 95  PNKYLLVYPIKVNQQREVVDEILASQAQLETKQLGLEAGSKPELLAVLALAQQGSSVIVC 154

Query: 94  PGKTDAELEGALRLGVGLIHVESTL--QLSRLDAV---ARRQGRCADVLLRANPAYGLPG 148
            G  D E      +G  L H    +  +LS LD V   A+  G    + LR   A    G
Sbjct: 155 NGYKDREYVRLALIGEKLGHKVFIVLEKLSELDLVLEEAKSLGVKPRLGLRIRLASQGAG 214

Query: 149 ATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGL-HVHAGSNSLDADTHLALIDRHI 207
                GG  ++FG+  + +  V+ + +   ++  + L H H GS   +       ++   
Sbjct: 215 KWQASGGEKSKFGLSASQVLSVIERLKREGSLDAMQLVHFHLGSQMANIRDVRNGVNESA 274

Query: 208 ALAKRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETA--------- 258
                LR L G  +E+ +VGGG+ +DY    R    +   +GLA   R            
Sbjct: 275 RFYCELRAL-GANIEYFDVGGGLAVDYDG-TRSQSSNSMNYGLAEYARNIVNTVGDVCQQ 332

Query: 259 ---PSTRIVFECGRFISAGCGCYVAEVI 283
              P   I+ E GR ++A     ++ VI
Sbjct: 333 YEQPMPVIISESGRSLTAHHAVLISNVI 360


>SPEA_SHEPW RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 59/267 (22%), Positives = 102/267 (38%), Gaps = 35/267 (13%)

Query: 46  LYYAVKANSDAPVLRALLGVAD-------GFEVASFGEIERVRGVDAEVPIAFGGPGKTD 98
           L Y +K N    V+  +L           G E  S  E+  V  +  +        G  D
Sbjct: 96  LVYPIKVNQQQTVVEEILASQVEKEVPQLGLEAGSKPELLAVLAMAQKASSVIICNGYKD 155

Query: 99  AELEGALRLGVGLIH-----VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQM 153
            E      +G  L H     +E   +L  +   A+  G    + LR   A+   G     
Sbjct: 156 KEYIRLALIGEKLGHKVYIVLEKMSELKVVLEQAKELGVTPRLGLRVRLAFQGKGKWQAS 215

Query: 154 GGGATQFGIDEALLPDV---LAQSRTMPNVRVVGLHVHAGS---NSLDADTHLALIDRHI 207
           GG  ++FG+  A +  V   L     + ++ +  LH H GS   N  D    ++   R  
Sbjct: 216 GGEKSKFGLSAAQVLKVIELLQHEEMLDSLEL--LHFHLGSQIANIRDIRQGVSEAGRFY 273

Query: 208 ALAKRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETA--- 258
               +L    G  ++  +VGGG+ +DY       N   ++    + + + ++L +     
Sbjct: 274 CELMKL----GAQVKCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVSVLTDMCKEY 329

Query: 259 --PSTRIVFECGRFISAGCGCYVAEVI 283
             P  RI+ E GR+++A     + +VI
Sbjct: 330 EQPMPRIISESGRYLTAHHAVLLTDVI 356


>SPEA_XYLFM RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 628

 Score = 39.7 bits (91), Expect = 5e-05
 Identities = 65/262 (24%), Positives = 103/262 (39%), Gaps = 28/262 (10%)

Query: 48  YAVKANSD---APVLRALLGVADGFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEGA 104
           Y +K N     A VL +  G   G E  S  E+  V  +  +  +      K    +  A
Sbjct: 96  YPIKVNQHRGVAGVLASHQGDGFGLEAGSKPELMAVLALSRQGGLIVCNGYKDREYIRLA 155

Query: 105 L---RLGVG-LIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQF 160
           L   +LG+   I +E   +L  +   A+  G    + +R   A    G     GG   +F
Sbjct: 156 LIGRKLGLKTFIVIEKPSELRMVLEEAKTLGVLPGLGVRVRLASLGAGKWQNSGGDKAKF 215

