BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABF09387.1 rmet0 ABF09387.1 GIB00349CH01 "Lysine exporter
protein (LYSE/YGGA)"
         (209 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EAMB_SALTI RecName: Full=Cysteine/O-acetylserine efflux protein;       93   2e-21
EAMB_SALPA RecName: Full=Cysteine/O-acetylserine efflux protein;       93   2e-21
EAMB_SALTY RecName: Full=Cysteine/O-acetylserine efflux protein;       91   9e-21
EAMB_SALCH RecName: Full=Cysteine/O-acetylserine efflux protein;       91   9e-21
EAMB_ECO24 RecName: Full=Cysteine/O-acetylserine efflux protein;       89   5e-20
EAMB_SHISS RecName: Full=Cysteine/O-acetylserine efflux protein;       88   6e-20
EAMB_SHIFL RecName: Full=Cysteine/O-acetylserine efflux protein;       88   6e-20
EAMB_SHIF8 RecName: Full=Cysteine/O-acetylserine efflux protein;       88   6e-20
EAMB_ECOUT RecName: Full=Cysteine/O-acetylserine efflux protein;       88   6e-20
EAMB_ECOLI RecName: Full=Cysteine/O-acetylserine efflux protein;       88   6e-20
EAMB_ECOL6 RecName: Full=Cysteine/O-acetylserine efflux protein;       88   6e-20
EAMB_ECOL5 RecName: Full=Cysteine/O-acetylserine efflux protein;       88   6e-20
EAMB_ECOK1 RecName: Full=Cysteine/O-acetylserine efflux protein;       88   6e-20
EAMB_ECOHS RecName: Full=Cysteine/O-acetylserine efflux protein;       88   6e-20
EAMB_ECO57 RecName: Full=Cysteine/O-acetylserine efflux protein;       86   3e-19
EAMB_SHIBS RecName: Full=Cysteine/O-acetylserine efflux protein;       85   5e-19
EAMB_KLEP7 RecName: Full=Cysteine/O-acetylserine efflux protein;       74   1e-15
LEUE_KLEP7 RecName: Full=Leucine efflux protein;                       54   9e-10
LEUE_ECOLI RecName: Full=Leucine efflux protein;                       49   5e-08
LEUE_ECOHS RecName: Full=Leucine efflux protein;                       49   5e-08
LEUE_SHISS RecName: Full=Leucine efflux protein;                       47   2e-07
LEUE_SHIDS RecName: Full=Leucine efflux protein;                       47   2e-07
LEUE_ECOUT RecName: Full=Leucine efflux protein;                       47   2e-07
LEUE_ECOL6 RecName: Full=Leucine efflux protein;                       47   2e-07
LEUE_ECOL5 RecName: Full=Leucine efflux protein;                       47   2e-07
LEUE_ECOK1 RecName: Full=Leucine efflux protein;                       47   2e-07
LEUE_ECO24 RecName: Full=Leucine efflux protein;                       47   2e-07
LEUE_SHIBS RecName: Full=Putative leucine efflux protein;              47   2e-07
LEUE_ECO57 RecName: Full=Leucine efflux protein;                       46   3e-07
LEUE_ENT38 RecName: Full=Leucine efflux protein;                       45   7e-07
Y1307_HAEIN RecName: Full=Uncharacterized membrane protein HI1307;     44   1e-06
Y4757_PSEAE RecName: Full=Uncharacterized membrane protein PA4757;     44   2e-06
YISU_BACSU RecName: Full=Putative amino-acid transporter yisU;         40   1e-05
RHTB_SHIFL RecName: Full=Homoserine/homoserine lactone efflux pr...    40   1e-05
RHTB_ECOLI RecName: Full=Homoserine/homoserine lactone efflux pr...    40   1e-05
RHTB_ECOL6 RecName: Full=Homoserine/homoserine lactone efflux pr...    40   1e-05
RHTB_ECO57 RecName: Full=Homoserine/homoserine lactone efflux pr...    40   1e-05
RHTC_SALTY RecName: Full=Threonine efflux protein;                     39   5e-05
RHTC_SALTI RecName: Full=Threonine efflux protein;                     39   5e-05
ARGO_SHIFL RecName: Full=Arginine exporter protein argO;               36   3e-04
ARGO_ECO57 RecName: Full=Arginine exporter protein argO;               36   3e-04
SYE_TRIEI RecName: Full=Glutamyl-tRNA synthetase;         EC=6.1...    36   3e-04
YAHN_ECOLI RecName: Full=Uncharacterized membrane protein yahN;        35   5e-04

