# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_24069.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABF08007.1  [L=1044]
Description: rmet0 ABF08007.1 GIB00349CH01 "Hydrophobe/amphiphile efflux-1 HAE1"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
          0 1068.6   0.0          0 1068.4   0.0    1.0  1  PF00873  AcrB/AcrD/AcrF family
      5e-13   51.1  37.6    8.5e-09   37.2  14.1    2.5  2  PF03176  MMPL family
    0.00026   22.9  20.2      0.095   14.5   0.3    2.3  2  PF02355  Protein export membrane protein
  ------ inclusion threshold ------
         10    8.9   0.9         85    5.9   0.1    2.6  2  PF05345  Putative Ig domain
         14    7.8   0.2         34    6.5   0.1    1.7  1  PF02698  DUF218 domain
         24    7.2   7.8        7.4    8.8   1.3    3.0  1  PF09125  Cytochrome C oxidase subunit II, transmembrane
         35    6.4   0.0         79    5.3   0.0    1.5  1  PF10490  Rb-binding domain of kinetochore protein Cenp-F/LEK
         52    6.4   0.0    1.1e+02    5.3   0.0    1.5  1  PF11341  Protein of unknown function (DUF3143)
    1.1e+02    5.5   0.0    2.6e+02    4.2   0.0    1.6  1  PF09149  Domain of unknown function (DUF1935)
    1.1e+02    4.2   0.1    3.7e+02    2.4   0.0    1.8  1  PF06189  5'-nucleotidase
    1.5e+02    3.8   4.7         27    6.2   0.2    1.9  1  PF06814  Lung seven transmembrane receptor
    1.6e+02    4.1   0.0    4.4e+02    2.7   0.0    1.6  1  PF06816  NOTCH protein
    1.8e+02    4.7   0.1    5.6e+02    3.2   0.1    1.9  1  PF08255  Trp-operon Leader Peptide
    2.8e+02    3.7   0.1    6.3e+02    2.5   0.1    1.5  1  PF03248  Rer1 family
      3e+02    4.1   0.0    6.3e+02    3.1   0.0    1.5  1  PF08444  Aralkyl acyl-CoA:amino acid N-acyltransferase, C-te
    3.1e+02    1.8  11.7    1.6e+03   -0.5   8.2    1.8  1  PF02460  Patched family
    3.2e+02    3.8   0.0    7.2e+02    2.7   0.0    1.5  1  PF09345  Domain of unknown function (DUF1987)
    3.9e+02    3.3   3.8    4.7e+02    3.1   0.1    2.4  2  PF03990  Domain of unknown function (DUF348)
    4.3e+02    2.9   0.0    1.2e+03    1.4   0.0    1.7  1  PF10509  Galactokinase galactose-binding signature
    5.2e+02    2.7   0.0      1e+03    1.7   0.0    1.4  1  PF04832  SOUL heme-binding protein
    5.7e+02    3.2   0.0    2.4e+03    1.1   0.0    2.0  1  PF02969  TATA box binding protein associated factor (TAF)
    6.2e+02    2.1   0.0      1e+03    1.4   0.0    1.2  1  PF12017  Transposase protein
    6.6e+02    3.0  12.4          6    9.5   1.3    3.1  1  PF10724  Protein of unknown function (DUF2516)
    7.4e+02    2.4   0.0    1.5e+03    1.5   0.0    1.3  1  PF01863  Protein of unknown function DUF45
    7.4e+02    1.6   0.0    1.3e+03    0.7   0.0    1.3  1  PF07693  KAP family P-loop domain
      8e+02    1.5   0.2    1.8e+03    0.3   0.1    1.5  1  PF06109  Haemolysin E (HlyE)
    8.5e+02    2.4   0.0    1.5e+03    1.6   0.0    1.3  1  PF02582  Uncharacterised ACR, YagE family COG1723
    1.1e+03    2.1   8.7         39    6.7   0.0    3.3  1  PF09851  Predicted membrane protein (DUF2078)
    1.1e+03    2.5   0.0    2.7e+03    1.3   0.0    1.6  1  PF11798  IMS family HHH motif
    1.2e+03    0.1   0.1    2.3e+03   -0.9   0.1    1.3  1  PF05510  Sarcoglycan alpha/epsilon
    1.5e+03    2.8   0.7    4.6e+03    1.2   0.5    1.8  1  PF05953  Allatostatin
    1.7e+03    1.5   0.0    4.4e+03    0.2   0.0    1.5  1  PF11954  Domain of unknown function (DUF3471)
    2.2e+03    0.5   5.8    2.1e+02    3.8   0.2    1.9  1  PF03303  WTF protein
    2.3e+03    0.7   0.3    5.7e+03   -0.6   0.2    1.4  1  PF05431  Insecticidal Crystal Toxin, P42
    2.6e+03    0.7   3.8    7.3e+02    2.5   0.1    1.9  1  PF03406  Phage tail fibre repeat