Query: 161 GIDEALLPDVLAQSRTMPNVRVVG-LHVHAGS---NSLDADTHLALIDRHIALAKRLRDL 216
           G+    + DV    R       +  +H H GS   N  D    +    R+     RL   
Sbjct: 216 GLSPRQVLDVWKVLRGTEYADCLNVMHFHMGSQISNVRDIAKGMREATRYFVELSRL--- 272

Query: 217 HGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAA----LLRETAPS--------TRIV 264
            G  +  ++VGGG+GIDY+      D     +GL A    +++  A +         RIV
Sbjct: 273 -GAKITHVDVGGGLGIDYEGTRSRSDCS-INYGLQAYASHIVQPLASACEDYDLVPPRIV 330

Query: 265 FECGRFISAGCGCYVAEVIDLK 286
            ECGR ++A     +A V +++
Sbjct: 331 TECGRAMTAHHAVLIANVTEVE 352


>SPEA_VIBVU RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 641

 Score = 39.7 bits (91), Expect = 5e-05
 Identities = 66/309 (21%), Positives = 110/309 (35%), Gaps = 43/309 (13%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVAD--------GFEVASFGEIERVRGVDAEVPIAFG 92
           P +  L Y +K N    V+  +L  +         G E  S  E+  V  +         
Sbjct: 95  PNKYLLVYPIKVNQQREVVDEILAASQAQLETKQLGLEAGSKPELLAVLAMAQHASSVIV 154

Query: 93  GPGKTDAELEGALRLGVGLIHVESTL--QLSRLDAVARRQ---GRCADVLLRANPAYGLP 147
             G  D E      +G  L H    +  ++S LD V R     G    + +R   A    
Sbjct: 155 CNGYKDREYIRLALIGEKLGHKVFIVLEKMSELDLVLREAKSLGVTPRLGIRIRLASQGA 214

Query: 148 GATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGL-HVHAGSNSLDADTHLALIDRH 206
           G     GG  ++FG+  + + +V+++ +    +  + L H H GS   +       ++  
Sbjct: 215 GKWQASGGEKSKFGLSASQVLNVISRLKKENQLDTLQLVHFHLGSQMANIRDVRNGVNES 274

Query: 207 IALAKRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETA-------- 258
                 LR L G  + + +VGGG+ IDY    R    +   +GL    R           
Sbjct: 275 ARFYCELRTL-GANITYFDVGGGLAIDYDG-TRSQSSNSMNYGLVEYARNIVNTVGDVCK 332

Query: 259 ----PSTRIVFECGRFISAGCGCYVAEVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHP 314
               P   I+ E GR ++A     ++ VI               GT  ++     +    
Sbjct: 333 DYKQPMPVIISESGRSLTAHHAVLISNVI---------------GTETYKPETVTEPEED 377

Query: 315 FQVLPNDHW 323
           F +L N+ W
Sbjct: 378 FPLLLNNMW 386


>SPEA_XYLFA RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 628

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 65/262 (24%), Positives = 102/262 (38%), Gaps = 28/262 (10%)

Query: 48  YAVKANSD---APVLRALLGVADGFEVASFGEIERVRGVDAEVPIAFGGPGKTDAELEGA 104
           Y +K N     A VL +  G   G E  S  E+  V  +     +      K    +  A
Sbjct: 96  YPIKVNQHRGVAGVLASHQGDGFGLEAGSKPELMAVLALSRPGGLIVCNGYKDREYIRLA 155

Query: 105 L---RLGVG-LIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQF 160
           L   +LG+   I +E   +L  +   A+  G    + +R   A    G     GG   +F
Sbjct: 156 LIGRKLGLKTFIVIEKPSELRMVLEEAKTLGVLPGLGVRVRLASLGAGKWQNSGGDKAKF 215