>EAMB_SALTI RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 92.8 bits (229), Expect = 2e-21
 Identities = 55/190 (28%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A       G R ++    G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAGMSLGFLVVMLLCAGIAFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P +  ++  VG  Y+LWLA++IA S +  EK   KP+  W S  LQ+ N+K  +  +  
Sbjct: 68  DPAIIHLLSWVGAAYILWLAWKIATSPAADEKVRPKPVGFWVSFGLQFVNVKIILYGITA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         V+ VS + AL G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALNWVIGVSILLALIGTFGNVCWALAGHLFQR------AFRHYGRQLNII 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_SALPA RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 92.8 bits (229), Expect = 2e-21
 Identities = 55/190 (28%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A       G R ++    G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAGMSLGFLVVMLLCAGIAFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P +  ++  VG  Y+LWLA++IA S +  EK   KP+  W S  LQ+ N+K  +  +  
Sbjct: 68  DPAIIHLLSWVGAAYILWLAWKIATSPAADEKVRPKPVGFWVSFGLQFVNVKIILYGITA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         V+ VS + AL G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALNWVIGVSILLALIGTFGNVCWALAGHLFQR------AFRHYGRQLNII 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_SALTY RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 90.9 bits (224), Expect = 9e-21
 Identities = 54/190 (28%), Positives = 89/190 (46%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A       G R ++    G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAGMSLGFLVVMLLCAGIAFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P +  ++  VG  Y+LWLA++IA S +  E    KP+  W S  LQ+ N+K  +  +  
Sbjct: 68  DPAIIHLLSWVGAAYILWLAWKIATSPAADENARPKPVGFWVSFGLQFVNVKIILYGITA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         V+ VS + AL G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALNWVIGVSILLALIGTFGNVCWALAGHLFQR------AFRHYGRQLNII 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_SALCH RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 90.9 bits (224), Expect = 9e-21
 Identities = 54/190 (28%), Positives = 89/190 (46%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A       G R ++    G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAGMSLGFLVVMLLCAGIAFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P +  ++  VG  Y+LWLA++IA S +  E    KP+  W S  LQ+ N+K  +  +  
Sbjct: 68  DPAIIHLLSWVGAAYILWLAWKIATSPAADENARPKPVGFWVSFGLQFVNVKIILYGITA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         V+ VS + AL G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALNWVIGVSILLALIGTFGNVCWALAGHLFQR------AFRHYGRQLNII 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_ECO24 RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.6 bits (218), Expect = 5e-20
 Identities = 53/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  I+ AV
Sbjct: 182 LALLLIYCAV 191


>EAMB_SHISS RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_SHIFL RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_SHIF8 RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_ECOUT RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_ECOLI RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_ECOL6 RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_ECOL5 RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_ECOK1 RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_ECOHS RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 52/190 (27%), Positives = 90/190 (47%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_ECO57 RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 85.9 bits (211), Expect = 3e-19
 Identities = 51/190 (26%), Positives = 88/190 (46%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TPGPN  +A  +    G   +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPGPNNILALSSATTHGFHQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         +V VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWIVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  I+ AV
Sbjct: 182 LALLLIYCAV 191


>EAMB_SHIBS RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 195

 Score = 85.1 bits (209), Expect = 5e-19
 Identities = 51/190 (26%), Positives = 89/190 (46%), Gaps = 6/190 (3%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A  T   + A TP PN  +A  +  + G R +     G+S GF  ++ LC     +L + 
Sbjct: 8   AFWTYTLITAMTPRPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVI 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
            P    ++   G  Y++WLA++IA S +  +    KP++ W S ALQ+ N+K  +  +  
Sbjct: 68  DPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTA 127

Query: 135 AASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLA 194
            ++++         VV VS + A+ G F N  + + G   +R        R +   + + 
Sbjct: 128 LSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIV 181

Query: 195 LALTAIWIAV 204
           LAL  ++ AV
Sbjct: 182 LALLLVYCAV 191


>EAMB_KLEP7 RecName: Full=Cysteine/O-acetylserine efflux protein;
          Length = 196

 Score = 73.9 bits (180), Expect = 1e-15
 Identities = 36/125 (28%), Positives = 64/125 (51%)

Query: 15  ALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILA 74
           A +T   + A TPGPN  +A  +  + GLR +L    G+S GF   + +C     +L+  
Sbjct: 8   AFLTYTLITALTPGPNNILALSSVTSHGLRRSLRVLAGMSVGFIITMLICAALTFSLVEL 67