Domain and alignment annotation for each model:
>> PF00873  AcrB/AcrD/AcrF family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1068.4   0.0         0         0       1    1020 [.       1    1022 [.       1    1023 [. 0.99

  Alignments for each domain:
  == domain 1    score: 1068.4 bits;  conditional E-value: 0
                  -HHHHHTSHHHHHHHHHHHHH----HCCCSSEESSSS-S--EEEEEE------HHHHHCCTHHHHHHTC---TTEEEEEEEE----EEEEEEE---- CS
     PF00873    1 iikffikrpifalvlalailllGilsilklPvdalPeiapptvqvstsypGaspevvedtvtqpiEqalngldglkyvsSqSseglssitvtFedgt 97  
                  +++ff++rp fa+vla++ +++G ++++++Pv+++P +apptv   ++ypGa + +ved+vt+++Eq++ g++gl y+ S+S++g++++t+ F +gt
  ABF08007.1    1 MAQFFLRRPAFAWVLAILTMVAGLVALNSIPVAQYPAVAPPTVILYADYPGATARTVEDRVTAVLEQQMHGIPGLLYIDSSSEAGTATVTIGFRQGT 97  
                  789********************************************************************************************** PP

                  -HHHHHHHHHHHHHCHGGGS-HHHHH--EEEEEEECCECEE---B-------HHHHHHHHHHCTHHHHHT------EE---.---EEEEEE-HHHHH CS
     PF00873   98 didiArqqvqnrlqeaknkLPeevqepgiskiktssseilvlavtskdgsltktdlrdlaesnikdqlsrveGVgdvqliGgsekavriwldpqkla 194 
                  d++ A+++v nr+++a++ LPe v++ g+ ++++s s+++ +++ sk g++++t l+d+a+ ++ ++l+r++G+g+v+ +  +e+a+r+w +p++l+
  ABF08007.1   98 DPQLAQVNVRNRVSQAEPLLPEVVRRGGVYVDQASASPFMYVSLISKTGTMSETALADYAAGTVLPMLRRLPGIGKVEAYS-AEYALRVWFNPDQLN 193 
                  ********************************************************************************9.*************** PP

                  CTT--HHHHHHHHHHHS-B-B--EB......------BEEE-SB---SCCCGCT-EEE.TT---EEEHHHCEEEE-----SS-EEEE---EE---EE CS
     PF00873  195 klgltltdvvsalkeqnvqvaaGql......egqqeelliraqgrlqsaediekiivk.sqdgskvrlrDvAkvelgaeeeriaatlngkpavllav 284 
                  ++glt +dv  a++++n  v  Gql       gq+ ++ +r ++ l+ +e +++i+++  +dgs+v lrDvA+ve+ a+++r+++tlng +a+++ +
  ABF08007.1  194 AYGLTTADVEAAIRARNGSVTPGQLggapskPGQSYQAVVRPPAPLADPEAFGRIVLRsAADGSAVLLRDVARVEMAAADYRYSSTLNGREAASMGL 290 
                  ******************************99**************************99************************************* PP

                  EEE---BHHHHHHHHHHHHHCCGGGS----B---SCESHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCCCCCHHHHHHHHHH---HHHCCC--- CS
     PF00873  285 kklpganaievvkavkekleelketlPegveivvvydttefvrasieeVvktlleaivLvvlvlflFLqnlratlipaiavPlsllgtfavlkalgl 381 
                  k++ gan +++++ v+++l+e ++ +P+gv + + ydt++fv++si+ V  tl ea+vLv+l+l+lFL+nlratlip i+vP+sllgt+a+l+a+gl
  ABF08007.1  291 KLADGANVLATSRTVRDALDEAAKAFPAGVAYDISYDTAHFVQSSISRVLMTLAEATVLVFLILYLFLGNLRATLIPCIVVPVSLLGTVACLYAFGL 387 
                  ************************************************************************************************* PP

                  -CEHHHH---TTT---HHHHHHHHHHHHHHHHHH----HHHHHHHH-----------HHHHHHHCCGGGG-------HHHHHHHHHHHHHHHHHHHH CS
     PF00873  382 siNlltlfgLvlAiGlvvDdAiVvvEnverkleeegekpleaalksmkeiegalvaialvllavfvPilflgGveGklfrqfaltivlaillsvlva 478 
                  s+N++tlfg vlAiG++vDdAiVvvEnver ++eeg + + aa++sm+e++gal+a++lvl+avfvP++flg  +G ++r fa+t++++i+ s+++a
  ABF08007.1  388 SLNVITLFGVVLAIGILVDDAIVVVENVERIMREEGVDAFTAASRSMREVSGALLAVTLVLCAVFVPMAFLGSAVGVIYRHFAMTLAISIAFSLFFA 484 
                  ************************************************************************************************* PP

