# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_24075.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABF08549.1  [L=341]
Description: rmet0 ABF08549.1 GIB00349CH01 "Transposase and inactivated derivatives-like pro.."
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      4e-10   42.1   0.1    6.6e-10   41.4   0.1    1.3  1  PF03050  Transposase IS66 family
      3e-07   33.2   0.2    8.3e-07   31.8   0.1    1.8  1  PF00665  Integrase core domain
  ------ inclusion threshold ------
        4.3   10.0   0.2          9    9.0   0.1    1.4  1  PF09691  Bacterial chaperone lipoprotein (PulS_OutS)
         11    8.2   0.9         67    5.7   0.1    2.4  2  PF01165  Ribosomal protein S21
         49    6.7   0.0      1e+02    5.7   0.0    1.5  1  PF07308  Protein of unknown function (DUF1456)
         54    5.9   0.0    1.1e+02    4.9   0.0    1.6  1  PF04815  Sec23/Sec24 helical domain
         59    7.1   1.5    1.1e+02    6.2   0.0    2.4  1  PF08238  Sel1 repeat
         61    5.9   0.8    1.7e+02    4.5   0.0    1.9  1  PF11395  Protein of unknown function (DUF2873)
         88    5.9   0.1    2.3e+02    4.6   0.1    1.7  1  PF07719  Tetratricopeptide repeat
    1.4e+02    5.0   0.0    2.8e+02    4.0   0.0    1.4  1  PF10448  20S proteasome chaperone
    1.7e+02    4.8   0.0    3.7e+02    3.7   0.0    1.6  1  PF09597  IGR protein motif
    1.9e+02    4.6   0.0      4e+02    3.5   0.0    1.5  1  PF08343  Ribonucleotide reductase N-terminal
    1.9e+02    4.0   0.0      3e+02    3.3   0.0    1.2  1  PF06532  Protein of unknown function (DUF1109)
      1e+03    1.6   0.0    1.6e+03    1.0   0.0    1.2  1  PF07698  7TM receptor with intracellular HD hydrolase
    1.5e+03    2.6   0.7    3.4e+03    1.5   0.5    1.5  1  PF09598  Stm1


Domain and alignment annotation for each model:
>> PF03050  Transposase IS66 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   41.4   0.1   9.9e-14   6.6e-10      48     160 ..      21     126 ..       6     134 .. 0.89

  Alignments for each domain:
  == domain 1    score: 41.4 bits;  conditional E-value: 9.9e-14
     PF03050  48 sllahvlvlkyadhlPlyrqaeilarlGveisrstlanwvgrvaelleplydalkaellaspvlhaDETpvrvlkekgkgkkgylWvyvrsdppavlfd 146
                  ++  ++  ++a+ l+l+ ++e++a+ G+++++s++ +wv++   l+e+   + k+ ++  + + +DET+++v      gk +yl+ +v+++ + + f 
  ABF08549.1  21 DVILLCVRWYVAYSLSLRDLEEMMAERGLAVDHSMVHRWVIKLLPLFEKAFRRHKRSVS--KSWRMDETYLKVR-----GKWAYLYRAVDKAGNTIDFL 112
                 566678888999**********************************************9..8899*********.....***********999999999 PP

     PF03050 147 yspsRsgehaeall 160
                    +R++ +a++ +
  ABF08549.1 113 LCARRDKVAARRYF 126
                 99999888887766 PP

>> PF00665  Integrase core domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.8   0.1   1.3e-10   8.3e-07       7     119 ..      80     184 ..      74     185 .. 0.86

  Alignments for each domain:
  == domain 1    score: 31.8 bits;  conditional E-value: 1.3e-10
     PF00665   7 elwqiDvtpgripskggkaylltaiddfsrfivaealkdessaetvadlleraverrggvepkrllsDngseftskafeallkelgirhkftrpyrpqd 105
                   w +D t++++ +k+  ayl+ a+d++ + i +  + ++ ++ ++ + +e+a+ + g   p+++  D+ ++   +a+ a+ ++  + ++     r + 
  ABF08549.1  80 KSWRMDETYLKVRGKW--AYLYRAVDKAGNTIDFLLCARR-DKVAARRYFEKAIGQNGA--PDTVAIDKSAANL-AALHAVNAHRETPIRIRQ--RKYL 170
                 57*********77666..**********************.**************9999..*******886655.577777666666555544..7*** PP

     PF00665 106 ngkvErfnrtlkee 119
                 n++vE+ +r +k++
  ABF08549.1 171 NNIVEQDHRAIKRR 184
                 ************97 PP

>> PF09691  Bacterial chaperone lipoprotein (PulS_OutS)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.1    0.0013         9      30      86 ..     120     174 ..     118     186 .. 0.80

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0013
     PF09691  30 vagsryLkekCnrsdlPdeaailktAikvakkkgwdtaekayqklpkkseelyqkll 86 
                 va+ ry  +   ++  Pd  ai k+A ++a  +  + ++  +  ++ + ++  ++++
  ABF08549.1 120 VAARRYFEKAIGQNGAPDTVAIDKSAANLAALHAVNAHR--ETPIRIRQRKYLNNIV 174
                 89****************************999888877..5555555555555554 PP