Query: 75  SPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAV 134
                 V+  +G  Y+LWLA++IA+S        ++P+  W S  LQ+ N+K  +  +  
Sbjct: 68  DSRFTLVLGWIGAAYILWLAWQIAKSKPATGTPSVEPVGFWASLGLQFVNVKIILYGITA 127

Query: 135 AASYM 139
            ++++
Sbjct: 128 LSTFV 132


>LEUE_KLEP7 RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 54.3 bits (129), Expect = 9e-10
 Identities = 48/170 (28%), Positives = 73/170 (42%), Gaps = 26/170 (15%)

Query: 4   WLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVAL 63
           +LT L  A F+ LV         PGPNT     TG   G++       GV  G A ++ L
Sbjct: 10  YLTYLVGAVFIILV---------PGPNTFFVLKTGIAHGVKKGYLAAAGVFIGDAVLMFL 60

Query: 64  CTTGVGALILASPMLATVIHVVGVLYLLW---------LAYRIARSTSLAE--KTVLKPM 112
              GV  LI  +P+L  V+  +G +YLLW         L  R  +S + AE    +LK  
Sbjct: 61  AFAGVATLIKTTPVLFNVVRYLGAIYLLWLGGKMLYAVLTQRDGQSDASAEPASAILK-- 118

Query: 113 NVWQSAALQYANIKAWMLALAVAASYM-AGAPSPGQRVVLVSAIFALFGF 161
              +S  L   N KA +  ++    ++   A +PG    +++    +  F
Sbjct: 119 ---RSLTLSLTNPKAILFYVSFFVQFIDVNAKTPGVAFFILALTLEVISF 165


>LEUE_ECOLI RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 48.5 bits (114), Expect = 5e-08
 Identities = 36/142 (25%), Positives = 59/142 (41%), Gaps = 7/142 (4%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARSTSLAEKTVLKPMNVWQSA------ALQYANIKAWMLALAVAASYM- 139
             YLL+L  +I  +T   + +  K       A       L   N KA +  ++    ++ 
Sbjct: 84  AFYLLYLGSKILYATLKGKNSEAKSDEPQYGAIFKRALILSLTNPKAILFYVSFFVQFID 143

Query: 140 AGAPSPGQRVVLVSAIFALFGF 161
             AP  G    +++A   L  F
Sbjct: 144 VNAPHTGISFFILAATLELVSF 165


>LEUE_ECOHS RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 48.5 bits (114), Expect = 5e-08
 Identities = 36/142 (25%), Positives = 59/142 (41%), Gaps = 7/142 (4%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARSTSLAEKTVLKPMNVWQSA------ALQYANIKAWMLALAVAASYM- 139
             YLL+L  +I  +T   + +  K       A       L   N KA +  ++    ++ 
Sbjct: 84  AFYLLYLGSKILYATLKGKNSEAKSDEPQYGAIFKRALILSLTNPKAILFYVSFFVQFID 143

Query: 140 AGAPSPGQRVVLVSAIFALFGF 161
             AP  G    +++A   L  F
Sbjct: 144 VNAPHTGISFFILAATLELVSF 165


>LEUE_SHISS RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARST 101
             YLL+L  +I  +T
Sbjct: 84  AFYLLYLGSKILYAT 98


>LEUE_SHIDS RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARST 101
             YLL+L  +I  +T
Sbjct: 84  AFYLLYLGSKILYAT 98


>LEUE_ECOUT RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARST 101
             YLL+L  +I  +T
Sbjct: 84  AFYLLYLGSKILYAT 98


>LEUE_ECOL6 RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARST 101
             YLL+L  +I  +T
Sbjct: 84  AFYLLYLGSKILYAT 98


>LEUE_ECOL5 RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARST 101
             YLL+L  +I  +T
Sbjct: 84  AFYLLYLGSKILYAT 98


>LEUE_ECOK1 RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARST 101
             YLL+L  +I  +T
Sbjct: 84  AFYLLYLGSKILYAT 98


>LEUE_ECO24 RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARST 101
             YLL+L  +I  +T
Sbjct: 84  AFYLLYLGSKILYAT 98


>LEUE_SHIBS RecName: Full=Putative leucine efflux protein;
          Length = 191

 Score = 46.6 bits (109), Expect = 2e-07
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   GV  LI  +P+L  ++  +G
Sbjct: 3   PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIKTTPILFNIVRYLG 62

Query: 87  VLYLLWLAYRIARST 101
             YLL+L  +I  +T
Sbjct: 63  AFYLLYLESKILYAT 77


>LEUE_ECO57 RecName: Full=Leucine efflux protein;
          Length = 212

 Score = 45.8 bits (107), Expect = 3e-07
 Identities = 23/75 (30%), Positives = 37/75 (49%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPNT        + G++       GV  G A ++ L   G+  LI  +P+L  ++  +G
Sbjct: 24  PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGMATLIKTTPILFNIVRYLG 83

Query: 87  VLYLLWLAYRIARST 101
             YLL+L  +I  +T
Sbjct: 84  AFYLLYLGSKILYAT 98


>LEUE_ENT38 RecName: Full=Leucine efflux protein;
          Length = 211

 Score = 44.7 bits (104), Expect = 7e-07
 Identities = 47/189 (24%), Positives = 74/189 (39%), Gaps = 22/189 (11%)

Query: 22  VGAF----TPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPM 77
           VGAF     PGPNT     TG   G++       GV  G A ++ L   GV ALI  +P+
Sbjct: 15  VGAFFIVLVPGPNTLFVLKTGIGHGVKKGYLAATGVFIGDAVLMFLAWAGVAALIQTTPV 74

Query: 78  LATVIHVVGVLY-------LLWLAYRIARSTSLA----EKTVLKPMNVWQSAALQYANIK 126
           L  ++              +LW       S          T+LK     +S  L   N K
Sbjct: 75  LFNIVRXXXXXXXXXXXXKMLWSVIMRKNSAHAGGAEPSSTILK-----RSLVLSLTNPK 129

Query: 127 AWMLALAVAASYM-AGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRV- 184
           A +  ++    ++   A + G   ++++    L  F         GA + R+L    ++ 
Sbjct: 130 AILFYVSFFVQFIDVSATNTGTSFLILATTLELISFMYMSFLIFSGAFVTRYLKTKKKLA 189

Query: 185 RWFNGAMGL 193
           +  NG +GL
Sbjct: 190 KLGNGLIGL 198


>Y1307_HAEIN RecName: Full=Uncharacterized membrane protein HI1307;
          Length = 210

 Score = 43.9 bits (102), Expect = 1e-06
 Identities = 28/92 (30%), Positives = 45/92 (48%)

Query: 14  LALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALIL 73
           L L+ +   G  TPGP+    +   A+   R T+   +G++ G A    L   G+  L +
Sbjct: 3   LNLIIVHLFGLMTPGPDFFYVSRMAASNSRRNTVCGILGITLGIAFWGMLSMLGLAVLFV 62

Query: 74  ASPMLATVIHVVGVLYLLWLAYRIARSTSLAE 105
             P L  VI ++G  YL +L + +ARS   A+
Sbjct: 63  TIPALHGVIMLLGGSYLAYLGFLMARSKKYAK 94


>Y4757_PSEAE RecName: Full=Uncharacterized membrane protein PA4757;
          Length = 216

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 39/169 (23%), Positives = 63/169 (37%), Gaps = 11/169 (6%)

Query: 27  PGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVG 86
           PGPN+     T A  G+        GV  G A ++ L   GV +L+ A PML   +  +G
Sbjct: 23  PGPNSLFVLATSAQRGVATGYRAACGVFLGDAVLMLLSALGVASLLKAEPMLFIGLKYLG 82

Query: 87  VLYLL----------WLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAVAA 136
             YL           W   R   +T+   + V       ++  L  +N KA +  ++   
Sbjct: 83  AAYLFYLGVGMLRGAWRKLRNPEATAAQAEQVDVHQPFRKALLLSLSNPKAILFFISFFI 142

Query: 137 SYM-AGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRV 184
            ++  G   PG   ++++ I  L            G  L  W     R+
Sbjct: 143 QFVDPGYAYPGLSFLVLAVILELVSALYLSFLIFTGVRLAAWFRRRQRL 191


>YISU_BACSU RecName: Full=Putative amino-acid transporter yisU;
          Length = 220

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 34/160 (21%), Positives = 66/160 (41%), Gaps = 37/160 (23%)

Query: 47  LPHCVGVSFGFASIVALCTTGVGALILASPMLATVIHVVGVLYLL---WLAYRIARSTSL 103
           LP  +  S     ++ L   GV  ++   P+  TV+   G L+LL   W+ + I  +TS 
Sbjct: 56  LPAVISASVCDTLLIVLAVAGVSVIVQELPVFETVMMAGGFLFLLYMGWVTWNIRPNTSQ 115