                  HCCHHHHHHHCS--------------HHHHHHHHHHHHHHH-HHHCCTHHHHHHHHHHHH---HHHHCTS-BESS-------EEEEEE------HHH CS
     PF00873  479 ltltPalcallLkarkeekekgffrefnrlfdalerrYekllekvlrhravvllvalllvvgslllfvripkeflPeedegvlvtsvqlppgvsleq 575 
                  l l Pa+ca lL++  ++   g +++f+  f a + rY+  ++++ ++r ++l+v+l++ +++++ + ++p+ flPeed+g+lv+ v+lppg++++q
  ABF08007.1  485 LSLAPAMCASLLRHGAQPAR-GPLAWFEHRFTAFTTRYAGWVQRLQQRRLRWLAVYLAMAAVCAVGLWQLPSGFLPEEDTGELVIDVELPPGSTQAQ 580 
                  *****************997.89************************************************************************** PP

                  HHHHHHHHHHHHH.TTTTEEEEEEEE------..-------EEEEE--CTT----TTSHHHHHHHHHHHCCTSSS...SEEEEEE--SSTT------ CS
     PF00873  576 tekvlkqvekilk.ekpevesvfavtGfafagdtagqnsakvfisLkpekerkeeektvealierlrkelekikg...anvellapiqlreletlsg 668 
                  t++ ++q+e+ +k e   v+  fa  G +  g  +g ++a+vf sL ++k r + e+ ++ +++rl+k le+ +g   a++ + +  +l el+++sg
  ABF08007.1  581 TRETIAQLEQWMKqERLPVKTSFALLGWNSGG--SGEQRASVFLSLDDWKLR-GRENAADVVLARLTKGLEEWPGrgdAQLYPYNGTALPELGSTSG 674 
                  **********99978899*********98888..9*****************.9999****************953338889999999********* PP

                  -EEEEE-.------HHHHHHHHHHHHHHCCSTTEECEEE-------EEEEEE-HHHHHH----HHHHHHHHHHH---EEEEEEE----EEEEEEEE- CS
     PF00873  669 vrlelqvklfgddleaLseareqllaalkqlpeladvrseqqedepqlqvkidrekaaalGvsiadinetlstalggsyvndfieegrvvkvvvqle 765 
                   ++ l + ++  +   L +ar +l++ +k+ p  a+vr ++ + +p l++ id +ka+++Gv++++i+++l++ lg++y++++ ++grv +v++q++
  ABF08007.1  675 LDMRLVT-RLEGGRPSLYAARDKLIERAKADPVFAEVRATAGQPVPALDLAIDYRKAESFGVDTEAIHHALAATLGSRYIDELARDGRVRRVILQAD 770 
                  *****99.9999************************************************************************************* PP

                  GGGSSSGGGGTT-EEE-----EEECGGCEEEEEE---TEEEEE---EEEEEE-EE--------HHHHHHHCCTT..S-----EEEE--HHHHHH--- CS
     PF00873  766 edlrsspedlkklyvrnkkgkmvplsavakieeekgpnsierenglrsveisgevaegdslgeaeeavekiakqvklPagvgiewtglseqeqeagn 862 
                  + +r++pedl++l vrn++g+mv l+a+a++e+++g   +er+ngl sv i+++va+g+s+g+a++  e+++++  l ++++++w+g + ++q++g+
  ABF08007.1  771 APFRMQPEDLARLHVRNAQGQMVSLGAFATLEWGNGEATLERYNGLISVRINADVAPGTSTGTAMTRLESLVRE--LGPDYEVRWSGRAFEQQQSGT 865 
                  **************************************************************************..********************* PP

                  HHHHHHHHHHHHHHHHHHHHTTSSSCCHHHHTTTT------HHHHHH----BSHHHH---TTT---HHHHHHHHHHHHHHHHCT-----HHHHHHHH CS
     PF00873  863 sllllvalalllvflvLaalyeslsdpllvlltvPlalvGallalllrglelsviaqvGlilliGlavkNailivefakelrekeglsleeAileaa 959 
                  ++++l+al++l++fl+L alyes+  pl+vl +vP +lvGa  a++lrgl+++v++ vG+i+++Gla+kNail+ve+a++lr+ +gl++++A+ +aa
  ABF08007.1  866 QAPWLFALSMLFIFLCLVALYESWTLPLAVLAIVPAGLVGAASAVWLRGLPNDVYFKVGVIVIMGLAAKNAILVVEYAEQLRR-NGLERVQAATQAA 961 
                  ***********************************************************************************.9************ PP

