hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_24069.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABF07939.1
Accession:      [none]
Description:    rmet0 ABF07939.1 GIB00349CH01 "2-dehydro-3-deoxyphosphooctonate aldolase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0048496  Aldolase                                       334.0      1e-98   1
0046878  Aldolase                                       297.6    2.7e-85   1
0046288  Aldolase                                       291.0      5e-85   1
0046975  Aldolase                                       233.9    2.1e-73   1
0049279  Aldolase                                       231.0    6.5e-71   1
0051114  Aldolase                                       222.5    2.8e-68   1
0047183  Aldolase                                       200.7    6.8e-59   1
0050239  Aldolase                                       191.9    1.2e-56   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0046288    1/1       1   283 [.     1   284 []   291.0    5e-85
0047183    1/1       1   276 [.    34   347 .]   200.7  6.8e-59
0048496    1/1       1   281 [.     1   281 []   334.0    1e-98
0050239    1/1       1   278 [.     1   295 []   191.9  1.2e-56
0046975    1/1       2   277 ..     1   343 []   233.9  2.1e-73
0049279    1/1       5   275 ..    87   338 .]   231.0  6.5e-71
0051114    1/1       7   285 ..     1   280 []   222.5  2.8e-68
0046878    1/1      12   275 ..     1   263 []   297.6  2.7e-85

Alignments of top-scoring domains:
0046288: domain 1 of 1, from 1 to 283: score 291.0, E = 5e-85
                   *->vlnsrikignilignddrllviaGpcsieseeaaleyAkrlielakk
                           +k+ ++ +g d+++++iaGpc+iese++al++A +l++++ +
  ABF07939.1     1    -----MKLCGFDVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGE 42   

                   lgldivfkvsfekpnrtsvdsfkglgleeglklllevaeelglpvltevl
                   lg+++++k sf+k+nr+s +sf+glg+e+gl++l+ v++++g+pvlt+++
  ABF07939.1    43 LGIPFIYKSSFDKANRSSGKSFRGLGMEKGLEILATVKRQIGVPVLTDIH 92   

                   dpisvdlladlvdvlqIgArltentdllrevAstgkpvllkngtsaslee
                   ++  ++ +a +vdvlq +A+l+++td++r++A+ gkpv++k+g+++++++
  ABF07939.1    93 EIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAPHD 142  

                   alnavek....iltaGnpd..iillergssypynylvvdlraipilkklf
                   ++n+++k+ +++++aG pd++++ +erg s++yn+lv+d+r+++i++++ 
  ABF07939.1   143 MKNVIDKardaAREAGLPDdvFMACERGVSFGYNNLVSDMRSLAIMRET- 191  

                   lglpvivDasHsnslkgglsdhtlgvrelvlalaraavalgadGlmiEsH
                    g+pv++Da+Hs++l+gg++ +++g+re+v++l+raava+g++Gl++E+H
  ABF07939.1   192 -GAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGVAGLFMETH 240  

                   ldpdnalsdgpqsltlgsltdllidlkatekllgslakavelkveivdillggddrllviaGPCsiedeeaaleyAerLkelgaklkddl
                      ++++++ +g d+++++iaGPC+ie+e++al++A+ Lk+++ +l  ++
  ABF07939.1     1    MKLCGFDVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGEL--GI 45   

                   livlRvyfeKPrttvg..fkGlindPdldgsfdieeGLkilrkllldlee
                    ++++ +f+K+++++g+ f+Gl+          +e+GL+il+ +   +++
  ABF07939.1    46 PFIYKSSFDKANRSSGksFRGLG----------MEKGLEILATV---KRQ 82   

                   lglpvatEvldpispqyvadlvdwlaIGArttesqlllelasglskPvgl
                   +g+pv+t+++++  ++ va +vd+l+ +A++++++++++++++ +kPv++
  ABF07939.1    83 IGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNI 132  

