# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_24060.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABF07116.1  [L=444]
Description: rmet0 ABF07116.1 GIB00349CH01 "two component, sigma54 specific, transcriptional.."
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    8.6e-68  229.7   0.0    1.2e-67  229.2   0.0    1.2  1  PF00158  Sigma-54 interaction domain
    2.3e-24   88.2   0.0    4.3e-24   87.3   0.0    1.5  1  PF00072  Response regulator receiver domain
    7.5e-10   40.8   0.3    2.5e-09   39.2   0.2    2.0  1  PF02954  Bacterial regulatory protein, Fis family
    1.4e-05   27.5   0.0      4e-05   26.0   0.0    1.9  1  PF07728  AAA domain (dynein-related subfamily)
  ------ inclusion threshold ------
      0.014   17.2   0.2        0.9   11.3   0.2    2.3  1  PF01078  Magnesium chelatase, subunit ChlI
      0.021   17.4   0.0      0.035   16.7   0.0    1.3  1  PF07724  AAA domain (Cdc48 subfamily)
      0.028   17.3   0.0      0.056   16.3   0.0    1.5  1  PF00004  ATPase family associated with various cellular acti
        0.4   13.5   0.0       0.79   12.5   0.0    1.5  1  PF06490  Flagellar regulatory protein FleQ
        7.1    9.1   0.1         74    5.8   0.0    2.5  1  PF00126  Bacterial regulatory helix-turn-helix protein, lysR
        7.6    9.0   0.0         15    8.0   0.0    1.4  1  PF02196  Raf-like Ras-binding domain
         12    8.4   0.1         38    6.9   0.0    1.8  1  PF02796  Helix-turn-helix domain of resolvase
         16    7.7   0.1         42    6.4   0.1    1.7  1  PF02775  Thiamine pyrophosphate enzyme, C-terminal TPP bindi
         22    6.4   0.0         31    5.9   0.0    1.1  1  PF05049  Interferon-inducible GTPase (IIGP)
         24    6.7   0.0         49    5.7   0.0    1.4  1  PF02562  PhoH-like protein
         26    6.0   0.0         47    5.2   0.0    1.3  1  PF06068  TIP49 C-terminus
         30    6.9   0.0         69    5.8   0.0    1.6  1  PF04542  Sigma-70 region 2
         31    7.1   0.0         53    6.3   0.0    1.3  1  PF06309  Torsin
         36    5.6   0.0         54    5.0   0.0    1.2  1  PF11855  Protein of unknown function (DUF3375)
         41    6.5   0.0         67    5.8   0.0    1.3  1  PF01710  Transposase
         41    5.9   0.0         83    4.9   0.0    1.4  1  PF08495  FIST N domain
         56    5.1   0.0    1.2e+02    3.9   0.0    1.5  1  PF00493  MCM2/3/5 family
         75    5.7   0.0    1.3e+02    4.9   0.0    1.3  1  PF04851  Type III restriction enzyme, res subunit
         76    4.4   0.0    1.5e+02    3.5   0.0    1.4  1  PF10412  Type IV secretion-system coupling protein DNA-bindi
         87    4.6   0.0    1.4e+02    3.9   0.0    1.2  1  PF09848  Uncharacterized conserved protein (DUF2075)
         88    4.6   0.0    4.5e+02    2.3   0.0    1.9  1  PF07693  KAP family P-loop domain
    1.1e+02    3.9   0.0    1.8e+02    3.2   0.0    1.2  1  PF08298  PrkA AAA domain
    1.1e+02    4.9   0.0    1.8e+02    4.3   0.0    1.2  1  PF03371  PRP38 family
    1.2e+02    4.9   0.0    2.4e+02    3.9   0.0    1.5  1  PF05729  NACHT domain
    1.6e+02    5.1   0.0      3e+02    4.3   0.0    1.4  1  PF06531  Protein of unknown function (DUF1108)
    2.7e+02    4.3   0.0    4.9e+02    3.4   0.0    1.4  1  PF04297  Putative helix-turn-helix protein, YlxM / p13 like
    4.3e+02    4.1   0.1    8.6e+02    3.2   0.0    1.5  1  PF10295  Uncharacterised protein (DUF2406)
    7.2e+02    2.9   0.0    1.5e+03    1.9   0.0    1.4  1  PF00479  Glucose-6-phosphate dehydrogenase, NAD binding doma
    7.7e+02    1.7   0.0    1.3e+03    0.9   0.0    1.2  1  PF00695  Major surface antigen from hepadnavirus
      1e+03    1.6   0.1    2.1e+03    0.7   0.1    1.3  1  PF06752  Enhancer of Polycomb C-terminus
    2.4e+03    1.4   0.0    4.7e+03    0.5   0.0    1.3  1  PF07173  Protein of unknown function (DUF1399)