                  HHCHHHHHHHHHHHH---HHHHTT-------TTT---------HHHHHCHHHHHHHHHHHH CS
     PF00873  960 klRLrPiLMTalaailGvlPLalstGaGselqqplgivvlGGlvtstvLtlllvPvlYvlv 1020
                  ++RLrP++MT+la+ilGv+PLa+stG G+++q+++g++vlGG++ +t+L+ l++P+lY+ +
  ABF08007.1  962 RQRLRPVVMTSLAFILGVVPLAISTGPGAGAQRAVGTGVLGGMLGATILGTLVIPLLYAWI 1022
                  **********************************************************876 PP

>> PF03176  MMPL family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.2  14.1     3e-12   8.5e-09     113     307 ..     304     500 ..     284     549 .. 0.75
   2 !   19.2   6.4   9.2e-07    0.0026     136     311 ..     862    1028 ..     815    1038 .. 0.78

  Alignments for each domain:
  == domain 1    score: 37.2 bits;  conditional E-value: 3e-12
     PF03176 113 aveearpleglkvevtGpaa.tladlrdasdr...dlklievvtlvvilviLlivyrSlvaallplltvvvsllaalglvlilalllglelstfvlgl. 206
                 +v++a  +e +k+  +G+a  +  d+++ +++    + ++ + + v++++iL + +++l a l+p ++v vsll +++       l +++ls  v++l 
  ABF08007.1 304 TVRDAL-DEAAKAFPAGVAYdISYDTAHFVQSsisRVLMTLAEATVLVFLILYLFLGNLRATLIPCIVVPVSLLGTVAC------LYAFGLSLNVITLf 395
                 444444.444455555555422334444444300044455566889***************************999998......44566666666664 PP

     PF03176 207 lvvlliavGtDYallLvsRy.reelaagedreeaviravastgkvvtaaGltvaiamlgLvvarlpv...laqvGvaialGvlvdvlivlTllPAllvl 301
                  vvl+i++ +D a+ +v    r  +++g d+ +a+ r ++ + ++ +a +l++++ ++ ++++   v    + +++++a++++++++ +l+l PA+++ 
  ABF08007.1 396 GVVLAIGILVDDAIVVVENVeRIMREEGVDAFTAASRSMREVSGALLAVTLVLCAVFVPMAFLGSAVgviYRHFAMTLAISIAFSLFFALSLAPAMCAS 494
                 899**************9984557889*********************************9987653222678*************************9 PP

     PF03176 302 lGraal 307
                 l r + 
  ABF08007.1 495 LLRHGA 500
                 877732 PP

  == domain 2    score: 19.2 bits;  conditional E-value: 9.2e-07
     PF03176  136 dlrdasdrdlklievvtlvvilviLlivyrSlvaallplltvvvsllaalglvlilalllglelstfvlgllvvlliavGtDYallLvsRyreelaa 232 
                       s  ++  + +++++ i++ L+ +y S   +l +l+ v  +l+ a +   ++   l    +++ ++  v+++++ ++  a+l+v    + +++
  ABF08007.1  862 Q----SGTQAPWLFALSMLFIFLCLVALYESWTLPLAVLAIVPAGLVGAASA--VWLRGLP---NDVYFKVGVIVIMGLAAKNAILVVEYAEQLRRN 949 
                  3....556666778899999**************************999999..6666544...4556677778888888899***9999999999* PP

     PF03176  233 gedreeaviravastgkvvtaaGltvaiamlgLvvarlp...vlaqvGvaialGvlvdvlivlTll.PAllvllGraalakpr 311 
                  g +r +a+ +a ++  + v++  l +++ ++ L++++ p   + ++vG+ +  G+l ++    Tl+ P l + + r+    + 
  ABF08007.1  950 GLERVQAATQAARQRLRPVVMTSLAFILGVVPLAISTGPgagAQRAVGTGVLGGMLGATI-LGTLViPLLYAWIARWS---KA 1028
                  ************************************876211455699999999999887.567777**********3...22 PP

>> PF02355  Protein export membrane protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   11.8   9.5   0.00023      0.65      19     182 ..     330     487 ..     313     497 .. 0.68
   2 !   14.5   0.3   3.3e-05     0.095      32     154 ..     866     987 ..     857    1019 .. 0.83