Query: 161 GIDEALLPDVLAQSRTMPNVRVVG-LHVHAGS---NSLDADTHLALIDRHIALAKRLRDL 216
           G+    + DV    R       +  +H H GS   N  D    +    R+     RL   
Sbjct: 216 GLSPRQVLDVWKVLRGTEYADCLNVMHFHMGSQISNVRDIAKGMREATRYFVELSRL--- 272

Query: 217 HGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAA----LLRETAPS--------TRIV 264
            G  +  ++VGGG+GIDY+      D     +GL A    +++  A +         RIV
Sbjct: 273 -GAKITHVDVGGGLGIDYEGTRSRSDCS-INYGLQAYASHIVQPLASACEDYDLVPPRIV 330

Query: 265 FECGRFISAGCGCYVAEVIDLK 286
            ECGR ++A     +A V +++
Sbjct: 331 TECGRAMTAHHAVLIANVTEVE 352


>SPEA_XANAC RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 628

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 42/151 (27%), Positives = 62/151 (41%), Gaps = 23/151 (15%)

Query: 154 GGGATQFGIDEALLPDVLAQSRTMPNVRVVGL-HVHAGS---NSLDADTHLALIDRHIAL 209
           GG   +FG+    + D+    R       + L H H GS   N  D    +    R+   
Sbjct: 209 GGDKAKFGLSPRQVLDLWKTLRDTEYADSLNLLHFHMGSQISNVRDIANGMREATRYFVE 268

Query: 210 AKRLRDLHGLTLEWLNVGGGIGIDYQ----------NPERHFDWDRFCHGLAALLRE--- 256
             RL    G  +  ++VGGG+GIDY+          N   H         LA+   E   
Sbjct: 269 LSRL----GAKISHVDVGGGLGIDYEGTRSRSYCSINYGLHSYASNIVQPLASACEEHGL 324

Query: 257 TAPSTRIVFECGRFISAGCGCYVAEVIDLKR 287
           T P  RIV ECGR ++A     +A V ++++
Sbjct: 325 TPP--RIVTECGRAMTAHHAVLIANVSEVEQ 353


>SPEA_PROMP RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 648

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 28/144 (19%), Positives = 62/144 (43%), Gaps = 19/144 (13%)

Query: 155 GGATQFGIDEALLPDVLAQSRTMPNVRVVG----LHVHAGSNSLDADTHLALIDRHIALA 210
           G  ++FG+    +P+++   + +    ++     LH H GS   D       +     + 
Sbjct: 222 GDNSKFGLS---IPEIMLTIKELKEANLINEMMLLHFHVGSQISDISVIKDALQEASQIF 278

Query: 211 KRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFCHGLAALLRETAPSTR-- 262
             L  L G  +++++VGGG+GID+       N   ++    + + + A ++++       
Sbjct: 279 VELSKL-GAPMKYIDVGGGLGIDFDGTKMSSNTSTNYSLQNYANDVIATVKDSCEVNNIQ 337

Query: 263 ---IVFECGRFISAGCGCYVAEVI 283
              I+ E GR I + C   +  ++
Sbjct: 338 HPIIISESGRAIISHCSVLIFNIL 361


>SPEA_XYLFT RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 628

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 21/149 (14%)

Query: 154 GGGATQFGIDEALLPDVLAQSRTMPNVRVVG-LHVHAGS---NSLDADTHLALIDRHIAL 209
           GG   +FG+    + DV    R       +  +H H GS   N  D    +    R+   
Sbjct: 209 GGDKAKFGLSPRQVLDVWKVLRGTEYADCLNVMHFHMGSQISNVRDIAKGMREATRYFVE 268

Query: 210 AKRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAA----LLRETAPS----- 260
             RL    G  +  ++VGGG+GIDY+      D     +GL A    +++  A +     
Sbjct: 269 LSRL----GAKITHVDVGGGLGIDYEGTRSRSDCS-INYGLQAYASHIVQPLASACEDYD 323

Query: 261 ---TRIVFECGRFISAGCGCYVAEVIDLK 286
               RIV ECGR ++A     +A V +++
Sbjct: 324 LVPPRIVTECGRAMTAHHAVLIANVTEVE 352