Query: 104 AEK---------------------TVLKPMNVWQSAALQYANIKAWM------------- 129
            EK                      +L  + V  +++LQY+ ++ W+             
Sbjct: 116 NEKHTFTPKKQAAFAAAVSLLNPHAILDTIGVIGTSSLQYSGLEKWLFMAACIAVSWIWF 175

Query: 130 LALAVAASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGV 169
           ++LA+A        + G+ +++V+   A   + + G +GV
Sbjct: 176 ISLAIAGRLFQTIDTSGRLMLIVNKCSAAVMWAAAGYFGV 215


>RHTB_SHIFL RecName: Full=Homoserine/homoserine lactone efflux
          protein;
          Length = 206

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 26/93 (27%), Positives = 37/93 (39%), Gaps = 9/93 (9%)

Query: 1  MEAWLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASI 60
          +E W   L T+  L+L         +PG        T  N G R  +    G+  G A  
Sbjct: 3  LEWWFAYLLTSIILSL---------SPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIH 53

Query: 61 VALCTTGVGALILASPMLATVIHVVGVLYLLWL 93
          + L   G+G L   S +   V+   G  YL+WL
Sbjct: 54 IVLVGVGLGTLFSRSVIAFEVLKWAGAAYLIWL 86


>RHTB_ECOLI RecName: Full=Homoserine/homoserine lactone efflux
          protein;
          Length = 206

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 26/93 (27%), Positives = 37/93 (39%), Gaps = 9/93 (9%)

Query: 1  MEAWLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASI 60
          +E W   L T+  L+L         +PG        T  N G R  +    G+  G A  
Sbjct: 3  LEWWFAYLLTSIILSL---------SPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIH 53

Query: 61 VALCTTGVGALILASPMLATVIHVVGVLYLLWL 93
          + L   G+G L   S +   V+   G  YL+WL
Sbjct: 54 IVLVGVGLGTLFSRSVIAFEVLKWAGAAYLIWL 86


>RHTB_ECOL6 RecName: Full=Homoserine/homoserine lactone efflux
          protein;
          Length = 206

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 26/93 (27%), Positives = 37/93 (39%), Gaps = 9/93 (9%)

Query: 1  MEAWLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASI 60
          +E W   L T+  L+L         +PG        T  N G R  +    G+  G A  
Sbjct: 3  LEWWFAYLLTSIILSL---------SPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIH 53

Query: 61 VALCTTGVGALILASPMLATVIHVVGVLYLLWL 93
          + L   G+G L   S +   V+   G  YL+WL
Sbjct: 54 IVLVGVGLGTLFSRSVIAFEVLKWAGAAYLIWL 86


>RHTB_ECO57 RecName: Full=Homoserine/homoserine lactone efflux
          protein;
          Length = 206

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 26/93 (27%), Positives = 37/93 (39%), Gaps = 9/93 (9%)

Query: 1  MEAWLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASI 60
          +E W   L T+  L+L         +PG        T  N G R  +    G+  G A  
Sbjct: 3  LEWWFAYLLTSIILSL---------SPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIH 53

Query: 61 VALCTTGVGALILASPMLATVIHVVGVLYLLWL 93
          + L   G+G L   S +   V+   G  YL+WL
Sbjct: 54 IVLVGVGLGTLFSRSVIAFEVLKWAGAAYLIWL 86


>RHTC_SALTY RecName: Full=Threonine efflux protein;
          Length = 206

 Score = 38.5 bits (88), Expect = 5e-05
 Identities = 21/87 (24%), Positives = 39/87 (44%)

Query: 13 FLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALI 72
          F  +  +  V   +PGP+    + T  +   +  +   +G++ G      +   G+  +I
Sbjct: 5  FFTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGLHLII 64

Query: 73 LASPMLATVIHVVGVLYLLWLAYRIAR 99
               L T+I V G LYL W+ Y++ R
Sbjct: 65 EKMAWLHTIIMVGGGLYLCWMGYQMLR 91


>RHTC_SALTI RecName: Full=Threonine efflux protein;
          Length = 206

 Score = 38.5 bits (88), Expect = 5e-05
 Identities = 21/87 (24%), Positives = 39/87 (44%)

Query: 13 FLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALI 72
          F  +  +  V   +PGP+    + T  +   +  +   +G++ G      +   G+  +I
Sbjct: 5  FFTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGLHLII 64