Domain and alignment annotation for each model:
>> PF00158  Sigma-54 interaction domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  229.2   0.0   4.2e-71   1.2e-67       1     167 [.     148     314 ..     148     315 .. 0.99

  Alignments for each domain:
  == domain 1    score: 229.2 bits;  conditional E-value: 4.2e-71
                 --.-SHHHHHHHHHHHHHHTS-S-EEEE-------HHHHHHHHHHSTTTTS--EEEETTTS-CCCHHHHH------------S-----TCCC----EEE CS
     PF00158   1 ligesealkelleqikkvaktdltvlitGesGtGKellAraiheaskrkkkpfvavncaaipeeLleseLFGhekGaFtGAekekkGlfekadgGtLfL 99 
                 +ig+s+a++++++ i++va+td++v+i+Ge+GtGKel+Ar++h+ s+r+++pf+a+nc+a+pe+++ese+FGhe+GaFtGA k++ G++e+a+gGtLfL
  ABF07116.1 148 IIGRSPAIAQVRDLIANVAATDVPVMINGETGTGKELVARSLHALSTRRDQPFIALNCGAVPESIFESEMFGHEAGAFTGAGKRRVGKLEHASGGTLFL 246
                 799************************************************************************************************ PP

                 ET-----HHHHHHHHHHHH---BE------EB-----EEEE-SS-HHHHHH-----HHHHHHHTCEEE CS
     PF00158 100 DeigelplelQekLlrvlqegeverlGsekeikvdvriiaatnedleeaveegkfredLyyrlnvvei 167
                 Dei+++pl+lQ+kLlrvlqeg++erlGs+++i++dvriiaa++ d+e+ v++g+fr+dL+yrlnvv+i
  ABF07116.1 247 DEIESMPLALQVKLLRVLQEGTLERLGSNTSIPIDVRIIAASKGDMEALVAQGTFRQDLLYRLNVVTI 314
                 ******************************************************************98 PP

>> PF00072  Response regulator receiver domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.3   0.0   1.5e-27   4.3e-24       1     111 [.      10     119 ..      10     120 .. 0.98

  Alignments for each domain:
  == domain 1    score: 87.3 bits;  conditional E-value: 1.5e-27
                 EEEESSSHHHHHHHHHHHHHTTSEEEEEESSSHHHHHHHHHHHESEEEEESS-TT----HHHHHHHHHTTTSEEEEEES-TTHHHHHHHHHTT-SEEEE CS
     PF00072   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdfls 99 
                 vl v+Deplvr++ +q le +g+ +v +  ++e+a+  l +  p+++++D++++g +Gl+ll++ r+++p +p+i+vt+hg+ ++a++a++ Ga df++
  ABF07116.1  10 VLFVEDEPLVRQATAQSLELAGF-SVLALPSAEAAMPHLGADFPGVLVTDVRLSGASGLDLLQHCRNAAPGVPVILVTGHGDITMAVQAMREGAYDFIE 107
                 799********************.*************************************************************************** PP

                 SS--HHHHHHHH CS
     PF00072 100 Kpfdpeelvkav 111
                 Kpf  ++l+++v
  ABF07116.1 108 KPFGADRLTETV 119
                 *********998 PP

