hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_24070.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABF08099.1
Accession:      [none]
Description:    rmet0 ABF08099.1 GIB00349CH01 "dihydroorotate oxidase A"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0050003  FMN-linked oxidoreductases                     347.0     3e-104   1
0049708  FMN-linked oxidoreductases                     273.2    7.9e-84   1
0036258  FMN-linked oxidoreductases                     262.4    2.5e-77   1
0046721  FMN-linked oxidoreductases                     259.0    4.8e-77   1
0047140  FMN-linked oxidoreductases                     233.5    6.9e-71   1
0051899  FMN-linked oxidoreductases                     204.7    4.2e-64   1
0046599  FMN-linked oxidoreductases                     209.4    1.1e-61   1
0052481  FMN-linked oxidoreductases                     196.0    4.7e-59   1
0048029  FMN-linked oxidoreductases                     156.9    9.2e-47   1
0050135  FMN-linked oxidoreductases                      97.4      2e-28   1
0039992  Ribulose-phoshate binding barrel                90.2    2.1e-25   1
0049587  FMN-linked oxidoreductases                      73.2    1.7e-20   1
0047026  FMN-linked oxidoreductases                      62.1    2.8e-17   1
0041152  Aldolase                                        59.9    8.6e-17   1
0049848  Aldolase                                        65.0    1.1e-16   1
0044760  FMN-linked oxidoreductases                      51.5      3e-14   1
0049629  Ribulose-phoshate binding barrel                37.3      2e-10   1
0052610  FMN-linked oxidoreductases                      36.9    2.4e-09   1
0045712  Ribulose-phoshate binding barrel                29.8    1.2e-08   1
0045046  Thiamin phosphate synthase                      29.3    6.1e-08   1
0051598  Ribulose-phoshate binding barrel                29.2    9.2e-08   1
0041658  Aldolase                                        29.5    2.2e-07   1
0047996  FMN-linked oxidoreductases                      23.4    2.2e-07   1
0047242  FMN-linked oxidoreductases                      24.2    2.3e-07   1
0051442  Ribulose-phoshate binding barrel                26.2    9.6e-07   1
0039781  Ribulose-phoshate binding barrel                23.7    4.8e-06   1
0048998  Ribulose-phoshate binding barrel                24.4    5.9e-06   1
0046501  FMN-linked oxidoreductases                      18.0    8.2e-06   1
0050717  ThiG-like                                       23.3      9e-06   1
0047561  Inosine monophosphate dehydrogenase (IMPDH)     20.3    9.1e-06   1
0050201  FMN-linked oxidoreductases                      20.3    1.3e-05   1
0046530  Inosine monophosphate dehydrogenase (IMPDH)     21.3    3.7e-05   1
0050322  Ribulose-phoshate binding barrel                20.9      5e-05   1
0042445  FMN-linked oxidoreductases                      19.1    7.7e-05   1
0051489  FMN-linked oxidoreductases                      17.6    0.00013   1
0047125  Ribulose-phoshate binding barrel                15.7    0.00022   1
0048294  Aldolase                                        16.3    0.00022   1
0049739  ThiG-like                                       13.5    0.00036   1
0048832  Inosine monophosphate dehydrogenase (IMPDH)     14.1    0.00047   1
0038429  FMN-linked oxidoreductases                      14.2    0.00066   1
0049146  Ribulose-phoshate binding barrel                13.7    0.00095   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0046721    1/1      18   356 ..     1   336 []   259.0  4.8e-77
0049708    1/1      18   358 ..     1   409 []   273.2  7.9e-84
0050003    1/1      18   358 ..     1   359 []   347.0   3e-104
0050135    1/1      55   357 ..     1   310 []    97.4    2e-28
0042445    1/1      56   359 ..     1   330 []    19.1  7.7e-05
0047561    1/1      56   343 ..     1   371 []    20.3  9.1e-06
0048029    1/1      60   358 ..     1   414 []   156.9  9.2e-47
0036258    1/1      61   358 ..     1   367 []   262.4  2.5e-77
0046599    1/1      61   350 ..     1   311 []   209.4  1.1e-61
0051899    1/1      61   358 ..     1   312 []   204.7  4.2e-64
0047140    1/1      62   358 ..     1   312 []   233.5  6.9e-71
0052481    1/1      63   358 ..     1   311 []   196.0  4.7e-59
0049587    1/1      64   358 ..     1   349 []    73.2  1.7e-20
0047026    1/1      65   358 ..     1   359 []    62.1  2.8e-17
0045046    1/1      66   360 .]     1   206 []    29.3  6.1e-08
0044760    1/1      73   356 ..     1   305 []    51.5    3e-14
0039992    1/1     119   357 ..     1   251 []    90.2  2.1e-25
0051598    1/1     162   343 ..     1   254 []    29.2  9.2e-08
0051489    1/1     168   357 ..   138   337 .]    17.6  0.00013
0052610    1/1     173   354 ..     1   231 []    36.9  2.4e-09
0041152    1/1     186   343 ..    84   225 .]    59.9  8.6e-17
0049848    1/1     186   341 ..    84   211 .]    65.0  1.1e-16
0039781    1/1     208   344 ..   183   323 .]    23.7  4.8e-06
0050717    1/1     216   343 ..     1   243 []    23.3    9e-06
0038429    1/1     232   354 ..   228   364 .]    14.2  0.00066
0046501    1/1     232   343 ..   572   676 ..    18.0  8.2e-06
0047242    1/1     232   344 ..   223   353 .]    24.2  2.3e-07
0047996    1/1     232   343 ..   591   695 ..    23.4  2.2e-07
0049629    1/1     234   359 ..   140   253 .]    37.3    2e-10
0045712    1/1     238   354 ..   132   247 .]    29.8  1.2e-08
0041658    1/1     240   335 ..   160   251 .]    29.5  2.2e-07
0050322    1/1     279   357 ..   165   239 .]    20.9    5e-05
0046530    1/1     282   359 ..   223   388 .]    21.3  3.7e-05
0049146    1/1     285   358 ..   176   261 .]    13.7  0.00095
0048294    1/1     288   360 .]   170   234 .]    16.3  0.00022
0048832    1/1     288   337 ..   197   249 ..    14.1  0.00047
0051442    1/1     288   357 ..   162   230 .]    26.2  9.6e-07
0047125    1/1     294   359 ..   184   252 .]    15.7  0.00022
0049739    1/1     294   343 ..   163   242 .]    13.5  0.00036
0050201    1/1     297   359 ..   170   229 .]    20.3  1.3e-05
0048998    1/1     298   357 ..   179   241 .]    24.4  5.9e-06