  Alignments for each domain:
  == domain 1    score: 11.8 bits;  conditional E-value: 0.00023
     PF02355  19 etvgptlgkelaekavlalllalvlilvyvalrFewrva.laavialvhDviitvgvlsllgieldlatvaAlLtiiGYSvndtvvvfdrvrenlkkkk 116
                 ++v +++++ l+      l+ a+vl+++ ++l+  +  a l   i++   ++ tv++l ++g+ l++ t+ ++   iG  v+d +vv + v++ +++ +
  ABF08007.1 330 HFVQSSISRVLM-----TLAEATVLVFLILYLFLGNLRAtLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMRE-E 422
                 555555555554.....444444444444444444443404444446677999**************************************988777.7 PP

     PF02355 117 ratleeivnlslnqtltrtiltslttllvvvallifgg...kvlkdfalvllvGllvgtyssifiaapl 182
                   +  +++ +s+++     ++ +l++  v v + ++g+    + + fa++l + +++    s+f+a  l
  ABF08007.1 423 GVDAFTAASRSMREVSGALLAVTLVLCAVFVPMAFLGSavgVIYRHFAMTLAISIAF----SLFFALSL 487
                 7888889999**998775555555555666777777775533446677777766665....44444444 PP

  == domain 2    score: 14.5 bits;  conditional E-value: 3.3e-05
     PF02355  32 kavlalllalvlilvyvalrFe.wrvalaavialvhDviitvgvlsllgieldlatvaAlLtiiGYSvndtvvvfdrvrenlkkkkratleeivnlsln 129
                 +a +  +l++++i++ ++  +e w ++la+++ +   ++ +++++ l g++ d+ + +++++i+G   ++ ++v +  ++  +++   +  +++ ++ +
  ABF08007.1 866 QAPWLFALSMLFIFLCLVALYEsWTLPLAVLAIVPAGLVGAASAVWLRGLPNDVYFKVGVIVIMGLAAKNAILVVEYAEQL-RRN-GLERVQAATQAAR 962
                 6677788889999888888887478888887778899999999999999*************************9976555.554.5555567788999 PP

     PF02355 130 qtltrtiltslttllvvvallifgg 154
                 q l   ++tsl  +l vv l i +g
  ABF08007.1 963 QRLRPVVMTSLAFILGVVPLAISTG 987
                 ********************99887 PP

>> PF05345  Putative Ig domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0       1.9   5.5e+03      29      46 ..      78      95 ..      72      98 .. 0.82
   2 ?    5.9   0.1      0.03        85      17      39 ..     809     831 ..     808     833 .. 0.92

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1.9
     PF05345 29 pdqtvapGsytftVtatd 46
                +d+++++G+ t+t+   +
  ABF08007.1 78 IDSSSEAGTATVTIGFRQ 95
                79999*******996555 PP

  == domain 2    score: 5.9 bits;  conditional E-value: 0.03
     PF05345  17 tLdsstGtitGtpdqtvapGsyt 39 
                 tL+  +G i++ ++  vapG+ t
  ABF08007.1 809 TLERYNGLISVRINADVAPGTST 831
                 89999***************976 PP

>> PF02698  DUF218 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.1     0.012        34       3      44 ..     924     972 ..     922     985 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.012
     PF02698   3 daivVlG.......salspdgqlspelaeRldaaaelyragkapriivs 44 
                  +iv++G          ++++ql+ +++eR++aa +++r+   p +++s
  ABF08007.1 924 GVIVIMGlaaknaiLVVEYAEQLRRNGLERVQAATQAARQRLRPVVMTS 972
                 678888888877665567899******************8887776665 PP

>> PF09125  Cytochrome C oxidase subunit II, transmembrane
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.8   1.3    0.0026       7.4      16      32 ..     869     884 ..     866     890 .. 0.90

  Alignments for each domain:
  == domain 1    score: 8.8 bits;  conditional E-value: 0.0026
                 -HHHHHHHHHHHHHHHH CS
     PF09125  16 WLAFSLAmLFVFiALiA 32 
                 WL F+L mLF+F+ L+A
  ABF08007.1 869 WL-FALSMLFIFLCLVA 884
                 66.9***********99 PP

>> PF10490  Rb-binding domain of kinetochore protein Cenp-F/LEK1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.028        79      17      37 ..     117     137 ..     113     146 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.028
     PF10490  17 LPEvVkkGFADIPtgkasPyI 37 
                 LPEvV++G   +    asP++
  ABF08007.1 117 LPEVVRRGGVYVDQASASPFM 137
                 9*******9999999999985 PP

>> PF11341  Protein of unknown function (DUF3143)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0      0.04   1.1e+02      48      62 ..     194     208 ..     189     209 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.04
     PF11341  48 pYsLsReDvEaAila 62 
                  Y+L  +DvEaAi+a
  ABF08007.1 194 AYGLTTADVEAAIRA 208
                 5************86 PP