>> PF02954  Bacterial regulatory protein, Fis family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   39.2   0.2   8.7e-13   2.5e-09       2      42 .]     402     442 ..     401     442 .. 0.97

  Alignments for each domain:
  == domain 1    score: 39.2 bits;  conditional E-value: 8.7e-13
                 HHHHHHHHHHHHHHT----HHHHHHH----HHHH...HHHT CS
     PF02954   2 leevEkelIeqALertgGnisrAArlLGisRrtLyrKLkky 42 
                 +e +E+++I ++L+rtgG +s+AA+lL ++  tLy K+k+y
  ABF07116.1 402 MERYERAVIADTLARTGGAVSQAADLLQVGKATLYDKIKRY 442
                 8999************************************9 PP

>> PF07728  AAA domain (dynein-related subfamily)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.0   0.0   1.4e-08     4e-05       1     121 [.     171     288 ..     171     310 .. 0.78

  Alignments for each domain:
  == domain 1    score: 26.0 bits;  conditional E-value: 1.4e-08
     PF07728   1 dvlLvGppGtgKselaerlaeal.nreveyvqltrdtteedlkgrreiangttslvdsplvraar.........egeilvlDEveraesevlnsLlsll 89 
                 +v++ G++GtgK  +a++l ++  +r    ++l+ +  +e ++ +  +      ++ ++++ a++         +g +l+lDE+e ++ + + +Ll++l
  ABF07116.1 171 PVMINGETGTGKELVARSLHALStRRDQPFIALNCGAVPESIFESEMF-----GHEAGAFTGAGKrrvgklehaSGGTLFLDEIESMPLALQVKLLRVL 264
                 5899***************99999555555666666666666666554.....455566666666777778899************************* PP

     PF07728  90 eerrlllpeggelvkaknddlleknfrviata 121
                  e +l    +++ +  +        +r+ia++
  ABF07116.1 265 QEGTLERLGSNTSIPID--------VRIIAAS 288
                 ****9965555555443........7777776 PP

>> PF01078  Magnesium chelatase, subunit ChlI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.3   0.2   0.00032       0.9      19     155 ..     166     287 ..     154     290 .. 0.65

  Alignments for each domain:
  == domain 1    score: 11.3 bits;  conditional E-value: 0.00032
     PF01078  19 aaGgHnlllvGppGsGKtmlakrlpsllpplseeealevakiasvagkkeeekllkrrpfraphhsaskaalvGggskpkpGeislahnGvLfLDElpe 117
                 aa    +++ G  G+GK ++a+ l++l ++ ++   +             +  ++ +  f++      + a+ G+g+  + G++  a  G LfLDE+  
  ABF07116.1 166 AATDVPVMINGETGTGKELVARSLHALSTRRDQ-PFIAL-----------NCGAVPESIFESEMFGHEAGAFTGAGK-RRVGKLEHASGGTLFLDEIES 251
                 455566788888899999988888887544332.22211...........112233333444444445567778876.5789**************999 PP

     PF01078 118 fkrkvleaLRePledgevtisrakakveyparfqlvaa 155
                 +       L + l++g+  ++r  ++++ p ++ ++aa
  ABF07116.1 252 MPLALQVKLLRVLQEGT--LERLGSNTSIPIDVRIIAA 287
                 88877766666676664..5677777777777777766 PP

>> PF07724  AAA domain (Cdc48 subfamily)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   16.7   0.0   1.2e-05     0.035       6     109 ..     172     270 ..     168     303 .. 0.84