Alignments of top-scoring domains:
0046721: domain 1 of 1, from 18 to 356: score 259.0, E = 4.8e-77
                   *->alrrllrpllfylddevtlrlnllafddilllprvlpdvsldvdlst
                      al+ llrp+lf +d+e +++++l+ + +   +  +  + +   d + 
  ABF08099.1    18    ALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGCIGNSIADDPR 64   

                   tllgltlknPlvlapmtvtdaelaialaalgaglivlgtvtveplegnvs
                   t++g++++nP++la++ ++d+++++ laa+g+g+i++gtvt+++++gn+ 
  ABF08099.1    65 TVMGVRFPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPR 114  

                   prllrlpedeaiinlyglndpgleellervkaagiki...pvganlgvde
                   pr++rlp+++a+in++g+n+ g++++++ v+a + k++  ++g n+g++ 
  ABF08099.1   115 PRMFRLPQADALINRMGFNNGGVDAFIRNVQASRWKAeggVLGLNIGKNA 164  

                   ilplgarvedfaeaarlaeegadaielnfssPnlpnlrsdeyggslenrp
                    +p+++ ++d++ ++++++++a ++ +n+ssPn++nlr++++ + l   +
  ABF08099.1   165 DTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASELDSLL 214  

                   rllleiikavreavgedvpvivKlspgldvediedlakaleeaGadaiiv
                   + l+   +++ +++++ vpv +K++p+ld++++ ++ +al+++ +d++i+
  ABF08099.1   215 STLKAAQQRLADQHKRYVPVALKIAPDLDDDQVRNIGDALVRHKIDGVIA 264  

                   sngigggtgltplelagvhgglsglplapaslevlaelreavggripvia
                   +n++++++++ +l++a++ gglsg+p+++as++v+++lre++g+ +p+i+
  ABF08099.1   265 TNTTISRDAVKGLPHAEEAGGLSGRPVFEASTRVVRALREVIGDALPIIG 314  

                   dGGirsgedaakalalGAdaVmigrallyagpdlvrkilegllnlldlralalrrllrpllfyldgetahrltlaflrigllprvlv..
                               al+ llrp+lf +d+e ah++tl  l  + ++     +
  ABF08099.1    18    ---------ALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGci 55   

                   .vsdvdlstellglklknPfglapmgdknlelaralaalgaglvvtgtvt
                     s  d + +++g++++nP+gla+++dk++++++ laa+g+g++++gtvt
  ABF08099.1    56 gNSIADDPRTVMGVRFPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVT 105  

                   pvpqegnpkprlfrlpedealinlyglnnegldallerlkalkallllll
                   p++q+gnp+pr+frlp+++alin++g+nn g+da++++++a ++ +    
  ABF08099.1   106 PRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAFIRNVQASRWKA---- 151  

                   leaggplivqiggsglfgsrp..edlaeaaellepladaielnlscPakp
                     +gg+l+++ig++++++ + +++d+++++e+++p+a ++++n+s+P+++
  ABF08099.1   152 --EGGVLGLNIGKNADTPIERaaDDYLYCLERVYPHASYVTVNISSPNTK 199  

                   glggllgaalledfiaaarraveagadiielgiasgylldgfliplanlr
                    l++l+ga  l+ +                                    
  ABF08099.1   200 NLRQLQGASELDSL------------------------------------ 213  

                   aleyGndpelllelikalreavg..vPlvivKirpglsvedieeiakale
                          ++ l++  ++l ++++ +vP v +Ki+p+l+++++++i +al+
  ABF08099.1   214 -------LSTLKAAQQRLADQHKryVP-VALKIAPDLDDDQVRNIGDALV 255  

                   eaGadgiivsnttagghgrtslegv..tgglsglpllpasleliaalrea
                   ++ +dg+i++ntt+++  +  l  ++++gglsg+p+++as+++++alre+
  ABF08099.1   256 RHKIDGVIATNTTISRDAVKGLPHAeeAGGLSGRPVFEASTRVVRALREV 305  

                   lggripviavGGIrtgedaakalaaGAdgVmvgrallyagpelvleilee
                   +g+ +p+i+vGGI++g+da++++ aGA +V+v+++l+y gp lv+e++  
  ABF08099.1   306 IGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVRECASA 355  

                   lkallallgvssleelvgsdHlyklllrpllflldpelahrlnlaalklllllp...lldvddpdlst
                       +++llrp lf +d+e ah+++l+ l ++ ++  +  +  + +d + 
  ABF08099.1    18    ALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGlagCIGNSIADDPR 64   

                   ellGlklknPiglAagpdknaealdalldlgfGavelgtvtpdpqagnpt
                   +++G++++nP+glAag+dk+++++d+l+++gfG++e+gtvtp++q+gnp+
  ABF08099.1    65 TVMGVRFPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPR 114  

                   prlarlaedagginrlglnnlgldavleelrelrkelvrelapdiplivn
                   pr++rl++++++inr+g+nn g+da+++++++ r +     a +++l++n
  ABF08099.1   115 PRMFRLPQADALINRMGFNNGGVDAFIRNVQASRWK-----AEGGVLGLN 159  

                   lggnklt..edavedyvelarrleegadalelnvssPntpglrelqlgla
                   +g+n +t +e+a++dy+++++r++++a+++++n+ssPnt++lr+lq+  +
  ABF08099.1   160 IGKNADTpiERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASE 209  

                   lgllpelllevveavkkavg..lpvivKlapdlteediaeiaraaeeaga
                   l+ l++ l++++++++++++ ++pv++K+apdl+++++++i +a++++++
  ABF08099.1   210 LDSLLSTLKAAQQRLADQHKryVPVALKIAPDLDDDQVRNIGDALVRHKI 259  

                   dgiivtNttggrlldlepllgveagglsgaalkplalrlvaevreavggd
                   dg+i+tNtt++r+ + +++++ eagglsg++++++++r+v+++re++g+ 
  ABF08099.1   260 DGVIATNTTISRDAVKGLPHAEEAGGLSGRPVFEASTRVVRALREVIGDA 309  

                   ipiigvGGIrtgedalealaaGAsaVqvgtallyegpalvkeilkeleal
                   +piigvGGI++g+da++++ aGA +Vqv+++l+y+gp lv+e ++ l++ 
  ABF08099.1   310 LPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVRECASALRR- 358  

                   lalkgfsslselvglllrlrnllafddvllvprvlpevdvsdvdlsttllgltlknPliiapm...
                                        ++ s  d + t++g++++nP+++a++ ++
  ABF08099.1    55    ------------------IGNSIADDPRTVMGVRFPNPVGLAAGldk 83   

                   ..................gggtlsapagn..palaraaaraGglgvigsg
                   + ++++  ++     +++g++t++a++gn  p+++r+ ++   ++ +g++
  ABF08099.1    84 dgayidglaafgfgfievGTVTPRAQPGNprPRMFRLPQADALINRMGFN 133  

                   glgsleelaeairrvrdlapggplgvnlggaq..daepgveeaaraaeea
                   + g++  +++  +   ++  gg+lg+n+g + ++++e++ ++++ ++e++
  ABF08099.1   134 NGGVDAFIRNVQASRWKA-EGGVLGLNIGKNAdtPIERAADDYLYCLERV 182  

                   g..adalelnvdlpql.gsreldrprlllellealreavg.........v
                     +a ++++n+++p+++ +r l+ +  l  ll+ l++a    +++++ +v
  ABF08099.1   183 YphASYVTVNISSPNTkNLRQLQGASELDSLLSTLKAAQQrladqhkryV 232  

                   pvivKlvggvltv...edaralleaGadaivvsgggggghidvetlravg
                   pv +K++++ ++ ++  +  al+++ +d+++++++++  +++ ++    +
  ABF08099.1   233 PVALKIAPDLDDDqvrNIGDALVRHKIDGVIATNTTISRDAVKGLP---H 279  

                   aattggllgvgv..ptlallaevrealg.dipviadGGirtgedaakala
                   a ++ggl+g +v ++++++++++re++g+ +p+i++GGi++g+da + + 
  ABF08099.1   280 AEEAGGLSGRPVfeASTRVVRALREVIGdALPIIGVGGIFSGADARAKID 329  