                   KngtdgtlevaldAilaasaphfflgvdkegvaeivlts....Gnpd..v
                   K+g                  +f++++d+++v+ +++ ++ ++G pd+++
  ABF07939.1   133 KKG------------------QFLAPHDMKNVIDKARDAareaGLPDdvF 164  

                   hlilRGgrtgpnylvldlaavplllekaglPvivDasHa...........
                   ++++RG+++g+n+lv d++++++ ++++g Pv++Da+H+++    + +  
  ABF07939.1   165 MACERGVSFGYNNLVSDMRSLAI-MRETGAPVVFDATHSvqlpggqgtss 213  

                   ngnkdlvrqlavledvleqraagaagidGlmiEsh......lsdGnqslp
                   +g++++v++l+        raa+a+g++Gl++E+h +  +++sdG++++p
  ABF07939.1   214 GGQREFVPVLS--------RAAVATGVAGLFMETHpdpskaMSDGPNAVP 255  

                   lddleellyglsitdaclgwedtekllrelaeavkarlelrkedtvvkigdiliggdkpllliaGpcvieseelaleiAealkelaeel
                          +k+ ++ +g dkp++liaGpcviese++al++A++lk+++ el
  ABF07939.1     1    ----MKLCGFDVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGEL 43   

                   giplvrkgsfkkapRTspysfrglgleeglkilaevkeelglpvvtevhd
                   gip+++k+sf+ka+R+s +sfrglg+e+gl+ila vk+++g+pv+t++h+
  ABF07939.1    44 GIPFIYKSSFDKANRSSGKSFRGLGMEKGLEILATVKRQIGVPVLTDIHE 93   

                   peqvelvaevvdvlqigArlmrntdlleavaktgkpvllkkgqfltleem
                   ++++++va vvdvlq +A+l+r+td+++a+a+ gkpv++kkgqfl++++m
  ABF07939.1    94 IDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAPHDM 143  

                   lnaaekilsa....Gndn..vilcerGistgynrlvldlralpvlkellt
                   +n+++k+++a+ ++G ++++ + cerG+s+gyn+lv+d+r+l++++e  t
  ABF07939.1   144 KNVIDKARDAareaGLPDdvFMACERGVSFGYNNLVSDMRSLAIMRE--T 191  

                   glPvivDpsHavqlpgglgdssgGlrelvlplaraavaaGadGlfiEvhp
                   g+Pv++D++H+vqlpgg+g+ssgG+re+v++l+raava+G++Glf+E+hp
  ABF07939.1   192 GAPVVFDATHSVQLPGGQGTSSGGQREFVPVLSRAAVATGVAGLFMETHP 241  

                   dPdkalsdgpqalpldeleelleelraidelvkslvllllkeikignlligndkplfiiAEiGpnhngslelalklidaakeagada
                        +k+ ++ +g dkp+f+iA  Gp++++s+++al+++ ++k++    
  ABF07939.1     1    --MKLCGFDVGLDKPFFLIA--GPCVIESEQMALDTAGELKAI---- 39   

                   vKfQtytadtlvlkidylrkgsfdkalnrtslysflglgle.glkiLkey
                            t  l+i++++k+sfdka nr+s +sf+glg+e+gl+iL+ +
  ABF07939.1    40 ---------TGELGIPFIYKSSFDKA-NRSSGKSFRGLGMEkGLEILATV 79   

                   ckelgipflttvfdlesvdllaelnvdilkiasfeltnlpllkaiaktgk
                   ++++g+p+lt++++++ ++ +a + vd+l+ ++f+++++++++a+a+ gk
  ABF07939.1    80 KRQIGVPVLTDIHEIDEIKPVAAV-VDVLQTPAFLCRQTDFIRACAQSGK 128  

                   pvilstG.mstleeilnavekl....lkagnkniiLl...hcts.gYptl
                   pv++++G+++++++++n+++k+ +++++ag ++ ++++ ++++s gY++l
  ABF07939.1   129 PVNIKKGqFLAPHDMKNVIDKArdaaREAGLPDDVFMaceRGVSfGYNNL 178  

                   vedvnlraipilkklfglpvigdsdHsl..lg.............illal
                   v   ++r++ i+++ +g pv++d++Hs++ +g + +    + + +++l++
  ABF07939.1   179 V--SDMRSLAIMRE-TGAPVVFDATHSVqlPGgqgtssggqrefvPVLSR 225  