  Alignments for each domain:
  == domain 1    score: 16.7 bits;  conditional E-value: 1.2e-05
                 EEEE-------HHHHHHHHHHTT-....--EEEEGGG---....----THHHHHHHHHTTT-HH...HHT---EEEETGGG----------------HH CS
     PF07724   6 illlgptgvGktelakalaellfvkkekkliradaselle....eeevehlvsrligappgyvg...aeegGivllDEidKihpkessgadvSregVqr 97 
                 +++ g+tg+Gk+++a++l +l   ++++++i +++ ++ e    +e   h    ++ga +  vg   ++ gG ++lDEi+                 q 
  ABF07116.1 172 VMINGETGTGKELVARSLHALST-RRDQPFIALNCGAVPEsifeSEMFGHEAGAFTGAGKRRVGkleHASGGTLFLDEIESMPL-----------ALQV 258
                 6899******************9.9**********9988888879999*********999888722256677*********999...........9999 PP

                 HHHHHH---EE- CS
     PF07724  98 dLLqileggtlt 109
                  LL++l +gtl+
  ABF07116.1 259 KLLRVLQEGTLE 270
                 999999999998 PP

>> PF00004  ATPase family associated with various cellular activities (AAA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   16.3   0.0   1.9e-05     0.056       1      73 [.     172     256 ..     172     298 .. 0.67

  Alignments for each domain:
  == domain 1    score: 16.3 bits;  conditional E-value: 1.9e-05
                 EEEE-------HHHHHHHHHHT...TCEEEEEETTSSSSS.....T.HCHHHHHHHHHHHHHHTS........SEEEEEETGGGTSHHH CS
     PF00004   1 vllyGppGtGKTllakavakel...gvefleisgsellsk.....yvgesekkirelfkeakeka........psvlfiDEidalaksr 73 
                 v++ G  GtGK l+a+++ + +   +++f+ +++  + ++     ++g+ +  + +  k+    +           lf+DEi+++  + 
  ABF07116.1 172 VMINGETGTGKELVARSLHALStrrDQPFIALNCGAVPESifeseMFGHEAGAFTGAGKR----RvgklehasGGTLFLDEIESMPLAL 256
                 5788*************99987444599******99985555555444444444444433....33334566459*********95554 PP

>> PF06490  Flagellar regulatory protein FleQ
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.5   0.0   0.00028      0.79       1     108 [.       9     123 ..       9     124 .. 0.89

  Alignments for each domain:
  == domain 1    score: 12.5 bits;  conditional E-value: 0.00028
     PF06490   1 kiLvidddaerrrdlstiLeFlgeeveavsseelsaaeeesssealavilgsvs..kleealealakkdpelPvlllgeedea.eelan....vigele 92 
                 ++L ++d+   r+++   Le  g +v a+ s+e++     +++  ++v     s  +  ++l+   +++p +Pv+l++ +++   +++         +e
  ABF07116.1   9 RVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAMPHLGADFPGVLVTDVRLSgaSGLDLLQHCRNAAPGVPVILVTGHGDItMAVQAmregAYDFIE 107
                 58999999999999999*****************99999999999999999999878899*********************996555557788888999 PP

     PF06490  93 lPlnYnqLtdlLhrcq 108
                 +P+  + Lt+  +r+ 
  ABF07116.1 108 KPFGADRLTETVRRAL 123
                 9999999999999985 PP

>> PF00126  Bacterial regulatory helix-turn-helix protein, lysR family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.026        74       8      36 ..     412     441 ..     406     442 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.026
                 HHHHHHS.-HHHHHHHCTS-HHHHHHHH-- CS
     PF00126   8 vavaetg.sftaAAerLglsqpavSrqikr 36 
                 +++a+tg  +++AA+ L +  +++   ikr
  ABF07116.1 412 DTLARTGgAVSQAADLLQVGKATLYDKIKR 441
                 789999999************999999987 PP

>> PF02196  Raf-like Ras-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.0    0.0053        15      21      45 ..     113     137 ..     111     146 .. 0.91

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0053
                 -BHHHHHHHHHHT----GGGEEEEE CS
     PF02196  21 ktvrDaLskalkkrgLnpsecaVrr 45 
                 ++++++ + al++r L+++ +a+rr
  ABF07116.1 113 DRLTETVRRALERRALELENHALRR 137
                 799********************97 PP