                   lGAdaVlvgrallyaleaggegvpkllealleelrlamallGarsleelr
                   +GA +V+v+++l+y       ++p l+++ +  lr               
  ABF08099.1   330 AGAQLVQVYSGLIY-------RGPTLVRECASALR--------------- 357  

                   grllllkmsrLfeplklggltlknRivmaPmtryladdgvptdlllayyaqra
                        s   +p ++ g++++n++ +a+            d   ay   +a
  ABF08099.1    56    GNSIADDPRTVMGVRFPNPVGLAAGL----------DKDGAYIDGLA 92   

                   kggagliiteatavs.............pegrgypgtlglwsdeqieglk
                   ++g+g+i ++ +++ ++  +    +   p++    +++g+ + ++ + ++
  ABF08099.1    93 AFGFGFIEVGTVTPRaqpgnprprmfrlPQADALINRMGFNNGGVDAFIR 142  

                   kl.tdavhaeggkifiqLahagrvasgllpvapsaipaplglvvpraltl
                    +++++ +aegg+++++++                               
  ABF08099.1   143 NVqASRWKAEGGVLGLNIGKNAD--------------------------- 165  

                   eeieeiiedfaeaarraleaGfdgveihgahgyLldqFlsplsnvrtdey
                     ie+  +d+  + +r +   +  v ++++          p+++  +   
  ABF08099.1   166 TPIERAADDYLYCLER-VYPHASYVTVNISS---------PNTKNLRQLQ 205  

                   Ggs.lenrprlllevveavreavgadfivgvRlspddlvgggltleeave
                   G+s+l   +  l +  +++++     ++v +++ pd       + +++  
  ABF08099.1   206 GASeLDSLLSTLKAAQQRLADQHKRYVPVALKIAPDL------DDDQVRN 249  

                   lakaleeaGadyihvs.................ggtleglvplestpvpg
                   + +al+++ +d ++ +++++  ++++   +++++g l+g       +++ 
  ABF08099.1   250 IGDALVRHKIDGVIATnttisrdavkglphaeeAGGLSG-------RPVF 292  

                   gadlelaravreav..sipviavggirtpedaeealeaggadlvavgraf
                    a ++++ra+re++ + +p+i+vggi++ +da++ ++ag a lv+v +++
  ABF08099.1   293 EASTRVVRALREVIgdALPIIGVGGIFSGADARAKIDAG-AQLVQVYSGL 341  

                   la.nPdlvaklkeglplelvfdYldggagdeltlrrnrlafddvllvPrvltvldvsevdlstll
                                                          + s  d  +++
  ABF08099.1    56    ------------------------------------GNSIADDPRTV 66   

                   lglglkiPiiiapmagv....sepalaiaaakaGglgvlgaggstpeeal
                   +g+++++P+ +a++   + ++++   a       +++v++++    ++++
  ABF08099.1    67 MGVRFPNPVGLAAGLDKdgayIDGLAAFGFGFIEVGTVTPRAQPGNPRPR 116  

                   aealvkralt................llplavklglgalpvaaavgagta
                   + +l+    +++ +  ++  +++ +  +      + g + + +  ++ + 
  ABF08099.1   117 MFRLPQADALinrmgfnnggvdafirNVQASRWKAEGGVLGLNIGKNADT 166  

                   vllraaalleagvd....................vividvapgsdpsllw
                    ++raa+ +  +++ ++ ++ ++++++   +++++ ++  a  +d  l+ 
  ABF08099.1   167 PIERAADDYLYCLErvyphasyvtvnisspntknLRQLQGASELDSLLST 216  

                   dllaikrl....kpkgpvvvkgvatved......AkkaeeaGaDaivvsg
                     +a  rl++++k ++pv +k +++++d+++ ++  +++++  D++++++
  ABF08099.1   217 LKAAQQRLadqhKRYVPVALKIAPDLDDdqvrniGDALVRHKIDGVIATN 266  

                   g..............gggghtgrlstgvllpqivavrlvaeaavgvdipv
                   +++  ++++   +++++gg+ gr++  +    ++a     +++ g+ +p+
  ABF08099.1   267 TtisrdavkglphaeEAGGLSGRPVFEASTRVVRA----LREVIGDALPI 312  

                   iadGGIrtggdvakAlalGAdaVmvGtaflatleapgeegvkqalvllke
                   i+ GGI +g+d+ + + +GA  V+v + +++                   
  ABF08099.1   313 IGVGGIFSGADARAKIDAGAQLVQVYSGLIY------------------- 343  

                   edtvsmalmggrsarvlrnslvralllveegveglvpykglladlllqll
                                                                     
  ABF08099.1     - -------------------------------------------------- -    

                   gglrssmgylGagslkelqkvatfvrvtsaglkeshpldelllllglrllyllelllpelrqylsladleelafrrlprslfdyl
                                                                     
  ABF08099.1     -    ----------------------------------------------- -    

                   dggaddeltlgrnlaafddvllrprvlvdvddvdlsttilglklknPlvl
                                                    d + t++g++++nP++l
  ABF08099.1    60 --------------------------------ADDPRTVMGVRFPNPVGL 77   

                   apmgfgglsepieaeialaraaaelgggipiilgemgnvslerlaaavsg
                   a+ g+++++++i+++ a++++++e  +g++++ ++ gn + +r+++++  
  ABF08099.1    78 AA-GLDKDGAYIDGLAAFGFGFIE--VGTVTPRAQPGN-PRPRMFRLPQA 123  

                   agglgsfglyalgdlevleellrrakaagikpigvnlgkpgeggalaaik
                   ++ ++++g+++ g +++++++ + + +a+ + +g+n+gk+ ++++++a+ 
  ABF08099.1   124 DALINRMGFNNGGVDAFIRNVQASRWKAEGGVLGLNIGKNADTPIERAA- 172  

                   vseagadaidlnlgaplvdpvvdvgsistlggdpel...........vle
                    ++++++ + + ++a +v  +v+++s++t  ++ ++ + + +    ++++
  ABF08099.1   173 -DDYLYCLERVYPHASYV--TVNISSPNTKNLRQLQgaseldsllstLKA 219  

                   dlkalreavg..vpvivKlvptved......AkaaeeaGaDaivvsga..
                     ++l ++ + +vpv +K++p+++d+++ ++  a++++ +D++++ ++++
  ABF08099.1   220 AQQRLADQHKryVPVALKIAPDLDDdqvrniGDALVRHKIDGVIATNTti 269  