>SPEA_XYLF2 RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 628

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 21/149 (14%)

Query: 154 GGGATQFGIDEALLPDVLAQSRTMPNVRVVG-LHVHAGS---NSLDADTHLALIDRHIAL 209
           GG   +FG+    + DV    R       +  +H H GS   N  D    +    R+   
Sbjct: 209 GGDKAKFGLSPRQVLDVWKVLRGTEYADCLNVMHFHMGSQISNVRDIAKGMREATRYFVE 268

Query: 210 AKRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAA----LLRETAPS----- 260
             RL    G  +  ++VGGG+GIDY+      D     +GL A    +++  A +     
Sbjct: 269 LSRL----GAKITHVDVGGGLGIDYEGTRSRSDCS-INYGLQAYASHIVQPLASACEDYD 323

Query: 261 ---TRIVFECGRFISAGCGCYVAEVIDLK 286
               RIV ECGR ++A     +A V +++
Sbjct: 324 LVPPRIVTECGRAMTAHHAVLIANVTEVE 352


>SPEA_HAMD5 RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 633

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 40/189 (21%), Positives = 76/189 (40%), Gaps = 17/189 (8%)

Query: 114 VESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEAL---LPDV 170
           +E   ++  +   A+R      + +RA  A    G     GG  ++FG+       L ++
Sbjct: 172 IEKMSEIKMVLEEAKRLNVVPRLGVRARLASEGSGKWQASGGEKSKFGLSATQVLQLVEI 231

Query: 171 LAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLNVGGGI 230
           L  +  +  +++  LH H GS   +       +         L  L G+ +   +VGGG+
Sbjct: 232 LKSADCLSGLQL--LHFHLGSQLSNIHDIATGVRESARFYVELHKL-GVKISCFDVGGGL 288

Query: 231 GIDYQNPERHFDW----------DRFCHGLAALLRET-APSTRIVFECGRFISAGCGCYV 279
           G+DY+      D           +    G+  +  E   P   ++ E GR ++A     +
Sbjct: 289 GVDYEGTRSQSDCSVNYGLKEYANNVIWGIGEICNENHLPHPTVISESGRALTAHHTVLI 348

Query: 280 AEVIDLKRN 288
           + VI ++RN
Sbjct: 349 SNVIGVERN 357


>SPEA_DEIRA RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 662

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 45/188 (23%), Positives = 75/188 (39%), Gaps = 15/188 (7%)

Query: 111 LIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGGGATQFGIDEALLPDV 170
           +I +E   +L R+   A+  G    V +R        G   + GG   +FG++ A     
Sbjct: 195 VITIEKFTELDRILKQAKALGVKPAVGVRFKLHARGSGQWEESGGDQAKFGLN-AYXXXX 253

Query: 171 LAQSRTMPNV--RVVGLHVHAGSNSLDADTHLALIDRHIALAKRLRDLHGLTLEWLNVGG 228
                   N+   +V LH H GS   D    + +  R  A         G  L++LNVGG
Sbjct: 254 XXXXXXXXNMLDSLVMLHTHIGSQITDI-RRVKVAVREAAQTYAGLIAAGADLKYLNVGG 312

Query: 229 GIGIDYQNPE------RHFDWDRFCHGLAALLRET-----APSTRIVFECGRFISAGCGC 277
           G+G+DY   +       ++    +   +   ++E       P   IV E GR ++A    
Sbjct: 313 GLGVDYDGSKTTFYASMNYTVKEYAADIVYTVQEVCKAREVPEPVIVSESGRALTAHHAV 372

Query: 278 YVAEVIDL 285
            +  V+D+
Sbjct: 373 LILPVVDV 380


>SPEA_BACFR RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 630

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 57/266 (21%), Positives = 111/266 (41%), Gaps = 33/266 (12%)

Query: 46  LYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGV--DAEVPIAFGGPGKTDA 99
           + Y +K N   PV+  ++        G E  S  E+  V  V  D++  I   G  K ++
Sbjct: 94  IIYPIKVNQMRPVVEEIISHGKKFNLGLEAGSKPELHAVIAVNTDSDSLIICNGY-KDES 152