>> PF02796  Helix-turn-helix domain of resolvase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.013        38      16      39 ..     413     436 ..     401     441 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.013
                 HHHH----HHHHHHHHT--HHHHH CS
     PF02796  16 kLleeGisiskIAkevnisRsTvY 39 
                 +L + G ++s+ A+ ++++++T+Y
  ABF07116.1 413 TLARTGGAVSQAADLLQVGKATLY 436
                 67788999**************** PP

>> PF02775  Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.1     0.015        42      33      64 ..      61      98 ..      51     105 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.015
                HHHHHHHTT......TSTTS-EEEEE----TCTTGGGH CS
     PF02775 33 lpaAiGakl......akpdrevvaivGDGgflmilqel 64
                l++A+G  l      a+p+ +v+ ++G G++ m +q++
  ABF07116.1 61 LSGASGLDLlqhcrnAAPGVPVILVTGHGDITMAVQAM 98
                789999999877776689***************99986 PP

>> PF05049  Interferon-inducible GTPase (IIGP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.011        31      20      49 ..     154     183 ..     151     198 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.011
                 HHHHHHHHHHHHHH--EEEEEE-------H CS
     PF05049  20 vvsiikeaikeiesaklkiavtGdsGnGks 49 
                 ++ ++++ i+++  + + +++ G++G+Gk 
  ABF07116.1 154 AIAQVRDLIANVAATDVPVMINGETGTGKE 183
                 5789************************96 PP

>> PF02562  PhoH-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.017        49      19      39 ..     169     189 ..     153     203 .. 0.71

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.017
     PF02562  19 ndivfaiGpaGtGKTylaval 39 
                    v++ G++GtGK ++a +l
  ABF07116.1 169 DVPVMINGETGTGKELVARSL 189
                 3358899*********99764 PP

>> PF06068  TIP49 C-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.016        47      36      88 ..     155     208 ..     141     223 .. 0.79

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.016
     PF06068  36 agvivelikekklaGravLlaGppgtGktalaiaisk.elgedvpfvalsgsev 88 
                  + + +li +   +   v++ G++gtGk  +a ++   +  +d pf+al+ + v
  ABF07116.1 155 IAQVRDLIANVAATDVPVMINGETGTGKELVARSLHAlSTRRDQPFIALNCGAV 208
                 55677888888888888***************998541455999**99997654 PP

>> PF04542  Sigma-70 region 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.024        69      10      41 ..     411     442 ..     402     443 .. 0.78

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.024
                 HHHHHHHCSTCCHHHHHHHHHHHHHHHHHHCT CS
     PF04542  10 rrlarrllgsgadaeDlvQeaflrllraverf 41 
                   ++ r  g  ++a Dl+Q + + l+ +++r+
  ABF07116.1 411 ADTLARTGGAVSQAADLLQVGKATLYDKIKRY 442
                 556666778889******************98 PP

>> PF06309  Torsin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.019        53      14      73 ..     130     189 ..     119     197 .. 0.70

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.019
     PF06309  14 anleeLekdlekklfGqhlv.kklvvksvkaylenekpkkpLvlsfhGwtGtGknfvaeii 73 
                  + ++L+++l+   +G  ++ ++  +  v+  ++n +++  + + + G tGtGk+ va+ +
  ABF07116.1 130 LENHALRRELAGPAAGTRIIgRSPAIAQVRDLIANVAATD-VPVMINGETGTGKELVARSL 189
                 5666777777777777776623446777777777765544.344579***********977 PP

>> PF11855  Protein of unknown function (DUF3375)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.019        54     243     284 ..     100     141 ..      99     163 .. 0.93

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.019
     PF11855 243 eaFwdlLldperreeldealravlarpalagLdpelreqlrr 284
                 e+++d++ +p + ++l+e +r+ l+r al+ ++++lr++l++
  ABF07116.1 100 EGAYDFIEKPFGADRLTETVRRALERRALELENHALRRELAG 141
                 5799*********************************99975 PP

>> PF01710  Transposase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.023        67      16      41 ..     416     441 ..     407     444 .] 0.88