                   ..............GG.tgldvgpptlealaevaealgelglrgripvia
                     ++++   +++++GG +g++v  ++++++++++e++g     + +p+i+
  ABF08099.1   270 srdavkglphaeeaGGlSGRPVFEASTRVVRALREVIG-----DALPIIG 314  

                   dGGirtgedaakalalGAdaVmvGraflgapeaggpegvknllealleel
                   +GGi++g+da + + +GA +V+v++++++     gp  v++   al++  
  ABF08099.1   315 VGGIFSGADARAKIDAGAQLVQVYSGLIY----RGPTLVRECASALRR-- 358  

                   rlimallGvrslaelrgsdlllrllllklldlsgllllllllldllllll
                                                                     
  ABF08099.1     - -------------------------------------------------- -    

                   lelmerlaelmlpkrlipyllvgldrevthrlnlkaldrvalipevtagd
                                                                     
  ABF08099.1     -    ----------------------------------------------- -    

                   pdlsttilglelknPlvlapmaggnaelaaalaagGagaievgtvtpdpq
                    d + t++g++++nP++la++ ++++++++ laa+G+g+ievgtvtp++q
  ABF08099.1    61 -DDPRTVMGVRFPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQ 109  

                   agnpvprlarlralagginrmglnnlgldalleelravrlavvkraapdv
                   +gnp+pr++rl++++++inrmg+nn g+da++++++a r      +a ++
  ABF08099.1   110 PGNPRPRMFRLPQADALINRMGFNNGGVDAFIRNVQASR-----WKAEGG 154  

                   pvgvnlggnk..paefgvddyelarraleaGadaivlnvsapnlpglrkd
                   ++g+n+g+n ++p e++ ddy ++ + +  +a ++++n+s+pn+++lr++
  ABF08099.1   155 VLGLNIGKNAdtPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQL 204  

                   qgggallpdpelvlelikalkeavg..lpvivklapgltgvdtvelakra
                   qg + l  ++  ++++ ++l+++++ ++pv +k+ap+l++++ + + +++
  ABF08099.1   205 QGASELDSLLSTLKAAQQRLADQHKryVPVALKIAPDLDDDQVRNIGDAL 254  

                   eeaGadavvvsnttggrgldgttrrvaeagglsGaplkpaslellreiae
                   +++ +d+v+++ntt++r+++   +++ eagglsG+p+++as++++r+++e
  ABF08099.1   255 VRHKIDGVIATNTTISRDAVKGLPHAEEAGGLSGRPVFEASTRVVRALRE 304  

                   avggdipviadGGIrtgedaakalaaGAdaVqvgsallyagpalveelak
                   ++g+ +p+i++GGI++g+da++ ++aGA +Vqv+s+l+y+gp lv+e a 
  ABF08099.1   305 VIGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVRECAS 354  

                   elkaameltglaslaelrgkllripkdvpllstlilglklknPiilApmadvtdaelaaalalaggggvlg
                           + +++++g++++nP++lA++ d +d+++++ la++g+g++++
  ABF08099.1    61    -----DDPRTVMGVRFPNPVGLAAGLD-KDGAYIDGLAAFGFGFIEV 101  

                   ktmtpepqagnpvprarrl..deaginrlgfndlgaaaelrrllkll...
                   +t+tp++q+gnp+pr++rl + +a+inr+gfn+ g++a++r++++ + ++
  ABF08099.1   102 GTVTPRAQPGNPRPRMFRLpqADALINRMGFNNGGVDAFIRNVQASRwka 151  

                   vksiaevpiivnlvgggirel.daedarllleagadavelnigcpntpvl
                     ++++ +i++n  ++++r+ +d++++ + ++++a++v++ni++pnt++l
  ABF08099.1   152 EGGVLGLNIGKNADTPIERAAdDYLYCLERVYPHASYVTVNISSPNTKNL 201  

                   gallakd.......pelvaivvaavkkavkvpvvvkivpgvdd..lveia
                   + l+++++ +     +++a+   a+ ++  vpv++ki+p++dd+++ +i 
  ABF08099.1   202 RQLQGASeldsllsTLKAAQQRLADQHKRYVPVALKIAPDLDDdqVRNIG 251  

                   kaleeaGadaiivtnttagghlglellkpilkvgigglsgrplrplalel
                   +al+++ +d++i+tntt+++ ++      +++ + gglsgrp++ +++++
  ABF08099.1   252 DALVRHKIDGVIATNTTISRDAV---KGLPHAEEAGGLSGRPVFEASTRV 298  

                   vpqlakav..diPviasGGIrsgedaaealaaGAdaVqvGtaflytpeal
                   v++l++++ + +P+i++GGI+sg+da++++ aGA +Vqv+++++y++++l
  ABF08099.1   299 VRALREVIgdALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTL 348  

                   aeikvklalllakdgdtsitelvGglslellDlstellglklknPiglApmgvskdaeaiaalaagglGiielgtvtl
                      D + +++g++++nP+glA++ ++kd+ +i+ laa+g+G+ie+gtvt+
  ABF08099.1    61    DDPRTVMGVRFPNPVGLAAG-LDKDGAYIDGLAAFGFGFIEVGTVTP 106  

                   apqegvtdprvrrlgag..linleglnnrglealllelakaa.gikglpl
                     q+g+++pr++rl+++++lin++g+nn g++a+++++ + + +++g++l
  ABF08099.1   107 RAQPGNPRPRMFRLPQAdaLINRMGFNNGGVDAFIRNVQASRwKAEGGVL 156  

                   gvniggs...gpeelaeaakllvrlleagadaielnigcpntgggaalll
                   g+nig+++++ +e +a+++ ++++++ ++a ++++ni++pnt+++++l+ 
  ABF08099.1   157 GLNIGKNadtPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQ- 205  

                   dpelllelikalreav.........gipvivKirpgidtaedveiakale
                   + + l  l++ l++a +  +++++  +pv +Ki+p++d+ ++ +i  al+
  ABF08099.1   206 GASELDSLLSTLKAAQqrladqhkrYVPVALKIAPDLDDDQVRNIGDALV 255  

                   eaGladaiivsnrtggtlaadigpgsllttrlvehgglsgdalpplalel
                   ++  +d++i++n+t        ++    + +  e+gglsg+++++ ++++
  ABF08099.1   256 RHK-IDGVIATNTTI------SRDAVKGLPHAEEAGGLSGRPVFEASTRV 298  

                   laevaeavgd.ipviadGGIrsgedaakalalGAdaVmiGraflyggpal
                   +++++e++gd++p+i++GGI+sg+da++++++GA +V+++++++y gp l
  ABF08099.1   299 VRALREVIGDaLPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTL 348  

                   leeikkellaamallgvkslselvgllklllLstellgltlknPlvlApmadvtdlelrraaarggaglvvtemvtae
                       + +++g++++nP++lA++ d+ d ++++ +a++g+g++++++vt++
  ABF08099.1    62    DPRTVMGVRFPNPVGLAAGLDK-DGAYIDGLAAFGFGFIEVGTVTPR 107  

                   qpqegnpkprlfrlpedevllvaevlglinrmglnnlglealleeiralk
                    +q+gnp+pr+frlp  +        +linrmg+nn g++a+++ ++a +
  ABF08099.1   108 -AQPGNPRPRMFRLPQAD--------ALINRMGFNNGGVDAFIRNVQASR 148  

                   daagdlpvivqlgvgsd......pedlaeaarraeeaGadaielnlgcPn
                    +a+++++++++g++ d+ ++ +++d++ +++r++++ a ++++n+++Pn
  ABF08099.1   149 WKAEGGVLGLNIGKNADtpieraADDYLYCLERVYPH-ASYVTVNISSPN 197  

                   tkvlrgggaallqdpellleivkavreavg.........ipvivKlrpgg
                   tk lr+     lq    l  +++++++a    +++++ ++pv +K++p++
  ABF08099.1   198 TKNLRQ-----LQGASELDSLLSTLKAAQQrladqhkryVPVALKIAPDL 242  

                   d..dtvelaraaeeaGadgiivhnrtgtqlidvearkallglglgsinet
                   d+++ +++ +a++++ +dg+i++n+t++++++          gl+++ e+
  ABF08099.1   243 DddQVRNIGDALVRHKIDGVIATNTTISRDAVK---------GLPHAEEA 283  