>> PF09149  Domain of unknown function (DUF1935)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.092   2.6e+02      68     100 ..     560     592 ..     541     596 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.092
     PF09149  68 eeeegelvaevvvkPleTelfveGevngyrikv 100
                 ee++gelv+ v+++P++T++  + ++ + ++ +
  ABF08007.1 560 EEDTGELVIDVELPPGSTQAQTRETIAQLEQWM 592
                 899****************98888887777665 PP

>> PF06189  5'-nucleotidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.13   3.7e+02     129     157 ..     407     435 ..     401     440 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.13
     PF06189 129 davlfsdeservykekgleafqehekeka 157
                 da+++ ++ er+++e+g++af++  ++++
  ABF08007.1 407 DAIVVVENVERIMREEGVDAFTAASRSMR 435
                 899999***************99887765 PP

>> PF06814  Lung seven transmembrane receptor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.2    0.0095        27     227     248 ..     465     486 ..     463     495 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.0095
     PF06814 227 lYrkfaivlvisvvasliiilv 248
                 +Yr+fa++l+is+ +sl ++l 
  ABF08007.1 465 IYRHFAMTLAISIAFSLFFALS 486
                 8****************99875 PP

>> PF06816  NOTCH protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0      0.15   4.4e+02       7      29 ..     564     586 ..     563     589 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.15
     PF06816   7 GtLvivVlippeelrnnsvqFLr 29 
                 G+Lvi+V++pp   + +  +++ 
  ABF08007.1 564 GELVIDVELPPGSTQAQTRETIA 586
                 99*********888887777765 PP

>> PF08255  Trp-operon Leader Peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1       0.2   5.6e+02       2      10 ..     600     608 ..     599     608 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.2
     PF08255   2 talisLhGW 10 
                 ++ ++L+GW
  ABF08007.1 600 KTSFALLGW 608
                 688****** PP

>> PF03248  Rer1 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1      0.22   6.3e+02      22      51 ..     862     891 ..     850     900 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.22
     PF03248  22 tpyvleRWlallvllllfllrvvlvqgfyi 51 
                  + ++  Wl++l +l++fl+ v l++++ +
  ABF08007.1 862 QSGTQAPWLFALSMLFIFLCLVALYESWTL 891
                 5556778********************965 PP

>> PF08444  Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.22   6.3e+02      15      57 ..     559     601 ..     545     605 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.22
     PF08444  15 lmdqtgelrmagtlpkYrrqglvahvivkqakalekkgiPvYs 57 
                   ++tgel +   lp   +q+   + i++ ++ +++  +Pv +
  ABF08007.1 559 PEEDTGELVIDVELPPGSTQAQTRETIAQLEQWMKQERLPVKT 601
                 5589************************************965 PP

>> PF02460  Patched family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.5   8.2      0.56   1.6e+03     649     797 ..     338     491 ..     293     497 .. 0.53

  Alignments for each domain:
  == domain 1    score: -0.5 bits;  conditional E-value: 0.56
     PF02460 649 stiqsiilalvcmavvcllfipnlitvlvitlsivSidiGvlGflslWgvdLDpismitiimsiGFsvDlsaHiayhfvrsegde..takeRvadalea 745
                  ++ +++ a v+++++  lf+ nl + l+  +++    +G++  l   g  L  i++  ++++iG  vD +  +  +  r   +e  +a   + +++ +
  ABF08007.1 338 RVLMTLAEATVLVFLILYLFLGNLRATLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMREEgvDAFTAASRSMRE 436
                 445555555555556666666665555555555544445555556666666666666666666666665444443332222222233555555555555 PP

     PF02460 746 lgwPvvqaalSTilcvlvLlfvdsymvev...FvKtvvLvvvlgllHGLiflPil 797
                 +   ++   l      ++++f  s + ++   F+ t+ ++++++l+ +L + P++
  ABF08007.1 437 VSGALLAVTLVLCAVFVPMAFLGSAVGVIyrhFAMTLAISIAFSLFFALSLAPAM 491
                 5555554444444444455555554433322255555555555555555555554 PP

>> PF09345  Domain of unknown function (DUF1987)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0      0.25   7.2e+02       9      72 ..     563     627 ..     560     637 .. 0.76

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.25
     PF09345   9 kgvleikGesypenaeefyepvldwleeylkepkkkltlnfkleYfntsss.kalleilklLekl 72 
                 +g l i+ e  p  +++  ++ ++ le+++k+++ +++ +f+l  +n+  s +   +++  L++ 
  ABF08007.1 563 TGELVIDVELPPGSTQAQTRETIAQLEQWMKQERLPVKTSFALLGWNSGGSgEQRASVFLSLDDW 627
                 56666666777777788888999*********************999975415566677666665 PP