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.023
     PF01710  16 esggsiteaskvfkigratiyrWLkr 41 
                 ++gg + +a+   ++g+at+y  +kr
  ABF07116.1 416 RTGGAVSQAADLLQVGKATLYDKIKR 441
                 78999****************97775 PP

>> PF08495  FIST N domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.029        83      19      43 ..      69      93 ..      62     107 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.029
     PF08495 19 llealrealpgvpvvGcstageitt 43
                ll+++r a pgvpv+  ++ g it+
  ABF07116.1 69 LLQHCRNAAPGVPVILVTGHGDITM 93
                89*********************98 PP

>> PF00493  MCM2/3/5 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.042   1.2e+02     115     171 ..     234     288 ..     229     313 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.042
                 --TTTT----EEEE------HHHHHHHHHHHH---EE---....-EE-----EEEE- CS
     PF00493 115 GalvladkGvcciDefdkmkeedrtalhEamEqqtisiaKAGivatLnartsvlaAa 171
                 G l  a +G + +De++ m    +++l+ ++ ++t++  + G +++++  + ++aA 
  ABF07116.1 234 GKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGTLE--RLGSNTSIPIDVRIIAAS 288
                 7777899************************999874..555567777777777765 PP

>> PF04851  Type III restriction enzyme, res subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.047   1.3e+02      13      45 ..     159     189 ..     146     203 .. 0.74

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.047
                 HHHT.......TTT---EEE------HHHHHHH CS
     PF04851  13 enllesiekedekkrglivmaTGtGKTlvaasl 45 
                 ++l++++        ++i+ +TGtGK lva sl
  ABF07116.1 159 RDLIANVAAT--DVPVMINGETGTGKELVARSL 189
                 5555555555..7789**********9998873 PP

>> PF10412  Type IV secretion-system coupling protein DNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.051   1.5e+02      17      47 ..     171     201 ..     156     211 .. 0.80

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.051
     PF10412  17 hilivGttGtGKtqalrelldqirargdrai 47 
                  ++i+G tGtGK  + r+l +   +r +  i
  ABF07116.1 171 PVMINGETGTGKELVARSLHALSTRRDQPFI 201
                 589************9999877777766665 PP

>> PF09848  Uncharacterized conserved protein (DUF2075)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.048   1.4e+02       4      23 ..     172     191 ..     170     205 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.048
     PF09848   4 ilvtGvaGtGKtvvalnlla 23 
                 ++++G+ GtGK +va +l a
  ABF07116.1 172 VMINGETGTGKELVARSLHA 191
                 689***********988765 PP

>> PF07693  KAP family P-loop domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.16   4.5e+02       2      47 ..     152     195 ..     151     211 .. 0.79

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.16
     PF07693   2 dlyasaladvlseptlatpiviglyGkWGsGKssllnlledelkef 47 
                 ++ + ++ d++ + + at + ++++G+ G+GK +l+++  ++l+++
  ABF07116.1 152 SPAIAQVRDLIANVA-ATDVPVMINGETGTGK-ELVARSLHALSTR 195
                 677889999999997.****************.5555555666665 PP

>> PF08298  PrkA AAA domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0     0.065   1.8e+02     227     283 ..     234     290 ..     229     325 .. 0.81

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.065
     PF08298 227 GalnranrGllefvemfkadikvlhplltatqegnyksteklslipfdgiilahsne 283
                 G+l +a+ G l + e+   ++ +  +ll + qeg+++  +  + ip+d  i+a s  
  ABF07116.1 234 GKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGTLERLGSNTSIPIDVRIIAASKG 290
                 8899999999999999999********************************998864 PP