                   gglsgpaippaaleliaevreavp.gipvianGGIrtgedalealaaGAd
                   gglsg+++++a++++++++re++++ +p+i++GGI++g+da++ ++aGA 
  ABF08099.1   284 GGLSGRPVFEASTRVVRALREVIGdALPIIGVGGIFSGADARAKIDAGAQ 333  

                   aVmvgsallgtgpalveeileglrelleergfglLsttllglklknPlglaaglvdkdaeailalaalgfgiielgtvtl
                        + t++g++++nP+glaag +dkd+ +i+ laa+gfg+ie+gtvt+
  ABF08099.1    63    --PRTVMGVRFPNPVGLAAG-LDKDGAYIDGLAAFGFGFIEVGTVTP 106  

                   apmagvtdprlrrl..gagllnreglnndgleaalkllrralkagkpglp
                     ++g+++pr++rl +  +l+nr+g+nn g++a+++++++  +    g +
  ABF08099.1   107 RAQPGNPRPRMFRLpqADALINRMGFNNGGVDAFIRNVQAS-RWKAEGGV 155  

                   vgvnlggnr.......pedlaeaarlleeagadailelnlgcpntlggsa
                   +g+n+g n ++ ++ +++d++ ++++++++ a ++ ++n+++pnt +++ 
  ABF08099.1   156 LGLNIGKNAdtpieraADDYLYCLERVYPH-ASYV-TVNISSPNTKNLRQ 203  

                   llkdpelllelleavkeavd.........vpvivKispgvgiediediak
                   l +  + l  ll+ +k+a +  +++++ +vpv +Ki+p+++++++ +i +
  ABF08099.1   204 L-QGASELDSLLSTLKAAQQrladqhkryVPVALKIAPDLDDDQVRNIGD 252  

                   alveaGadaivvsntthggrqldiegvdlivaqgp..eagglsGnalapa
                   alv++ +d+++++ntt          +d+++   +++eagglsG+++++a
  ABF08099.1   253 ALVRHKIDGVIATNTT--------ISRDAVKGLPHaeEAGGLSGRPVFEA 294  

                   aleliaeiadavkgdipviadGGIrsgedaakalalGAdaVmiGraflyt
                   ++++++++++ +++ +p+i++GGI+sg+da +++ +GA +V+++++++y+
  ABF08099.1   295 STRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYR 344  

                   gpalveeilkelrlamallgigsleelvgslkllnllsladlealakrrlpkrkfdyldggagdevtlrenrlafddvllv
                                                                     
  ABF08099.1     -    ----------------------------------------------- -    

                   prvlpdvsdvdlsttllgiklslPliiap.....................
                                 t++g+++++P+++a+  +++ ++++  ++     ++
  ABF08099.1    64 -------------RTVMGVRFPNPVGLAAgldkdgayidglaafgfgfie 100  

                   mggvtllspdge..palaraaaraGglgvlgsgslgleeevrkakp....
                   +g+vt+ +++g+  p+++r+ ++   ++ +g+++ g+++++r++     +
  ABF08099.1   101 VGTVTPRAQPGNprPRMFRLPQADALINRMGFNNGGVDAFIRNVQAsrwk 150  

                   ..dgplivnlyaskdrgvlaelleraeeag.....adaivltvdspllgq
                   +++g+l+ n++ ++d  + +++ + +  ++ ++ +a+++ ++++sp+++ 
  ABF08099.1   151 aeGGVLGLNIGKNADTPIERAADDYLYCLErvyphASYVTVNISSPNTK- 199  

                   rardlrggfllglkvtaeilalrlvppgealispahgdpilsledlkalr
                    +r+l+g   l+ +++                         + ++ ++l+
  ABF08099.1   200 NLRQLQGASELDSLLS------------------------TLKAAQQRLA 225  

                   ealg..vpvivkgvltved......allaaeaGadaivvsgh........
                   ++++ +vpv +k++++++d+++ ++  +++++++d++++ ++++  ++++
  ABF08099.1   226 DQHKryVPVALKIAPDLDDdqvrniGDALVRHKIDGVIATNTtisrdavk 275  

                   .........ggggldvgvptlealpevaeavggdipviadGGirtggDva
                      +++++ g++g +v  ++++++++++e++g+ +p+i+ GGi +g+D+ 
  ABF08099.1   276 glphaeeagGLSGRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADAR 325  

                   kalalGAdaVmiGraflyaleapgeegvknlleallgelrlamallGars
                   + + +GA++V+++++++y     g+  v++   al++             
  ABF08099.1   326 AKIDAGAQLVQVYSGLIY----RGPTLVRECASALRR------------- 358  

                   leelrgkllvlesllnladlealarrrlpkrkfdyldggagdevtlrrnrlafddvll
                                                                     
  ABF08099.1     -    ----------------------------------------------- -    

                   vprvlpdvsdvdlsttllglklslPliiapmagvtllhpdgeaalaraaa
                                  t++g+++++P+++a++        d++ a   ++a
  ABF08099.1    65 ---------------TVMGVRFPNPVGLAAG-------LDKDGAYIDGLA 92   

                   raGglgv.lgsgslapee.....evrkaapgpfgvnlyglk...dpella
                   ++G++++++g+++++++  +   +++++ +    +n +g+++   +++++
  ABF08099.1    93 AFGFGFIeVGTVTPRAQPgnprpRMFRLPQADALINRMGFNnggVDAFIR 142  

                   ellrraeaagadaivltvglpvlgvrerdlrlgfllppaaggalladlar
                    + +   +a   ++ l++g+ +                  + + ++d+  
  ABF08099.1   143 NVQASRWKAEGGVLGLNIGKNA---------------DTPIERAADDYLY 177  

                   alalvlagadelvlvvsdgdpeg................lleliealrea
                    l+ v  +a+++++++s ++++   + + + + +    +l ++ ++l+++
  ABF08099.1   178 CLERVYPHASYVTVNISSPNTKNlrqlqgaseldsllstLKAAQQRLADQ 227  

                   tg..vpvivkgvatved......araaaeaGadaivvsg...........
                    + +vpv +k++++++d+++ ++  a++++ +d++++ ++++  ++++  
  ABF08099.1   228 HKryVPVALKIAPDLDDdqvrniGDALVRHKIDGVIATNttisrdavkgl 277  

                   ......gggggldvgvptlealpevaeavggdipviadGGIrtgedvaka
                    +++++gg++g +v  ++ +++++++e++g+ +p+i+ GGI +g+d+++ 
  ABF08099.1   278 phaeeaGGLSGRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADARAK 327  

                   lalGAdgVlvGtaflyaleapgeegvkealealleelrltmallGapsie
                   + +GA+ V+v ++++y     g+  v+e   al++               
  ABF08099.1   328 IDAGAQLVQVYSGLIY----RGPTLVRECASALRR--------------- 358  

                   elrgkllvvritiimllkriylildvdiedllelaeaaleaGadaiqlrvkdp.....s
                      +++ +++ ++ l +++++  ++++ +++ G+ +i++++ +p ++  +
  ABF08099.1    66    VMGVRFPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPraqpgN 112  

                   pegllelaeaikelakkv.....dvplivndg..velaleagadgvhlgg
                   p++++  ++   +l++++  ++ +v  ++ + ++ ++ +e g+ g+ +g 
  ABF08099.1   113 PRPRMFRLPQADALINRMgfnngGVDAFIRNVqaSRWKAEGGVLGLNIGK 162  

