# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_24068.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABF07889.1  [L=63]
Description: rmet0 ABF07889.1 GIB00349CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
        1.3   11.4   0.1        1.7   11.1   0.1    1.2  1  PF05836  Chorion protein S16
        1.7   10.9   0.1        1.8   10.8   0.0    1.1  1  PF05078  Protein of unknown function (DUF679)
        5.6    8.2   0.1        5.8    8.1   0.1    1.0  1  PF04547  Calcium-activated chloride channel
         22    6.8   1.6         28    6.5   1.1    1.1  1  PF06912  Protein of unknown function (DUF1275)
         27    6.9   0.1         37    6.5   0.1    1.3  1  PF11779  Protein of unknown function (DUF3317)
         32    6.8   0.0         35    6.7   0.0    1.1  1  PF01252  Signal peptidase (SPase) II
         48    5.4   0.2         54    5.2   0.1    1.1  1  PF09752  Uncharacterized conserved protein (DUF2048)
         58    4.8   0.0         56    4.9   0.0    1.0  1  PF05609  Lamina-associated polypeptide 1C (LAP1C)
         64    6.2   0.6         85    5.8   0.4    1.3  1  PF07835  Bacterial aa3 type cytochrome c oxidase subunit IV
         68    6.1   0.3    1.1e+02    5.5   0.2    1.3  1  PF03183  Borrelia repeat protein
    1.2e+02    5.1   0.3    2.1e+02    4.3   0.2    1.5  1  PF09049  Stannin transmembrane
    1.3e+02    4.9   0.4    1.7e+02    4.5   0.3    1.2  1  PF12354  Bacterial adhesion/invasion protein N terminal
    1.3e+02    5.1   0.2    1.3e+02    5.2   0.1    1.2  1  PF04307  Predicted membrane-bound metal-dependent hydrolase 
    1.6e+02    4.0   0.0    1.5e+02    4.1   0.0    1.1  1  PF05206  Methyltransferase TRM13
    1.7e+02    5.0   1.7    1.6e+02    5.0   0.5    1.4  1  PF04304  Protein of unknown function (DUF454)
    1.9e+02    4.0   0.0    1.7e+02    4.2   0.0    1.1  1  PF04333  VacJ like lipoprotein
    2.5e+02    3.5   0.0    2.4e+02    3.6   0.0    1.1  1  PF03631  Ribonuclease BN-like family
    2.5e+02    3.3   0.0    3.2e+02    2.9   0.0    1.2  1  PF09265  Cytokinin dehydrogenase 1, FAD and cytokinin bindin
    2.5e+02    4.3   0.1    2.6e+02    4.3   0.1    1.1  1  PF00892  EamA-like transporter family
    3.2e+02    3.8   0.1    4.4e+02    3.4   0.0    1.2  1  PF08104  Ponericin L family
    3.5e+02    2.9   0.1    3.3e+02    2.9   0.0    1.0  1  PF00865  Osteopontin
    4.1e+02    3.4   0.0      1e+03    2.1   0.0    1.6  1  PF07981  Plasmodium repeat_MYXSPDY
    4.7e+02    3.7   1.6    8.6e+02    2.9   1.1    1.4  1  PF12393  Dr family adhesin
    4.9e+02    2.5   0.1    5.4e+02    2.4   0.1    1.1  1  PF05313  Poxvirus P21 membrane protein
    7.2e+02    2.7   3.0    4.8e+02    3.3   1.0    1.5  1  PF08525  Opacity-associated protein A N-terminal motif
    8.7e+02    3.6   1.3    4.1e+03    1.6   0.6    2.3  1  PF01581  FMRFamide related peptide family
    9.2e+02    3.1   0.9    1.1e+03    2.9   0.6    1.4  1  PF03964  Chorion family 2
      1e+03    2.2   2.4      2e+03    1.3   1.7    1.4  1  PF03911  Sec61beta family


Domain and alignment annotation for each model:
>> PF05836  Chorion protein S16
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.1   0.1   0.00047       1.7       5      34 ..      24      53 ..      18      62 .. 0.79

  Alignments for each domain:
  == domain 1    score: 11.1 bits;  conditional E-value: 0.00047
     PF05836  5 llcllacavsicvaalarpsygsaasgasa 34
                +  l a++v ic++ ++ p+ ++++sg+++
  ABF07889.1 24 IAALSAMTVFICLSDTVAPRDTEYGSGKAV 53
                23367899******************9965 PP

>> PF05078  Protein of unknown function (DUF679)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.8   0.0   0.00051       1.8      38      67 ..      18      47 ..       9      60 .. 0.83

  Alignments for each domain:
  == domain 1    score: 10.8 bits;  conditional E-value: 0.00051
     PF05078 38 lltaaLvallavscillsftDsivdkdGkv 67
                ++t +L+a l+++++++++ D++  +d + 
  ABF07889.1 18 VVTLCLIAALSAMTVFICLSDTVAPRDTEY 47
                6899*******************9877654 PP

>> PF04547  Calcium-activated chloride channel
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.1   0.1    0.0016       5.8     121     157 ..      11      48 ..       4      62 .. 0.78