                   aAvalGa..liiEkHftldkalsgpDgaaslepdelkelvkelraiekal
                   aAva G++ l++E+H++++ka+s  Dg+++++++++kel++ lr ++ ++
  ABF07939.1   226 AAVATGVagLFMETHPDPSKAMS--DGPNAVPLSRMKELLTVLRDLDGMV 273  

                   gsglkkllksellrrslvalkdikGdlrilgikplispaelleelPlseellelvlesreeildillgeddr
                                                         +++++ +g d++
  ABF07939.1     2    -----------------------------------KLCGFDVGLDKP 13   

                   llviaGPCsiedeeaaleyaerLkelaeklkdgllivmrvyfeKPrttv.
                   +++iaGPC+ie+e++al++a+ Lk+++ +l  g+ ++++ +f+K+++++ 
  ABF07939.1    14 FFLIAGPCVIESEQMALDTAGELKAITGEL--GIPFIYKSSFDKANRSSg 61   

                   .gwkGlindPdldgsfdieeGLkilrkllldlaelglpvatevldpitpq
                   ++++Gl+          +e+GL+il+ ++   +++g+pv+t+++++  ++
  ABF07939.1    62 kSFRGLG----------MEKGLEILATVK---RQIGVPVLTDIHEIDEIK 98   

                   yvadlvdwlaiGArttesqlllelasglskPvglKngtdgnlevalnail
                    va +vd+l+ +A++++++++++++++ +kPv++K+g+++++++++n+i 
  ABF07939.1    99 PVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAPHDMKNVID 148  

                   aasaphlflgvnkeGlaaivlttGnpdvhlilRGgsfpnydlvslalalv
                   +a+             aa  +   ++ +++++RG+sf++++lvs++++l+
  ABF07939.1   149 KARD------------AAREAGLPDDVFMACERGVSFGYNNLVSDMRSLA 186  

                   llakaglnlpvvvDasHsn.........sgkdlerqllvaedvleqraag
                   +++++g  +pvv+Da+Hs++    + + sg+++e+++++       raa+
  ABF07939.1   187 IMRETG--APVVFDATHSVqlpggqgtsSGGQREFVPVLS------RAAV 228  

                   avgidGvmiEshldpgnqlsdgpnsltygvsiTDaclgwedteklLrlla
                   a+g++G+++E+h+dp++++sdgpn++ ++        ++++++++Lr l 
  ABF07939.1   229 ATGVAGLFMETHPDPSKAMSDGPNAVPLS--------RMKELLTVLRDLD 270  

                   eavklrrgvligddrplvia.Gpcsieslelalelaealkea....gadavrfg
                      g+ +g d+p+++++Gpc+ies+++al++a++lk+++ + g+++++++
  ABF07939.1     5    GFDVGLDKPFFLIaGPCVIESEQMALDTAGELKAItgelGIPFIYKS 51   

                   tfk..prtsvysfqglgle.glkilrelleelglpvltevldpesvdlla
                   +f++++r+s  sf+glg+e+gl+il+ +++++g+pvlt+++++++++ +a
  ABF07939.1    52 SFDkaNRSSGKSFRGLGMEkGLEILATVKRQIGVPVLTDIHEIDEIKPVA 101  

                   dlvdilqigArnmtnfdlleaaaktgkpvllkrGmsatleeilnAv....
                    +vd+lq +A++++++d+++a+a+ gkpv++k+G+++++++++n+++++ 
  ABF07939.1   102 AVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAPHDMKNVIdkar 151  

                   eyilsagnpn..villerGirtfypytrnvvdlraipllkelfglpvivD
                   +  ++ag p+++++ +erG++  ++y+++v d+r++++++e +g+pv++D
  ABF07939.1   152 DAAREAGLPDdvFMACERGVS--FGYNNLVSDMRSLAIMRE-TGAPVVFD 198  

                   psHgl...........sdhelvlqlavaavalgadGlmiEvHltpdkals
                   ++H+++    + +   +++e+v++l++aava g++Gl++E+H++p+ka+s
  ABF07939.1   199 ATHSVqlpggqgtssgGQREFVPVLSRAAVATGVAGLFMETHPDPSKAMS 248  