                   ..........pdllleaarelglgvivgvsvhtleealeaeelgadyi..
                   ++++ ++ +++d l+ + r +++  +v v+++++      +  ga+ ++ 
  ABF08099.1   163 nadtpieraaDDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASELds 212  

                   ..................................................
                      + +++++  +++++ ++ ++ +++ + +++++ ++ ++ + ++++ +
  ABF08099.1   213 llstlkaaqqrladqhkryvpvalkiapdldddqvrnigdalvrhkidgv 262  

                   ..............llgpvfptgtkpgf.gplglellrelveav..kipv
                   +++++++  ++++ l +  +++g  + ++  ++  ++r+l+e++ + +p+
  ABF08099.1   263 iatnttisrdavkgLPHAEEAGGLSGRPvFEASTRVVRALREVIgdALPI 312  

                   iasGGi.tpenaaealeaGadgvavgsailgap..dpaeaakalleavke
                   i +GGi ++++a++ ++aGa  v+v s++++ + + ++e a al++    
  ABF08099.1   313 IGVGGIfSGADARAKIDAGAQLVQVYSGLIYRGptLVRECASALRRXX-- 360  

                   yrgnrlvlAPMvgvtdlpfrlllarlgaglvytemvtakdllrgglkrl.
                      n++ lA   +  d ++   la +g+g++  + vt +++  +++ r+ 
  ABF08099.1    73    NPVGLAAGLDK-DGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMf 118  

                   .llavdeegrplvvqlagsd..............................
                    l   d+   +++++ +g d+ + ++++   +++  +   ++ +++++ +
  ABF08099.1   119 rLPQADALINRMGFNNGGVDafirnvqasrwkaeggvlglnigknadtpi 168  

                   ...pedlaeaaklaeegadgidlnfgcpvskvrrdgyGaallkdpelvle
                   + +++d++ + +++ ++a ++ +n+ +p++k +r+  Ga+ l+    +l 
  ABF08099.1   169 eraADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASELDS---LLS 215  

                   ivkavreavp......ipvtvkirlgwdledtvelakaleeaGadaltvh
                   ++ka+ + + ++++ ++pv +ki   +d+++  ++ +al+++ +d+++  
  ABF08099.1   216 TLKAAQQRLAdqhkryVPVALKIAPDLDDDQVRNIGDALVRHKIDGVIAT 265  

                   g.................rtrsqrytgpadleaikevke....sipvian
                   ++++  ++++   +++++++ s+r++  a  +++++++e++ + +p+i+ 
  ABF08099.1   266 NttisrdavkglphaeeaGGLSGRPVFEASTRVVRALREvigdALPIIGV 315  

                   GgirtpedaakaleatGadgVmigraal.gnpelfgeikeglggegivvi
                   Ggi++ +da++ ++a Ga  V++ +++++++p l++e + +l        
  ABF08099.1   316 GGIFSGADARAKIDA-GAQLVQVYSGLIyRGPTLVRECASAL-------- 356  

                   gakevlellleylellleyggellgvlrllkhllrllkglpgagelrltl
                                                                     
  ABF08099.1     - -------------------------------------------------- -    

                   ndadgllegldlleelleevdmlakriipaldlkdgrvvrlivglnggdpedpveaakaae...eaGa
                                +l +  ++++++g+n+g ++ ++++++a + ++e G+
  ABF08099.1   119    ----------RLPQADALINRMGFNNGGVDAFIRNVQASRwkaEGGV 155  

                   daielndldpallgp..ealleviraireavgipvivgggirspedaral
                    ++++   + ++++p+++a+++++ ++ ++++++ +v+++i+sp++    
  ABF08099.1   156 LGLNI---GKNADTPieRAADDYLYCLERVYPHASYVTVNISSPNTK--- 199  

                   leaGadavivgsalledpellaellealgpevivvaidvkavgvpvtvki
                             + + l+ + +l  ll  l++ +  +a    +++++v+v++
  ABF08099.1   200 ----------NLRQLQGASELDSLLSTLKAAQQRLA---DQHKRYVPVAL 236  

                   rggldltdvdavelakaleeagadailvt..................ggl
                   ++++dl+d  +  +  al+++ +d++++t++++  ++++   +++++ggl
  ABF08099.1   237 KIAPDLDDDQVRNIGDALVRHKIDGVIATnttisrdavkglphaeeaGGL 286  

                   gggtlggadlelvaeiaeavg..iPviasGGirspedaakalaaGAdaVl
                   +g++++ a++++v++++e++g+++P+i++GGi s++da++ + aGA  V+
  ABF08099.1   287 SGRPVFEASTRVVRALREVIGdaLPIIGVGGIFSGADARAKIDAGAQLVQ 336  

                   vgsal.lggpelvreikegleeggllvrlnqgggidpedpaelaraaeea...Gadaielndgcpf..dsrlldgs.
                      + ++  +e  a+   + +e ++  a ++ +n++ p +++ r+l+g+ 
  ABF08099.1   162    KNADTPIERAADDYLYCLERvypHASYVTVNISSPNtkNLRQLQGAs 208  

                   gllpdpeiikavrkav......svpvivkgrigsdedvelalaagadgvt
                   +l + ++ +ka+ ++++++++  vpv +k+    d+d             
  ABF08099.1   209 ELDSLLSTLKAAQQRLadqhkrYVPVALKIAPDLDDD------------- 245  

                   vgtlagedpeelleaakelglpvivgardakealraarlgrealrtkgik
                                                                     
  ABF08099.1     - -------------------------------------------------- -    

                   llpdvvttveaaraaeeaGadvigvtg.................gdltgt
                             +  a+++  +d++++t++++  ++++   +++++g+l+g 
  ABF08099.1   246 ------QVRNIGDALVRHKIDGVIATNttisrdavkglphaeeaGGLSGR 289  

                   krlagaglelvrevkeavp..ipvinfaaGGIgtpedaaaalelGAdgVl
                    ++ +a+ ++vr+++e++++++p+i  + GGI +++da+a +++GA  V+
  ABF08099.1   290 -PVFEASTRVVRALREVIGdaLPII--GVGGIFSGADARAKIDAGAQLVQ 336  

                   vGsaifkapdpveaaralveaveagrlaylagriskrligeiiedfaeaAkraieaGfdgvelhgahgyLldqFlspltnvrtde
                      i++  +d+  + +r++   + +v ++++         sp t+  +  
  ABF08099.1   168    IERAADDYLYCLERVYPH-ASYVTVNIS---------SPNTKNLRQL 204  

                   yGgslenrarfllevveavreavg...fpvgvrlspldlvegglnleeav
                    G+s ++ +   l+  ++  +   + ++pv++++ p      +l+ ++++
  ABF08099.1   205 QGASELDSLLSTLKAAQQRLADQHkryVPVALKIAP------DLDDDQVR 248  

                   elakaleeagvdllhvshg..............rtsglstpaipgafldl
                    + +al+++++d +  +++++  ++++   +++  +gls++ + +a +++
  ABF08099.1   249 NIGDALVRHKIDGVIATNTtisrdavkglphaeEAGGLSGRPVFEASTRV 298  

                   aaavkkavs..ipviavggitspedaeealeeggadlvalgRallan.Pd
                   ++a+++++++++p+i+vggi+s +da++ +++g a+lv++  +l++  P 
  ABF08099.1   299 VRALREVIGdaLPIIGVGGIFSGADARAKIDAG-AQLVQVYSGLIYRgPT 347  

                   lvlkiaegleleildcitfdllllkkglivaltlgdpdkedlvelakaleeaGadaieldgsf.......
                                      +d++ ++++++ + a+++ +++s  ++++  
  ABF08099.1   173    ----------------DDYLYCLERVYPH-ASYVTVNISSpntknlr 202  