  Alignments for each domain:
  == domain 1    score: 8.1 bits;  conditional E-value: 0.0016
     PF04547 121 q.lvslpvvlllivlvvllmlgvfelrelvteikeake 157
                 + + +lpvv l++++++++m +++ l+++v   +++++
  ABF07889.1  11 FaMHKLPVVTLCLIAALSAMTVFICLSDTVAPRDTEYG 48 
                 55889**********************99987766555 PP

>> PF06912  Protein of unknown function (DUF1275)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   1.1     0.008        28     177     208 ..       4      35 ..       3      36 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.008
     PF06912 177 lGaivGallfralgfaalllaaalllvlavll 208
                 +Ga +G ++++ l  ++l+l+aal ++ ++++
  ABF07889.1   4 FGASFGRFAMHKLPVVTLCLIAALSAMTVFIC 35 
                 6**************99999999999988875 PP

>> PF11779  Protein of unknown function (DUF3317)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.1      0.01        37      32      52 ..      19      39 ..      12      43 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.01
     PF11779 32 tllllllslilfaaylylpsh 52
                ++l+l+++l+ ++++++l++ 
  ABF07889.1 19 VTLCLIAALSAMTVFICLSDT 39
                689**************9976 PP

>> PF01252  Signal peptidase (SPase) II
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0    0.0097        35      43      76 ..       5      36 ..       2      53 .. 0.64

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.0097
     PF01252 43 Gaafglfsgkseelrklllvlvslvavllllvll 76
                Ga+fg f+ ++  +    l+l++++ ++ +++ l
  ABF07889.1  5 GASFGRFAMHKLPVV--TLCLIAALSAMTVFICL 36
                9*******9965433..44444444444444333 PP

>> PF09752  Uncharacterized conserved protein (DUF2048)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.015        54     195     216 ..      13      34 ..       6      41 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.015
     PF09752 195 nlpkplalvpllswstassvft 216
                 +++ p+++++l+++ +a +vf 
  ABF07889.1  13 MHKLPVVTLCLIAALSAMTVFI 34 
                 5778****************95 PP

>> PF05609  Lamina-associated polypeptide 1C (LAP1C)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.016        56     290     317 ..      19      46 ..       3      55 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.016
     PF05609 290 aillltaardaeevlkclseqiadayss 317
                  +l l aa  a  v+ cls+ +a   + 
  ABF07889.1  19 VTLCLIAALSAMTVFICLSDTVAPRDTE 46 
                 478899****************965443 PP

>> PF07835  Bacterial aa3 type cytochrome c oxidase subunit IV
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.4     0.024        85      28      44 .]      19      35 ..       7      35 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.024
     PF07835 28 gtiavivlLilmAiflt 44
                +t+ +i+ L +m++f++
  ABF07889.1 19 VTLCLIAALSAMTVFIC 35
                79999*********986 PP

>> PF03183  Borrelia repeat protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.2      0.03   1.1e+02       9      18 .]      28      37 ..      28      37 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.03
     PF03183  9 SLisdfisas 18
                S +++fi++s
  ABF07889.1 28 SAMTVFICLS 37
                67******98 PP

>> PF09049  Stannin transmembrane
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.2     0.058   2.1e+02      16      28 ..      18      30 ..      17      35 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.058
                HHHHHHHHH---- CS
     PF09049 16 IVILIAIAALGAL 28
                +V L  IAAL A+
  ABF07889.1 18 VVTLCLIAALSAM 30
                5788999***997 PP

>> PF12354  Bacterial adhesion/invasion protein N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.3     0.048   1.7e+02       1      23 [.      13      36 ..      13      41 .. 0.75

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.048
     PF12354  1 mkknnvlkkvltlllvlivsl.ci 23
                m+k  v++ +l++ l ++ ++ c+
  ABF07889.1 13 MHKLPVVTLCLIAALSAMTVFiCL 36
                788888999999888766666476 PP

>> PF04307  Predicted membrane-bound metal-dependent hydrolase (DUF457)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.035   1.3e+02      32      59 ..       9      36 ..       1      59 [. 0.66

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.035
     PF04307 32 HRgftHsllfalllallllllffalgyl 59
                 R ++H l+++ l  + +l   +++ +l
  ABF07889.1  9 GRFAMHKLPVVTLCLIAALSAMTVFICL 36
                6889999999776543333332333343 PP

>> PF05206  Methyltransferase TRM13
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.042   1.5e+02      23      39 ..      45      61 ..      22      63 .] 0.83

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.042
     PF05206 23 vEfGaGkgeLsrylnqa 39
                 E+G+Gk+ +++yl q 
  ABF07889.1 45 TEYGSGKAVFKHYLVQY 61
                69***********9875 PP

>> PF04304  Protein of unknown function (DUF454)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.5     0.044   1.6e+02      45      69 ..      11      35 ..       4      37 .. 0.76

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.044
     PF04304 45 iflvpslwvkilllvlllgvliwil 69
                + ++++++v+++l++ l + +++i 
  ABF07889.1 11 FAMHKLPVVTLCLIAALSAMTVFIC 35
                5677788899999999998888886 PP