Query: 100 ELEGAL---RLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGG 155
            +E AL   ++G  + + VE   +L  +  +A++     ++ +R   A            
Sbjct: 153 YIELALLAQKMGKRIFLVVEKMNELKLIARMAKQLNVQPNIGIRIKLAXXXXXXXXXXXX 212

Query: 156 GATQFGIDEALLPDVL--AQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRL 213
            A++FG+  + L + L   +S+ M +   + +H H GS      T +  I   +  A + 
Sbjct: 213 DASKFGLTSSELLEALDFLESKGMKDCLKL-IHFHIGSQV----TKIRRIKTALREASQF 267

Query: 214 R-DLH--GLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRET------------A 258
              LH  G  +E++++GGG+G+DY             + +   + ++             
Sbjct: 268 YVQLHAMGFNVEFVDIGGGLGVDYDGTRXXXXXXXVNYSIQEYVNDSISTLVDASDKNGI 327

Query: 259 PSTRIVFECGRFISAGCGCYVAEVID 284
           P   I+ E GR ++A     + EV++
Sbjct: 328 PHPNIITESGRALTAHHSVLIFEVLE 353


>SPEA_BACFN RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 630

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 57/266 (21%), Positives = 111/266 (41%), Gaps = 33/266 (12%)

Query: 46  LYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGV--DAEVPIAFGGPGKTDA 99
           + Y +K N   PV+  ++        G E  S  E+  V  V  D++  I   G  K ++
Sbjct: 94  IIYPIKVNQMRPVVEEIISHGKKFNLGLEAGSKPELHAVIAVNTDSDSLIICNGY-KDES 152

Query: 100 ELEGAL---RLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGG 155
            +E AL   ++G  + + VE   +L  +  +A++     ++ +R   A            
Sbjct: 153 YIELALLAQKMGKRIFLVVEKMNELKLIARMAKQLNVQPNIGIRIKLAXXXXXXXXXXXX 212

Query: 156 GATQFGIDEALLPDVL--AQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRL 213
            A++FG+  + L + L   +S+ M +   + +H H GS      T +  I   +  A + 
Sbjct: 213 DASKFGLTSSELLEALDFLESKGMKDCLKL-IHFHIGSQV----TKIRRIKTALREASQF 267

Query: 214 R-DLH--GLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRET------------A 258
              LH  G  +E++++GGG+G+DY             + +   + ++             
Sbjct: 268 YVQLHAMGFNVEFVDIGGGLGVDYDGTRXXXXXXXVNYSIQEYVNDSISTLVDASDKNGI 327

Query: 259 PSTRIVFECGRFISAGCGCYVAEVID 284
           P   I+ E GR ++A     + EV++
Sbjct: 328 PHPNIITESGRALTAHHSVLIFEVLE 353


>SPEA_SHELP RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 637

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 34/161 (21%), Positives = 71/161 (44%), Gaps = 19/161 (11%)

Query: 138 LRANPAYGLPGATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGL-HVHAGS---NS 193
           LR   A+   G     GG  ++FG+  A + +V+   +    +  + L H H GS   N 
Sbjct: 200 LRVRLAFQGKGKWQASGGEKSKFGLSAAQVLNVINSLKDEDMLDSLQLLHFHLGSQIANI 259

Query: 194 LDADTHLALIDRHIALAKRLRDLHGLTLEWLNVGGGIGIDY------QNPERHFDWDRFC 247
            D  + ++   R     +++    G  ++  +VGGG+ +DY       +   ++    + 
Sbjct: 260 RDIRSGVSEAGRFYCELQKM----GANVKCFDVGGGLAVDYDGTRSQSSNSMNYGLTEYA 315

Query: 248 HGLAALLRETA-----PSTRIVFECGRFISAGCGCYVAEVI 283
           + + ++L +       P  R++ E GR+++A     + +VI
Sbjct: 316 NNIVSVLNDMCREHDQPMPRLISESGRYLTAHHAVLITDVI 356