                   DgpqslepdeleelveeiraieealgsgvklvlelikivsrligeddpllvIaeigvnhngdlelakeliliAgpcg
                                                     d++l+k+++liAgpc+
  ABF07939.1     7    -------------------------------DVGLDKPFFLIAGPCV 22   

                   aesvkfqlltaetl...vkklgi.lilkgsadk.prtslysflglgle.g
                   +es++++l ta++l++++ +lgi +i+k+s+dk++r+s  sf+glg+e+g
  ABF07939.1    23 IESEQMALDTAGELkaiTGELGIpFIYKSSFDKaNRSSGKSFRGLGMEkG 72   

                   lkiLaevaeelglpvltevfdlesvdllaelgvdvlkigafeltntdllr
                   l+iLa v++++g+pvlt++++++ ++++a + vdvl+ +af++++td++r
  ABF07939.1    73 LEILATVKRQIGVPVLTDIHEIDEIKPVAAV-VDVLQTPAFLCRQTDFIR 121  

                   avaktgkpvilktG.matleeillavekl....reagn.dlvllrctrgy
                   a+a+ gkpv++k+G+++++++++++++k+ +++reag  d v + c+rg+
  ABF07939.1   122 ACAQSGKPVNIKKGqFLAPHDMKNVIDKArdaaREAGLpDDVFMACERGV 171  

                   ptpyen..ldlraipvlkelflpvivglSdHslglp..............
                   +++y+n + d+r++++++e+++pv+++++ Hs++lp  + +    + + +
  ABF07939.1   172 SFGYNNlvSDMRSLAIMRETGAPVVFDAT-HSVQLPggqgtssggqrefv 220  

                   ..laraAvalG..alfiEkHftpdkalsgpDgpaslepdelealveelra
                    +l+raAva G+++lf+E+H++p+ka+s  Dgp++++++++++l++ lr+
  ABF07939.1   221 pvLSRAAVATGvaGLFMETHPDPSKAMS--DGPNAVPLSRMKELLTVLRD 268  

                   iekalgd..plelelledrllviaGpCsieseeaaleyaerlkelgaklldillivlrsyakkp
                      +++++iaGpC+iese++al++a+ lk+++ + l+i++i+++s++k++
  ABF07939.1    12    KPFFLIAGPCVIESEQMALDTAGELKAITGE-LGIPFIYKSSFDKAN 57   

                   RtsvgsfkGlgleegldilaevkeelglpvatevldpiqvelvadlvdvl
                   R+s +sf+Glg+e+gl+ila vk+++g+pv+t+++++  +++va +vdvl
  ABF07939.1    58 RSSGKSFRGLGMEKGLEILATVKRQIGVPVLTDIHEIDEIKPVAAVVDVL 107  

                   qigArltentdlleaaagtgkpvllKkGtfltleealnave....kilta
                   q +A+l+++td+++a+a+ gkpv++KkG+fl++++++n+++++ + +++a
  ABF07939.1   108 QTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAPHDMKNVIDkardAAREA 157  

                   Gnpn..vilieRGgstgpnylvldlralpvlle.glpvivDashsvslkg
                   G p+++ +++eRG+s+g+n+lv d+r+l++++e+g+pv++Da+hsv+l+g
  ABF07939.1   158 GLPDdvFMACERGVSFGYNNLVSDMRSLAIMREtGAPVVFDATHSVQLPG 207  

                   glgqlsvgrrvlvlalaraavalgadGlmiEsHldpdnalsDgpqslpld
                   g+g++s+g+r++v++l+raava+g++Gl++E+H+dp++a+sDgp+++pl+
  ABF07939.1   208 GQGTSSGGQREFVPVLSRAAVATGVAGLFMETHPDPSKAMSDGPNAVPLS 257  

                   eleellyglsitdaclgweetel