                   ...........gvtvenvlelvkavkevdvpvvlkgginpilrigvdgvl
                   + + + + +    t++     ++   +  vpv lk              +
  ABF08099.1   203 qlqgaseldslLSTLKAAQQRLADQHKRYVPVALK--------------I 238  

                   ipdlpveepeefaeaaaeagadiivlhapttgdlrlikeaggfayvvlnp
                    pdl   ++ ++ +a++++ +d +                     ++ n 
  ABF08099.1   239 APDLDDDQVRNIGDALVRHKIDGV---------------------IATNT 267  

                   gtsvagvtgarpvlglvdlvlaaavaeglsglliiyleadgtpvdlelvk
                     s  +v+g+ +  +          a+glsg +++       ++++++v+
  ABF08099.1   268 TISRDAVKGLPHAEE----------AGGLSGRPVF-------EASTRVVR 300  

                   evkkavp.dipvivgGGIsspedakelle.gAdgvvvGsa.iykgpdilk
                   ++++++++ +p+i+ GGI s++da+  +++gA  v+v s  iy+gp +++
  ABF08099.1   301 ALREVIGdALPIIGVGGIFSGADARAKIDaGAQLVQVYSGlIYRGPTLVR 350  

                   eikeladeieinishgnl.......legdlelllelikaikeavg...gvvv
                      a+++++nis++n+++  + + +  l+ ll  +ka ++ + ++++++v
  ABF08099.1   186    ASYVTVNISSPNTknlrqlqGASELDSLLSTLKAAQQRLAdqhKRYV 232  

                   kvilgtvll.deeeivelaealieaGaDgi..................kv
                   +v l+++ + d++++  +  al+++ +Dg++++++++  ++++   ++  
  ABF08099.1   233 PVALKIAPDlDDDQVRNIGDALVRHKIDGViatnttisrdavkglphaEE 282  

                   sgGfggi...gatlealrliaevvkekipiiadGGIrsgedalkalaaGA
                    gG++g+ +  a++ ++r+++ev+++ +pii++GGI sg+da+++++aGA
  ABF08099.1   283 AGGLSGRpvfEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGA 332  

                   dlvgvgsalaileellglleelggssiadeidlvincgalkag.......dpelvlelikavreavg.....gv
                      a ++ ++i+ +++k+  + + + +++ +l+ +ka+ +++ ++++  v
  ABF08099.1   186    ASYVTVNISSPNTKNLrqlqgasELDSLLSTLKAAQQRLAdqhkrYV 232  

                   pvkviletglltveeiveaaraaveaGadfiktst...............
                   pv  +++++l ++++++ +  a+v++ +d+++++++++  ++++   +++
  ABF08099.1   233 PVALKIAPDL-DDDQVRNIGDALVRHKIDGVIATNttisrdavkglphae 281  

                   ..gggsg....gatlevlaliveavggkipviaaGGirtaedalkalaaG
                   ++gg+sg  +  a+  v+++++e++g+ +p+i++GGi +++da++ ++aG
  ABF08099.1   282 eaGGLSGrpvfEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAG 331  

                   Adavgvgsalaileaallddpelveaiveavkeavpvpvtvkirggtelgdidavelakal
                      + l + + +++a+ + + + ++  v v+ ++  +l+d+ +  +  al
  ABF08099.1   208    SELDSLLSTLKAAQQRLADQHKRYVPVALKIAPDLDDDQVRNIGDAL 254  

                   eeaGadailvtgr.............trdgtlsg.....adlelirevke
                   +++ +d +++t+ ++  ++++   +++  g+lsg  + +a    +r+++e
  ABF08099.1   255 VRHKIDGVIATNTtisrdavkglphaEEAGGLSGrpvfeASTRVVRALRE 304  

                   av..kiPViasGGigtpedaaaaleelGadgvlvgsallggpeileeaka
                    + + +P+i  GGi +++da+a ++ +Ga  v+v s+l ++         
  ABF08099.1   305 VIgdALPIIGVGGIFSGADARAKID-AGAQLVQVYSGLIYR--------- 344  

                   lleeggllvrpllvdllviggktflsrlllGtgkydspellqeaiaesgaeivtvalrrvn
                                            ++++ q+ +a+   + v val+ ++
  ABF08099.1   216    ----------------------TLKAAQQRLADQHKRYVPVALKIAP 240  

                   lggdgaldllldllkeggvallpntagartaveavriavlareiglgtda
                     +d+++ ++ d l ++++                               
  ABF08099.1   241 DLDDDQVRNIGDALVRHKI------------------------------- 259  

                   vklevigddlillpdvletleaaealvkagfkvlvytgddlelakrleea
                                                         d ++     + +
  ABF08099.1   260 --------------------------------------DGVIATNTTISR 271  

                   gadavmplgeligsgig....lanpellraiaea..vkvPVivdGGIgtp
                    a   +p++e++g+  g  +  a+++++ra++e++   +P+i  GGI ++
  ABF08099.1   272 DAVKGLPHAEEAGGLSGrpvfEASTRVVRALREVigDALPIIGVGGIFSG 321  

                   sdaaaamelGadgVlvgtaiakakdpvlmaralvlAveagrlaylagris
                   +da+a +++Ga+ V+v +++++                            
  ABF08099.1   322 ADARAKIDAGAQLVQVYSGLIY---------------------------- 343  

                   krfpvgvrlspldlvggmarlgltledavelakaleeaGadylhvsdgd
                      +pv +++            +l+ +++  + +al+++ +d ++ +  +
  ABF08099.1   232    VPVALKI----------APDLDDDQVRNIGDALVRHKIDGVIATNTT 268  

                   ga.................g..geganlelieaireavg..ipviasGgi
                   ++ ++++   +++++    g  +  a + +++a+re++g+++p+i++Ggi
  ABF08099.1   269 ISrdavkglphaeeagglsGrpVFEASTRVVRALREVIGdaLPIIGVGGI 318  

                   .tpedaeealaagladlValGrall.anpdlvaklaeglpleiyvridfy
                    + +da++ ++ag a lV + ++l++++p lv++ a              
  ABF08099.1   319 fSGADARAKIDAG-AQLVQVYSGLIyRGPTLVRECAS------------- 354  

                   gglvagytdyptlvpvivKlvggvgt...vedAalaakaGaDaivvsGheGGTgaaplrs
                      vpv +K++++  +++++ +  +++++++D++++ +         + s
  ABF08099.1   232    VPVALKIAPDLDDdqvRNIGDALVRHKIDGVIATNT--------TIS 270  

                   ldg.............aglptllalaevadalvenglrdripviadGGir
                   +d ++   +++++   +g+p ++a  +v++al+e  ++d +p+i+ GGi+
  ABF08099.1   271 RDAvkglphaeeagglSGRPVFEASTRVVRALREV-IGDALPIIGVGGIF 319  

                   tgrdvakalalGAdavgiGraflvvpvivkgvatved......arraleaGadaivvsghggggl......
                      vpv +k++++++d+++ ++  +++++ +d++++ +  ++  +++   
  ABF08099.1   232    VPVALKIAPDLDDdqvrniGDALVRHKIDGVIATNTTISRDavkglp 278  

