hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_24074.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABF08451.1
Accession:      [none]
Description:    rmet0 ABF08451.1 GIB00349CH01 "transcriptional regulator"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0046377  PYP-like sensor domain (PAS domain)             93.2    1.4e-26   1
0040536  PYP-like sensor domain (PAS domain)             84.4      9e-25   1
0048644  PYP-like sensor domain (PAS domain)             87.0    2.6e-24   1
0050109  PYP-like sensor domain (PAS domain)             82.4    3.8e-23   1
0048248  PYP-like sensor domain (PAS domain)             83.5    5.9e-23   1
0041279  PYP-like sensor domain (PAS domain)             80.2    1.1e-22   1
0037219  PYP-like sensor domain (PAS domain)             84.1    1.7e-22   1
0046903  PYP-like sensor domain (PAS domain)             73.9      4e-22   1
0048459  PYP-like sensor domain (PAS domain)             73.8    1.2e-21   1
0046045  PYP-like sensor domain (PAS domain)             79.1    3.7e-21   1
0048715  PYP-like sensor domain (PAS domain)             77.9      8e-21   1
0048579  PYP-like sensor domain (PAS domain)             66.7    3.9e-18   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0037219    1/1       4   122 ..    14   130 .]    84.1  1.7e-22
0048248    1/1       4   118 ..     1   110 []    83.5  5.9e-23
0048459    1/1       4   119 ..    15   125 .]    73.8  1.2e-21
0040536    1/1       9   124 ..     1   114 []    84.4    9e-25
0050109    1/1       9   120 ..     1   113 []    82.4  3.8e-23
0048644    1/1      10   119 ..     1   105 []    87.0  2.6e-24
0041279    1/1      11   122 ..     1   109 []    80.2  1.1e-22
0048715    1/1      11   126 ..     1   114 []    77.9    8e-21
0046045    1/1      13   124 ..     1   110 []    79.1  3.7e-21
0046903    1/1      14   121 ..     1   104 []    73.9    4e-22
0048579    1/1      15   123 ..     1   109 []    66.7  3.9e-18
0046377    1/1      17   130 ..     1   116 []    93.2  1.4e-26

Alignments of top-scoring domains:
0037219: domain 1 of 1, from 4 to 122: score 84.1, E = 1.7e-22
                   *->seerlrallesapdgiivldldgrilyvNpaaerllGyspeellGks
                      s +  +++le++ d++i  d+dgri+ +N+aa++l+Gy p+e+lG+s
  ABF08451.1     4    STNTAAQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQS 50   

                   lldllppedrervlealrralaggeplllgvslelrlrrkdGelrwvevs
                   l  ++p++ ++++++ +++a+++g+++l g       ++kdG+ + ve++
  ABF08451.1    51 LDLIIPERLQAAHWKGFQAAIDTGKTRLSGKPTLTKAIHKDGRKLFVEMT 100  

                   aspirdeggr..gvvgvvrDITseerlralldaapdgiivlDadGrilyvNraaerllGyspeeviGrn
                      s + ++++l+++ d++i  D dGri+ +N+aa++l+Gy p+e++G++
  ABF08451.1     4    STNTAAQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQS 50   

                   lfsellppedrpafeaallralatgep......lelrlrrkdGsrrwvlv
                   l ++++p++  +a+++ +++a+ tg++    +   + +++kdG+ ++v++
  ABF08451.1    51 L-DLIIPERLQAAHWKGFQAAIDTGKTrlsgkpTLTKAIHKDGRKLFVEM 99   

                   tvsplrdedGevvgvvgviseerlralldslpdgiivlDadgrilyvNpaaeellGyspeeliGkn
                      s +  +++l++l+d++i  D+dgri+ +N+aa+el+Gy p+e++G++
  ABF08451.1     4    STNTAAQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQS 50   

                   lfellhpedlreavleallealatgepvrg....elrlrrkdGsrrwvsv
                   l   ++pe l++a+++ +++a+ tg++    + + +  ++kdG+ ++v++
  ABF08451.1    51 LDL-IIPERLQAAHWKGFQAAIDTGKTRLSgkptLTKAIHKDGRKLFVEM 99   

                   s..pirdedGevvgvvgvfrrllleaapdgilvldldtgrilyvNdaaerllGyspeellGkslldl
                       ++le++ d+++  d+d gri+ +N+aa++l+Gy p+e lG+sl  +
  ABF08451.1     9    AQILEQLADALIFADTD-GRITGWNHAAAELFGYGPDEALGQSLDLI 54   

                   lhpedreavlealeralaggevvtlllllelrlrrkdGsvrwvevsaspi
                   ++++ ++a+++ +++a+ +g+++  +    ++ ++kdG+ + ve+++ +i
  ABF08451.1    55 IPERLQAAHWKGFQAAIDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALI 104  