Query: 73 LASPMLATVIHVVGVLYLLWLAYRIAR 99
               L T+I V G LYL W+ Y++ R
Sbjct: 65 EKMAWLHTIIMVGGGLYLCWMGYQMLR 91


>ARGO_SHIFL RecName: Full=Arginine exporter protein argO;
          Length = 211

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 46/181 (25%), Positives = 75/181 (41%), Gaps = 14/181 (7%)

Query: 40  NFGLRATLPHCVGVSFGFASIVALCTT--GVGALILASPMLATVIHVVGVLYLLWL---A 94
           N G+R      + +    + +V +C    G  AL++ SP L  ++   GV++LLW    A
Sbjct: 28  NQGIRRQYHIMIALLCAISDLVLICAGIFGGSALLMQSPWLLALVTWGGVVFLLWYGFGA 87

Query: 95  YRIARSTS--LAEKTVLKPMNVWQ----SAALQYANIKAWMLALAVAASYMAGAPSPGQR 148
           ++ A S++  LA   VLK    W+      A+ + N   ++    V  S         +R
Sbjct: 88  FKTAMSSNIELASAEVLK-QGRWKIIATMLAVTWLNPHVYLDTFVVLGSLGGQLDVEPKR 146

Query: 149 VVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLALALTAIWIAVAGQP 208
              +  I A F +F   A  +L A L   L      R  N  +G  +   A+ +A  G  
Sbjct: 147 WFALGTISASFLWFFGLA--ILAAWLAPRLRTAKSQRIINLVVGCVMWFIALQLARDGIA 204

Query: 209 H 209
           H
Sbjct: 205 H 205


>ARGO_ECO57 RecName: Full=Arginine exporter protein argO;
          Length = 211

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 46/181 (25%), Positives = 75/181 (41%), Gaps = 14/181 (7%)

Query: 40  NFGLRATLPHCVGVSFGFASIVALCTT--GVGALILASPMLATVIHVVGVLYLLWL---A 94
           N G+R      + +    + +V +C    G  AL++ SP L  ++   GV++LLW    A
Sbjct: 28  NQGIRRQYHIMIALLCAISDLVLICAGIFGGSALLMQSPWLLALVTWGGVVFLLWYGFGA 87

Query: 95  YRIARSTS--LAEKTVLKPMNVWQ----SAALQYANIKAWMLALAVAASYMAGAPSPGQR 148
           ++ A S++  LA   VLK    W+      A+ + N   ++    V  S         +R
Sbjct: 88  FKTAMSSNIELASAEVLK-QGRWKIIATMLAVTWLNPHVYLDTFVVLGSLGGQLDVEPKR 146

Query: 149 VVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLALALTAIWIAVAGQP 208
              +  I A F +F   A  +L A L   L      R  N  +G  +   A+ +A  G  
Sbjct: 147 WFALGTISASFLWFFGLA--ILAAWLAPRLRTAKSQRIINLVVGCVMWFIALQLARDGIA 204

Query: 209 H 209
           H
Sbjct: 205 H 205


>SYE_TRIEI RecName: Full=Glutamyl-tRNA synthetase;       
           EC=6.1.1.17;AltName: Full=Glutamate--tRNA ligase;       
            Short=GluRS;
          Length = 881

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 55  FGFASIVALCTTGVGALILAS---PMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKP 111
           FG+ ++V L  T +  +I A    P+L+ +  ++GV+YL+W  YR     S  ++ + K 
Sbjct: 810 FGWLALVILTFTFMAVVIEALDGIPILSIIFELIGVIYLVWFVYRYLLKRSNRQELLDKI 869

Query: 112 MNV 114
            N+
Sbjct: 870 ENI 872


>YAHN_ECOLI RecName: Full=Uncharacterized membrane protein yahN;
          Length = 223

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 25/94 (26%), Positives = 36/94 (38%)

Query: 17  VTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGALILASP 76
           V L  +  F PG N  +   T    G R             A    L   G+  LI    
Sbjct: 24  VGLFVITFFNPGANLFVVVQTSLASGRRXXXXXXXXXXXXDAFYSGLGLFGLATLITQCE 83

Query: 77  MLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLK 110
            + ++I +VG  YLLW A+   R  S  + + L+
Sbjct: 84  EIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQ 117


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.317    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 10,260,791,101
Number of extensions: 409145437
Number of successful extensions: 1084932
Number of sequences better than 1.0e-03: 25561
Number of HSP's gapped: 1046390
Number of HSP's successfully gapped: 42620
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)