>> PF03990  Domain of unknown function (DUF348)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.4   0.4       1.2   3.3e+03      12      27 ..      53      68 ..      52      69 .. 0.86
   2 ?    3.1   0.1      0.16   4.7e+02      13      27 ..     298     312 ..     297     313 .. 0.87

  Alignments for each domain:
  == domain 1    score: 0.4 bits;  conditional E-value: 1.2
     PF03990 12 tvwTtadTVedlLeel 27
                t++T +d V  +Le++
  ABF08007.1 53 TARTVEDRVTAVLEQQ 68
                6789999999999986 PP

  == domain 2    score: 3.1 bits;  conditional E-value: 0.16
     PF03990  13 vwTtadTVedlLeel 27 
                 v  t++TV d+L+e+
  ABF08007.1 298 VLATSRTVRDALDEA 312
                 66799*******996 PP

>> PF10509  Galactokinase galactose-binding signature
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.0      0.43   1.2e+03      30      39 ..     155     164 ..     154     165 .. 0.95

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.43
                 GGGT--BEEE CS
     PF10509  30 DYnggfVlPa 39 
                 DY+ g VlP+
  ABF08007.1 155 DYAAGTVLPM 164
                 9********9 PP

>> PF04832  SOUL heme-binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.36     1e+03     130     163 ..     577     610 ..     574     618 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.36
     PF04832 130 seeeveekakkLresleadgleesgefvlagYnp 163
                 ++++ +e  ++L++++++++l  +++f l g+n+
  ABF08007.1 577 TQAQTRETIAQLEQWMKQERLPVKTSFALLGWNS 610
                 56788999*********************99997 PP

>> PF02969  TATA box binding protein associated factor (TAF)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.0      0.86   2.4e+03      56      66 .]     197     207 ..     195     207 .. 0.94

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.86
                 B-HHHHHHHH- CS
     PF02969  56 LtvaDvdsALr 66 
                 Lt+aDv++A+r
  ABF08007.1 197 LTTADVEAAIR 207
                 9********98 PP

>> PF12017  Transposase protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.0      0.36     1e+03     145     178 ..     310     341 ..     274     351 .. 0.79

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.36
     PF12017 145 delkvaaafeydssadvvyepseyvqlaivrGlk 178
                 de   a af    + d+ y+ +++vq +i r l 
  ABF08007.1 310 DE--AAKAFPAGVAYDISYDTAHFVQSSISRVLM 341
                 33..477999999****************99875 PP

>> PF10724  Protein of unknown function (DUF2516)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.5   1.3    0.0021         6      11      76 ..     398     465 ..     387     472 .. 0.70

  Alignments for each domain:
  == domain 1    score: 9.5 bits;  conditional E-value: 0.0021
     PF10724  11 illilalvalvvevyalvdaarqra..dafeaadkrtKpvWlailgvavlvlllllsilsllgl.iavv 76 
                 +l i  lv  ++ v+  v+ +++ +  daf+aa++  ++v  a+l+v++++ ++++  + +lg  ++v+
  ABF08007.1 398 VLAIGILVDDAIVVVENVERIMREEgvDAFTAASRSMREVSGALLAVTLVLCAVFV-PMAFLGSaVGVI 465
                 3333333334455555666677665559**************************95.666666536665 PP

>> PF01863  Protein of unknown function DUF45
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.51   1.5e+03      13      46 ..     568     601 ..     562     635 .. 0.85

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.51
     PF01863  13 vevsaPkgvseeeieefveekakwikkklaklee 46 
                 + v +P+g ++++ +e +++ ++w+k+++  +++
  ABF08007.1 568 IDVELPPGSTQAQTRETIAQLEQWMKQERLPVKT 601
                 67999********************998876665 PP

>> PF07693  KAP family P-loop domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.7   0.0      0.47   1.3e+03      39      91 ..     587     658 ..     583     679 .. 0.82

  Alignments for each domain:
  == domain 1    score: 0.7 bits;  conditional E-value: 0.47
     PF07693  39 lledelkef...................kpvrflfaeinpwsskggddavaallaaladaleeeagalatrl 91 
                  le+ +k++                   +++  +f+ ++ w+  g+++a   +la l + lee  g+   +l
  ABF08007.1 587 QLEQWMKQErlpvktsfallgwnsggsgEQRASVFLSLDDWKLRGRENAADVVLARLTKGLEEWPGRGDAQL 658
                 6677777777777777777777777777788999*************************9999888776666 PP

>> PF06109  Haemolysin E (HlyE)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.3   0.1      0.62   1.8e+03     174     197 ..     456     479 ..     404     495 .. 0.77