>SPEA_PASMU RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 644

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 18/117 (15%)

Query: 185 LHVHAGS---NSLDADTHLALIDRHIALAKRLRDLHGLTLEWLNVGGGIGIDYQNPERHF 241
           LH H GS   N  D  T +    R      +L    G+ ++  +VGGG+G+DY+      
Sbjct: 255 LHFHLGSQLGNIRDVATGVRESARFYVELHKL----GVNIQCFDVGGGLGVDYEGNRTQS 310

Query: 242 DW----------DRFCHGLAALLRETA-PSTRIVFECGRFISAGCGCYVAEVIDLKR 287
           D           D    G+    RE   P   I+ E GR ++A     V+ VI ++R
Sbjct: 311 DCSVNYGLNEYADTVVWGIGQACREHGLPHPTIITESGRGVTAHHAVLVSNVIGVER 367


>SPEA_BACTN RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 630

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 57/266 (21%), Positives = 114/266 (42%), Gaps = 33/266 (12%)

Query: 46  LYYAVKANSDAPVLRALLGVAD----GFEVASFGEIERVRGV--DAEVPIAFGGPGKTDA 99
           + Y +K N   PV+  ++        G E  S  E+  V  V  D++  I   G  K ++
Sbjct: 94  IIYPIKVNQMRPVVEEIISHGKKFNLGLEAGSKPELHAVIAVNTDSDSLIVCNGY-KDES 152

Query: 100 ELEGAL---RLGVGL-IHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGATLQMGG 155
            +E AL   ++G  + + VE   +L  +  +A++     ++ +R   A            
Sbjct: 153 YIELALLAQKMGKRIFLVVEKMNELKLIAKMAKQLNVQPNIGIRIKLAXXXXXXXXXXXX 212

Query: 156 GATQFGIDEALLPDVL--AQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRL 213
            A++FG+  + L + L   +S+ + +   + +H H GS      T +  I   +  A + 
Sbjct: 213 DASKFGLTSSELLEALDFMESKGLKDCLKL-IHFHIGSQV----TKIRRIKTALREASQF 267

Query: 214 R-DLH--GLTLEWLNVGGGIGIDYQNPER-------HFDWDRFCHGLAALLRETA----- 258
              LH  G  +E++++GGG+G+DY            ++    + +   + L + +     
Sbjct: 268 YVQLHSMGFNVEFVDIGGGLGVDYDGTRSSNSEGSVNYSIQEYVNDSISTLVDVSDKNGI 327

Query: 259 PSTRIVFECGRFISAGCGCYVAEVID 284
           P   I+ E GR ++A     + EV++
Sbjct: 328 PHPNIITESGRALTAHHSVLIFEVLE 353


>SPEA_GEOLS RecName: Full=Biosynthetic arginine decarboxylase;      
             Short=ADC;         EC=4.1.1.19;
          Length = 635

 Score = 35.4 bits (80), Expect = 9e-04
 Identities = 21/92 (22%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 154 GGGATQFGIDEALLPDVLAQSRTMPNVRVVG----LHVHAGSNSLDADTHLALIDRHIAL 209
           GG   +FG+    + +++A  + +    ++     LH H GS     D     +     +
Sbjct: 212 GGEDAKFGLR---MSEIMAAIKMLQEADLLDCVNLLHSHIGSQVTKIDKIKTALIEAARI 268

Query: 210 AKRLRDLHGLTLEWLNVGGGIGIDYQNPERHF 241
              +R L G+ +++L++GGG+G+DY   +  +
Sbjct: 269 YSEMRKL-GVNIQYLDIGGGLGVDYDGSKSSY 299


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.316    0.129    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 11,048,558,497
Number of extensions: 442683655
Number of successful extensions: 1085721
Number of sequences better than 1.0e-03: 21479
Number of HSP's gapped: 1048714
Number of HSP's successfully gapped: 24936
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)