>> PF03371  PRP38 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.063   1.8e+02     123     165 ..     281     323 ..     276     327 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.063
     PF03371 123 DyrklkvkakdgdklthvDefvddlltkdrvcdisLprlpkra 165
                 D r +  ++ d++ l+  ++f +dll + +v+ i+Lp l++r 
  ABF07116.1 281 DVRIIAASKGDMEALVAQGTFRQDLLYRLNVVTIPLPPLRERR 323
                 667777888888999999*********************9986 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.083   2.4e+02       2      28 ..     171     197 ..     170     207 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.083
     PF05729   2 tvilqGeaGsGKTtLlqklasawakgk 28 
                 +v+++Ge G GK   +++l+ +  +++
  ABF07116.1 171 PVMINGETGTGKELVARSLHALSTRRD 197
                 589*********999999887655555 PP

>> PF06531  Protein of unknown function (DUF1108)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0       0.1     3e+02      45      72 ..      82     109 ..      72     121 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.1
     PF06531  45 gilvvdendlyialdilkqsidewieen 72 
                  ilv+ + d+ +a+ ++++  +++ie+ 
  ABF07116.1  82 VILVTGHGDITMAVQAMREGAYDFIEKP 109
                 5789999******************975 PP

>> PF04297  Putative helix-turn-helix protein, YlxM / p13 like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.17   4.9e+02      37      56 ..     422     441 ..     417     444 .] 0.89

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.17
                 HHHHHHCT--HHHHHHHHHH CS
     PF04297  37 sEiAeefnvsrqavydnikr 56 
                 s  A+  +v + ++yd+ikr
  ABF07116.1 422 SQAADLLQVGKATLYDKIKR 441
                 6679***************9 PP

>> PF10295  Uncharacterised protein (DUF2406)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0       0.3   8.6e+02      42      55 ..     391     404 ..     341     405 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.3
     PF10295  42 dPDlSNPtRtraER 55 
                   D S P R r+ER
  ABF07116.1 391 PVDESTPLRERMER 404
                 5599*********9 PP

>> PF00479  Glucose-6-phosphate dehydrogenase, NAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.53   1.5e+03     142     151 ..     106     115 ..      94     129 .. 0.83

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.53
                 ESS-----HH CS
     PF00479 142 iEKPfGrdle 151
                 iEKPfG d  
  ABF07116.1 106 IEKPFGADRL 115
                 9*****9964 PP

>> PF00695  Major surface antigen from hepadnavirus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.0      0.47   1.3e+03      99     150 ..     128     179 ..     106     189 .. 0.80

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.47
     PF00695  99 qyleerpkeaetaapaqgklsptedPlleakslieskvavikdPvlkkeatf 150
                   le++   +e+a pa g    + +P++ ++  + ++va + +Pv+ + +t 
  ABF07116.1 128 LELENHALRRELAGPAAGTRIIGRSPAIAQVRDLIANVAATDVPVMINGETG 179
                 45677777889999999999999*********************98776554 PP

>> PF06752  Enhancer of Polycomb C-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.7   0.1      0.73   2.1e+03       6      24 ..     340     358 ..     336     361 .. 0.85

  Alignments for each domain:
  == domain 1    score: 0.7 bits;  conditional E-value: 0.73
     PF06752   6 qyqqHqeqLvlmqkqqlaq 24 
                  yq     L  mq+qql q
  ABF07116.1 340 RYQRPAPILSEMQRQQLMQ 358
                 6888888999*******98 PP

>> PF07173  Protein of unknown function (DUF1399)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   0.0       1.6   4.7e+03      88     116 ..     332     360 ..     303     361 .. 0.89

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 1.6
     PF07173  88 vfLeealaRYkrFlellkkneekslflvP 116
                 +f+  a +RY+r   +l++ + ++l+  P
  ABF07116.1 332 HFMLVAAVRYQRPAPILSEMQRQQLMQRP 360
                 5888999*****99999999998888766 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (444 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       217  (0.0182169); expected 238.2 (0.02)
Passed bias filter:                      194  (0.0162861); expected 238.2 (0.02)
Passed Vit filter:                        35  (0.00293821); expected 11.9 (0.001)
Passed Fwd filter:                        35  (0.00293821); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              35  [number of targets reported over threshold]
# CPU time: 0.29u 0.04s 00:00:00.32 Elapsed: 00:00:01
# Mc/sec: 3305.35
//