  Alignments for each domain:
  == domain 1    score: 0.3 bits;  conditional E-value: 0.62
                 HH-------B------HHHHHHH- CS
     PF06109 174 ayagaaagvvarpfgliisysiaa 197
                 a+ g+a gv+ r f + ++ sia 
  ABF08007.1 456 AFLGSAVGVIYRHFAMTLAISIAF 479
                 677788888888888877777775 PP

>> PF02582  Uncharacterised ACR, YagE family COG1723
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.53   1.5e+03       4      43 ..     920     959 ..     918     970 .. 0.83

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.53
     PF02582   4 iFknGsvVfwnlseeeekkilaflnsfsaepleekeieee 43 
                  Fk G++V+++l  ++   +++  +++ ++ le+ +  ++
  ABF08007.1 920 YFKVGVIVIMGLAAKNAILVVEYAEQLRRNGLERVQAATQ 959
                 7************999999999999988888887665555 PP

>> PF09851  Predicted membrane protein (DUF2078)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.014        39       4      39 ..     997    1035 ..     987    1043 .. 0.73

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.014
     PF09851    4 gwgw..ggllmlllwlllialvvyllvrllkg.sssgsd 39  
                  g g+  g+l   +l  l+i l+ +++ r+ k+  +++++
  ABF08007.1  997 GTGVlgGMLGATILGTLVIPLLYAWIARWSKArATTEPA 1035
                  444466999999*******9***9****98854222222 PP

>> PF11798  IMS family HHH motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0      0.94   2.7e+03      14      23 ..     165     174 ..     165     176 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.94
                 GGGSTT---- CS
     PF11798  14 itdlpGiGgk 23 
                 ++ lpGiG++
  ABF08007.1 165 LRRLPGIGKV 174
                 689*****96 PP

>> PF05510  Sarcoglycan alpha/epsilon
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.9   0.1      0.82   2.3e+03     298     325 ..     467     494 ..     465     504 .. 0.89

  Alignments for each domain:
  == domain 1    score: -0.9 bits;  conditional E-value: 0.82
     PF05510 298 deivitlaipllvalllvllLalilcfq 325
                  ++++tlai  + +l ++l La  +c +
  ABF08007.1 467 RHFAMTLAISIAFSLFFALSLAPAMCAS 494
                 5799**********************75 PP

>> PF05953  Allatostatin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   0.5       1.6   4.6e+03       6      10 ..     383     387 ..     382     387 .. 0.96

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 1.6
     PF05953   6 YaFGL 10 
                 YaFGL
  ABF08007.1 383 YAFGL 387
                 ****9 PP

>> PF11954  Domain of unknown function (DUF3471)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   0.0       1.5   4.4e+03      72      97 ..     756     781 ..     753     784 .. 0.78

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 1.5
     PF11954  72 ldedGrvtsltlhqegt.segeplelk 97 
                 l  dGrv +++l++++  +  +p++l 
  ABF08007.1 756 LARDGRVRRVILQADAPfR-MQPEDLA 781
                 5689**********96656.7777665 PP

>> PF03303  WTF protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.2     0.074   2.1e+02     133     163 ..     874     903 ..     864     945 .. 0.74

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.074
     PF03303 133 icllllilllyfyEtWtkavkvtvivigvGl 163
                   l+++++l++ yE Wt  + v  i + +Gl
  ABF08007.1 874 SMLFIFLCLVALYESWTLPLAVLAI-VPAGL 903
                 567899999********98877665.23333 PP

>> PF05431  Insecticidal Crystal Toxin, P42
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.6   0.2         2   5.7e+03      36      43 ..     364     371 ..     361     377 .. 0.88

  Alignments for each domain:
  == domain 1    score: -0.6 bits;  conditional E-value: 2
     PF05431  36 tLiPcimV 43 
                 tLiPci+V
  ABF08007.1 364 TLIPCIVV 371
                 9*****99 PP

>> PF03406  Phage tail fibre repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1      0.26   7.3e+02      23      38 ..     300     315 ..     300     319 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.26
     PF03406  23 ATpKAVKaayDlAnaa 38 
                 AT++ V +a D+A  a
  ABF08007.1 300 ATSRTVRDALDEAAKA 315
                 9************876 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (1044 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       653  (0.0548187); expected 238.2 (0.02)
Passed bias filter:                      293  (0.024597); expected 238.2 (0.02)
Passed Vit filter:                        41  (0.00344191); expected 11.9 (0.001)
Passed Fwd filter:                        41  (0.00344191); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              35  [number of targets reported over threshold]
# CPU time: 0.71u 0.05s 00:00:00.76 Elapsed: 00:00:01
# Mc/sec: 3174.50
//