                   .......dvgiptlaalpevveav......dvpviadGGirtggdvakal
                   +++++    g+p ++a  +vv+a+ +++ + +p+i  GGi +g+d+ + +
  ABF08099.1   279 haeeaggLSGRPVFEASTRVVRALrevigdALPIIGVGGIFSGADARAKI 328  

                   alGAdaVlvGtaflyaleapgeegvknvleallgelrltmallGapslae
                    +GA+ V+v + ++y                                   
  ABF08099.1   329 DAGAQLVQVYSGLIYR---------------------------------- 344  

                   LrgkllvlrvpvivKlvagvgigt...dAaaaaeaGaDaivvsGheGGTGaaplrs
                      vpv +K++++ + + + ++  a++++++D++++ +    T      s
  ABF08099.1   232    VPVALKIAPDLDDDQvrnIGDALVRHKIDGVIATNT---T-----IS 270  

                   ldg.............aGlptilalaevadalvenglrdripviadGGir
                   +d+++   +++++   +G+p ++a  +v++al+e  ++d +p+i+ GGi+
  ABF08099.1   271 RDAvkglphaeeagglSGRPVFEASTRVVRALREV-IGDALPIIGVGGIF 319  

                   tgrdvakalalGAdavgiGraflyvatrggleltgvdlvelakaaeeaGadailvtsi.............
                      va ++  +l + ++ ++  a++++ +d++++t++++  ++++   ++
  ABF08099.1   234    VALKIAPDLDDDQVRNIGDALVRHKIDGVIATNTtisrdavkglpha 280  

                   drdgtlsgp.....dlellkevaeavs..ipviasGGigsledaaellaa
                   +  g+lsg  + +++++++++++e++++++p+i++GGi s +da++ + a
  ABF08099.1   281 EEAGGLSGRpvfeaSTRVVRALREVIGdaLPIIGVGGIFSGADARAKIDA 330  

                   GadavlvGsal.lggplllkeikelleelgievrllgpgaaalsdpelvellelakelglevlvevht......leeakralelg
                      +a +l+d +++++ +++ ++ ++ ++ ++t++  ++++ +  a+e+g
  ABF08099.1   238    IAPDLDDDQVRNIGDALVRHKIDGVIATNTtisrdaVKGLPHAEEAG 284  

                   adligvnnrdgttggvdlellkelaeavpkdipviasGGisspediaell
                         +  +   ++++ +++++l+e +++ +p+i  GGi+s +d+++ +
  ABF08099.1   285 ------GLSGRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADARAKI 328  

                   eaGadgvlvGsal.mkapdplkearegdldleeiveaakaaaeaGadfi.................ktstGfg
                      +dld++ ++ +  a++++++d+++++++++  ++++   +    G++
  ABF08099.1   240    PDLDDDQVRNIGDALVRHKIDGViatnttisrdavkglphAEEAGGL 286  

                   gg....gatlealrlilevvkdkipviaaGGIrtgeDalkalaaGadriG
                   +g  +  a+  ++r+++ev++d +p+i++GGI +g+Da++ ++aGa ++ 
  ABF08099.1   287 SGrpvfEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGAQLV- 335  

                   tssllallaglelgvvtgidrdgtlggp....dlellrevaeavd..ipviasGGigsledla
                      ++ +++g  g p+ ++    +r+++e++++++p+i  GGi+s++d++
  ABF08099.1   279    HAEEAGGLSGRPvfeaSTRVVRALREVIGdaLPIIGVGGIFSGADAR 325  

                   aalellalGadgvlvGsal.lggpeslaeakeylegGggltgrevlgvgvptltalpevadavk...grdipviadGGIrtg
                      ++ggl+gr       p ++a  +v++a+++++g+ +p+i+ GGI +g
  ABF08099.1   282    EAGGLSGR-------PVFEASTRVVRALReviGDALPIIGVGGIFSG 321  

                   gdvakalalGAdaVmiGtaflgtleapgeevykdgvltklyrgmpsrgam
                   +d+ + + +GA+ V++ + +++                            
  ABF08099.1   322 ADARAKIDAGAQLVQVYSGLIY---------------------------- 343  

                   nrlsldvylleegdadklllpeGveglvpyvggvaellellvgelrsama
                                                   +   l+++ ++ lr+   
  ABF08099.1   344 --------------------------------RGPTLVRECASALRRX-- 359  

                   llGakslkelrrkalvvritslGvtGqktgfipevlelvkevkkat..dipvivggGIstpedakeale
                      G++G    + +   + v+++++++ + +p+i  gGI + +da++ ++
  ABF08099.1   285    GLSGRP--VFEASTRVVRALREVIgdALPIIGVGGIFSGADARAKID 329  

                   aGAdgvvvGsaivkaidgalaieelleavkelvealkeligGfllggatledvllmleavggldvgvkaaGGirtledalkllaaGad
                      G+    a+ ++v+ ++e++g+  ++++  GGi +++da++ ++aGa 
  ABF08099.1   288    GRPVFEASTRVVRALREVIGD-ALPIIGVGGIFSGADARAKIDAGAQ 333  

                   .........riGtsslleilaelekgvgvpqltalpevadavreyleegglgipviadGGirdggdiakalalG
                      g+p + a  +v++a+re+    g+  p+i  GGi++g d  + + +G
  ABF08099.1   288    GRPVFEASTRVVRALREV---IGDALPIIGVGGIFSGADARAKIDAG 331  

                   AdaVmltgtvagvgppdlellrevvevgipviadGGIrtpedaakalaaGAdg
                      ++ v++++  ++++lrev++  +p+i  GGI +++da++ ++aGA  
  ABF08099.1   288    GRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGAQL 334  

                   vlvGsallg.apeppgeakellepdlellkevaeavs..ipviasGGigtpedaaklleaGadgvivGsa
                      ++ + +++++e++++++p+i  GGi + +da++ ++aGa  v v s+
  ABF08099.1   294    ASTRVVRALREVIGdaLPIIGVGGIFSGADARAKIDAGAQLVQVYSG 340  

                   .lfggplileeakalleelgkevrladlellrevaeav..diPviadGGIgtpedaakalelGAdgVlvGsa
                      a+ +++r+++e++ + +P+i  GGI +++da++ +++GA  V+v s+
  ABF08099.1   294    ASTRVVRALREVIgdALPIIGVGGIFSGADARAKIDAGAQLVQVYSG 340  

                   iagaedPgemaralklaveagrlaalaglgskdryellkalreavg..ipvviagGGistpedaaelle.gAdgvvvGsa.i
                      + ++alre++g+++p +i  GGi + +da++ +++gA  v+v s  i
  ABF08099.1   297    RVVRALREVIGdaLP-IIGVGGIFSGADARAKIDaGAQLVQVYSGlI 342  

                   fkgedplkeaieflkaellkklaeavs..ipviasGGigsledlkellelsnlletgadgvlvg
                      ++++l+e++++++p+i  GGi s  d+++ +++      ga  v+v 
  ABF08099.1   298    VVRALREVIGdaLPIIGVGGIFSGADARAKIDA------GAQLVQVY 338  

                   sal.lggpltleeakellk