>> PF04333  VacJ like lipoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.048   1.7e+02     104     143 ..       2      41 ..       1      63 [] 0.72

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.048
     PF04333 104 edFgqtlgryGvgsgpYlvlPllgpttlRdavgkvvdava 143
                 ++Fg ++gr+ +++ p ++l l+ +  +   +  + d+va
  ABF07889.1   2 DHFGASFGRFAMHKLPVVTLCLIAALSAMTVFICLSDTVA 41 
                 57*****************999998877766666666665 PP

>> PF03631  Ribonuclease BN-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0     0.067   2.4e+02     108     137 ..       8      37 ..       2      62 .. 0.51

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.067
     PF03631 108 flrkrllslllllllglllllslalsvflk 137
                 f r  +  l +++l++++ l ++++++ l 
  ABF07889.1   8 FGRFAMHKLPVVTLCLIAALSAMTVFICLS 37 
                 444444444455444444444444444443 PP

>> PF09265  Cytokinin dehydrogenase 1, FAD and cytokinin binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0     0.091   3.2e+02     252     265 ..       2      15 ..       1      23 [. 0.91

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.091
                 HH--HHHHHHHHHH CS
     PF09265 252 rHFGakwerfverK 265
                 +HFGa + rf+  K
  ABF07889.1   2 DHFGASFGRFAMHK 15 
                 7*********9988 PP

>> PF00892  EamA-like transporter family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.1     0.072   2.6e+02       9      36 ..       8      35 ..       4      55 .. 0.72

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.072
     PF00892  9 lskkllesvspltitayrlliagillil 36
                + + ++++++ +t+  +  l a+ ++i+
  ABF07889.1  8 FGRFAMHKLPVVTLCLIAALSAMTVFIC 35
                6677777777777777777777754444 PP

>> PF08104  Ponericin L family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.12   4.4e+02      11      16 ..      48      53 ..      47      55 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.12
     PF08104 11 GAGKAV 16
                G GKAV
  ABF07889.1 48 GSGKAV 53
                89***9 PP

>> PF00865  Osteopontin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0     0.092   3.3e+02       2      19 ..      15      32 ..      13      59 .. 0.74

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.092
     PF00865  2 rlavicfCllgiasalPv 19
                +l v+++Cl++  sa+ v
  ABF07889.1 15 KLPVVTLCLIAALSAMTV 32
                789********9999998 PP

>> PF07981  Plasmodium repeat_MYXSPDY
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.28     1e+03      11      17 .]      33      39 ..      33      39 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.28
     PF07981 11 LVqLPDT 17
                ++ L+DT
  ABF07889.1 33 FICLSDT 39
                899***9 PP

>> PF12393  Dr family adhesin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   1.1      0.24   8.6e+02       4      15 ..      21      32 ..      20      33 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.24
     PF12393  4 LAIMaatSvlta 15
                L ++aa S +t+
  ABF07889.1 21 LCLIAALSAMTV 32
                679*****9997 PP

>> PF05313  Poxvirus P21 membrane protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1      0.15   5.4e+02      73      98 ..      11      36 ..       8      47 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.15
     PF05313 73 laitttpviavimiavaslllPlpsL 98
                +a++  pv+++ +ia  s++  + +L
  ABF07889.1 11 FAMHKLPVVTLCLIAALSAMTVFICL 36
                57788899999999888888777776 PP

>> PF08525  Opacity-associated protein A N-terminal motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   1.0      0.14   4.8e+02      13      23 ..      23      33 ..      21      36 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.14
     PF08525 13 llialsavvll 23
                l++alsa++++
  ABF07889.1 23 LIAALSAMTVF 33
                799******98 PP

>> PF01581  FMRFamide related peptide family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.6       1.2   4.1e+03       5       9 ..       7      11 ..       4      11 .. 0.79

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 1.2
     PF01581  5 rfmRF 9 
                 f+RF
  ABF07889.1  7 SFGRF 11
                58998 PP

>> PF03964  Chorion family 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.6       0.3   1.1e+03       1      12 [.      19      30 ..      19      60 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.3
     PF03964  1 vllaliAavsAs 12
                v+l+liAa+sA 
  ABF07889.1 19 VTLCLIAALSAM 30
                799*****9995 PP

>> PF03911  Sec61beta family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   1.7      0.55     2e+03      25      40 ..      18      33 ..      18      34 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.55
     PF03911 25 vlSlgfiasvilLhil 40
                v++l++ia   +++++
  ABF07889.1 18 VVTLCLIAALSAMTVF 33
                689*****99999987 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (63 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       353  (0.029634); expected 238.2 (0.02)
Passed bias filter:                      313  (0.026276); expected 238.2 (0.02)
Passed Vit filter:                        29  (0.00243452); expected 11.9 (0.001)
Passed Fwd filter:                        29  (0.00243452); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              28  [number of targets reported over threshold]
# CPU time: 0.11u 0.04s 00:00:00.15 Elapsed: 00:00:00
# Mc/sec: 1236.46
//