                   rdeggr.v..vgvvrDITeRarlralleaapdgiivldldgrilyvNpaaerllGyspeellGkpll
                          ++le++ d++i  d dgri+ +N+aa++l+Gy p+e+lG++l 
  ABF08451.1     9    ---AQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLD 52   

                   dllhpedrervlealeralaggepvllgvegelrlrrkdGevrwvevsas
                    ++++  ++++++ +++a+++g+++l g    ++ ++kdG+ + ve++ +
  ABF08451.1    53 LIIPERLQAAHWKGFQAAIDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFA 102  

                   pirdedg..vgvvgvirDallenapdgiivlDadgrilyvNpaaeellGyspeeviGknlfdlli
                      ++le+++d++i  D+dgri+ +N+aa+el+Gy p+e++G++l   +i
  ABF08451.1    10    QILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDL-II 55   

                   ppedreevlealrealagge......svelrlrrkdGslrwvevsaspir
                   p++ ++++++ +++a+ +g++    ++  +  ++kdG+ ++ve++ + i 
  ABF08451.1    56 PERLQAAHWKGFQAAIDTGKtrlsgkPTLTKAIHKDGRKLFVEMTFALIS 105  

                   dedGevvgvvgvlrlleaapdgiwitdldgrilyvNpaferllGyspeellgknlrelvhp
                      +le++ d+++  d+dgri+ +N+a+++l+Gy p+e lg++l +++++
  ABF08451.1    11    ILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPE 57   

                   edrervlealrralagg.epfsg...elrlrrkdGslrwvllsispirde
                   + ++++++ +++a+ +g+++ sg+ +  + ++kdG+   v+++ + i d+
  ABF08451.1    58 RLQAAHWKGFQAAIDTGkTRLSGkptLTKAIHKDGRKLFVEMTFALISDA 107  

                   dGevvgvvgiarDITllleaapdgifvldldgrilyvnpaflellGyspeellgkslldlihp
                      +le++ d+++  d dgri+ +n+a++el+Gy p+e lg+sl  +i++
  ABF08451.1    11    ILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPE 57   

                   edrervlealeealaggep....fsgeyrlrrkdGsyrwvevsaspirde
                     ++++++ +++a+++g++         + ++kdG+ + ve+++ +i d+
  ABF08451.1    58 RLQAAHWKGFQAAIDTGKTrlsgKPTLTKAIHKDGRKLFVEMTFALISDA 107  

                   ldgkvvgvvgvarDiTerKqaeaapdgivitdldgrilyvNpaferllGysreellgkslllldllhp
                      e++ d+++  d dgri+ +N+a+++l+Gy ++e+lg+sl    ++++
  ABF08451.1    13    EQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSL--DLIIPE 57   

                   edrervlaalrralaggepfsg....elrlrrkdGslfwvllsvspirde
                     ++++++ +++a+ +g+++   + +  + ++kdG+ + v+++ + i d+
  ABF08451.1    58 RLQAAHWKGFQAAIDTGKTRLSgkptLTKAIHKDGRKLFVEMTFALISDA 107  

                   dGevvgvvgvvrDiTeRnapdgiiitdldgrilyvNdaflellGysreellgknlrdlvhpedr
                      +  d++i  d dgri+ +N+a++el+Gy ++e+lg++l +++++   
  ABF08451.1    14    QLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQ 60   

                   eavlaalwealrgg.epwsg...elrlrrkdGelrwvelsispirdedGe
                   +a+++ +++a+ +g++  sg+ +  + ++kdG+   ve++ + i d++G+
  ABF08451.1    61 AAHWKGFQAAIDTGkTRLSGkptLTKAIHKDGRKLFVEMTFALISDANGN 110  

                   vvgfvgvarDIlddfifvldadGriiyvneaalrallGyspeeliGksiydfvhpedr
                      l d+++  d+dGri+ +n+aa++ l+Gy p+e +G+s+  +++++ +
  ABF08451.1    15    LADALIFADTDGRITGWNHAAAE-LFGYGPDEALGQSLDLIIPERLQ 60   

                   eesalrealeevlakgev....rsfeyrflrkdGsyvwletsatpildpd
                   +  a ++ +++++ +g++         + ++kdG+ + +e +  +i d++
  ABF08451.1    61 A--AHWKGFQAAIDTGKTrlsgKPTLTKAIHKDGRKLFVEMTFALISDAN 108  

                   tgklegvvgiarditeDgiivldldgrilyvNpaaerllGysaeellgknlldlippedrerl
                      D++i+ d+dgri+ +N+aa++l+Gy ++e+lg++l  +ip++ ++++
  ABF08451.1    17    DALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAH 63   

                   laalrralaggeplllgvelelrlrrkdGslfwvelsisplrdegge..g
                   ++ +++a+++g+++l g    + +++kdG+ + ve++ +++ d++g+++g
  ABF08451.1    64 WKGFQAAIDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNviG 113  

                   vvgvlrDiTerkraeeeLrel