>> PF01165  Ribosomal protein S21
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.1      0.01        67      11      25 ..      67      81 ..      66      87 .. 0.90
   2 ?    0.0   0.1      0.58   3.9e+03      32      39 ..     121     128 ..     117     130 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.01
                ------SSSTTTT-- CS
     PF01165 11 ierALrrfkrkveka 25
                +e+A+rr kr v+k+
  ABF08549.1 67 FEKAFRRHKRSVSKS 81
                79**********997 PP

  == domain 2    score: 0.0 bits;  conditional E-value: 0.58
                 SS---TTT CS
     PF01165  32 rrrrfyek 39 
                  +rr++ek
  ABF08549.1 121 AARRYFEK 128
                 689****9 PP

>> PF07308  Protein of unknown function (DUF1456)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.015     1e+02      10      41 ..      31      62 ..      23      89 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.015
     PF07308 10 yaldlkdedmveifklagvevtkeelsallkk 41
                +a +l+  d+ e++++ g+ v+++ ++ ++ k
  ABF08549.1 31 VAYSLSLRDLEEMMAERGLAVDHSMVHRWVIK 62
                577889999********************998 PP

>> PF04815  Sec23/Sec24 helical domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.017   1.1e+02      57      85 ..      60      88 ..       8      92 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.017
                GGTTHHHHHHHHHTSTTT------HHHHH CS
     PF04815 57 slkllPlyilaLlKspalrvfnvspDera 85
                 +kllPl+  a+++++   + + + De+ 
  ABF08549.1 60 VIKLLPLFEKAFRRHKRSVSKSWRMDETY 88
                589************99888999999986 PP

>> PF08238  Sel1 repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.0     0.017   1.1e+02      21      37 ..     116     132 ..      97     134 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.017
                 ---HHHHHHHHHHHHHT CS
     PF08238  21 pkdpekAleWyekAAeq 37 
                 ++d+  A++++ekA  q
  ABF08549.1 116 RRDKVAARRYFEKAIGQ 132
                 56999*********766 PP

>> PF11395  Protein of unknown function (DUF2873)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.025   1.7e+02      22      39 ..      22      42 ..      19      45 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.025
     PF11395 22 LimLiiFW...FsLelqDlee 39
                +i+L + W   +sL l Dlee
  ABF08549.1 22 VILLCVRWyvaYSLSLRDLEE 42
                688899994445********9 PP

>> PF07719  Tetratricopeptide repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.1     0.035   2.3e+02      12      28 ..     114     130 ..     111     134 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.035
                 HH---HHHHHHHHHHHH CS
     PF07719  12 yklgdyeeAleafekAl 28 
                  +++d   A+++fekA+
  ABF08549.1 114 CARRDKVAARRYFEKAI 130
                 56678889********8 PP

>> PF10448  20S proteasome chaperone
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.041   2.8e+02      18      54 ..     142     178 ..     123     187 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.041
                 ---EEEEEEEECCESSSSCEEEEEE-----EEEEEEE CS
     PF10448  18 tssedvevaitalhfsnkiplsiringemdstyevss 54 
                 ++s+ +  a++a++ ++++p+ ir  + ++  +e + 
  ABF08549.1 142 DKSAANLAALHAVNAHRETPIRIRQRKYLNNIVEQDH 178
                 478889999***************9999888888765 PP

>> PF09597  IGR protein motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0     0.056   3.7e+02      36      52 ..     159     175 ..     126     177 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.056
     PF09597  36 elGipvkqRrYiLsqve 52 
                 e  i ++qR+Y+ ++ve
  ABF08549.1 159 ETPIRIRQRKYLNNIVE 175
                 66799******988776 PP

>> PF08343  Ribonucleotide reductase N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.06     4e+02      21      37 ..     117     133 ..     110     156 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.06
                 HHHHHHHHHHHHTTGGG CS
     PF08343  21 kDkeAleaylkehvnpn 37 
                  Dk A+++y+++ + +n
  ABF08549.1 117 RDKVAARRYFEKAIGQN 133
                 7***********99988 PP

>> PF06532  Protein of unknown function (DUF1109)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0     0.045     3e+02     160     185 ..       7      32 ..       5      45 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.045
     PF06532 160 GalaalaYalhCpedsvlfvalWyll 185
                 +++a+++  lh+p d +l  + Wy++
  ABF08549.1   7 AGVAKVLKRLHHPLDVILLCVRWYVA 32 
                 78999999****************97 PP

>> PF07698  7TM receptor with intracellular HD hydrolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.0      0.25   1.6e+03     179     191 ..      60      72 ..      54      73 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.25
     PF07698 179 aigllPllEslFg 191
                 +i llPl+E++F+
  ABF08549.1  60 VIKLLPLFEKAFR 72 
                 6889*******95 PP

>> PF09598  Stm1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.5       0.5   3.4e+03      42      64 ..     236     258 ..     233     262 .. 0.81

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.5
     PF09598  42 PnkpaPreqadrerRgrqapsgn 64 
                 P+ + P++ ++r+ R r+++ g 
  ABF08549.1 236 PAHSSPPASTNRPYRDRTKGAGA 258
                 78889999999**9999888775 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (341 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       231  (0.0193922); expected 238.2 (0.02)
Passed bias filter:                      205  (0.0172095); expected 238.2 (0.02)
Passed Vit filter:                        15  (0.00125923); expected 11.9 (0.001)
Passed Fwd filter:                        15  (0.00125923); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              15  [number of targets reported over threshold]
# CPU time: 0.23u 0.04s 00:00:00.27 Elapsed: 00:00:00
# Mc/sec: 3200.81
//