hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_24088.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABF09882.1
Accession:      [none]
Description:    rmet0 ABF09882.1 GIB00349CH01 "TniB"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0050374  P-loop containing nucleoside triphosphate hy    52.4    2.8e-15   1
0040237  P-loop containing nucleoside triphosphate hy    47.9      1e-13   1
0039472  P-loop containing nucleoside triphosphate hy    37.1    2.2e-11   1
0052155  P-loop containing nucleoside triphosphate hy    39.6    2.8e-11   1
0047420  P-loop containing nucleoside triphosphate hy    36.3    7.3e-11   1
0049491  P-loop containing nucleoside triphosphate hy    37.7    8.6e-11   1
0043790  P-loop containing nucleoside triphosphate hy    32.4    3.3e-09   1
0049053  P-loop containing nucleoside triphosphate hy    30.0    3.9e-09   1
0039270  P-loop containing nucleoside triphosphate hy    31.4    9.8e-09   1
0036729  P-loop containing nucleoside triphosphate hy    28.7    3.3e-08   1
0043792  P-loop containing nucleoside triphosphate hy    29.0    5.9e-08   1
0043794  P-loop containing nucleoside triphosphate hy    29.0    7.8e-08   1
0042094  P-loop containing nucleoside triphosphate hy    28.5    1.1e-07   1
0038674  P-loop containing nucleoside triphosphate hy    28.0    2.2e-07   1
0036850  P-loop containing nucleoside triphosphate hy    27.6    3.1e-07   1
0047394  P-loop containing nucleoside triphosphate hy    26.6    4.5e-07   1
0047665  P-loop containing nucleoside triphosphate hy    20.5    1.8e-06   1
0041830  P-loop containing nucleoside triphosphate hy    22.7    3.5e-06   1
0043798  P-loop containing nucleoside triphosphate hy    22.7    6.3e-06   1
0037926  P-loop containing nucleoside triphosphate hy    23.3    6.8e-06   1
0046258  P-loop containing nucleoside triphosphate hy    16.7    6.8e-06   1
0047073  P-loop containing nucleoside triphosphate hy    19.6    7.6e-06   1
0040678  P-loop containing nucleoside triphosphate hy    22.0    9.6e-06   1
0051289  P-loop containing nucleoside triphosphate hy    19.5    3.8e-05   1
0037996  P-loop containing nucleoside triphosphate hy    19.4      4e-05   1
0040419  P-loop containing nucleoside triphosphate hy    19.6    4.6e-05   1
0052726  P-loop containing nucleoside triphosphate hy    19.6    5.2e-05   1
0043012  P-loop containing nucleoside triphosphate hy    16.8    0.00015   1
0048255  P-loop containing nucleoside triphosphate hy    15.6    0.00017   1
0048266  P-loop containing nucleoside triphosphate hy    13.6    0.00056   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0039472    1/1      13   217 ..     1   195 []    37.1  2.2e-11
0043012    1/1      13   279 ..     1   315 []    16.8  0.00015
0049053    1/1      13   277 ..     1   387 []    30.0  3.9e-09
0040237    1/1      16   285 ..     1   269 []    47.9    1e-13
0050374    1/1      16   285 ..     1   287 []    52.4  2.8e-15
0036850    1/1      20   298 ..     1   443 []    27.6  3.1e-07
0043792    1/1      20   282 ..     1   224 []    29.0  5.9e-08
0037926    1/1      21   226 ..     1   443 []    23.3  6.8e-06
0041830    1/1      21   272 ..     1   309 []    22.7  3.5e-06
0043790    1/1      21   285 ..     1   254 []    32.4  3.3e-09
0043794    1/1      21   282 ..     1   227 []    29.0  7.8e-08
0047665    1/1      22   283 ..     1   240 []    20.5  1.8e-06
0048266    1/1      22   182 ..     1   362 []    13.6  0.00056
0040678    1/1      23   285 ..     1   256 []    22.0  9.6e-06
0049491    1/1      23   274 ..     1   237 []    37.7  8.6e-11
0052155    1/1      23   285 ..     1   253 []    39.6  2.8e-11
0043798    1/1      24   280 ..     1   252 []    22.7  6.3e-06
0040419    1/1      25   268 ..     1   213 []    19.6  4.6e-05
0039270    1/1      26   285 ..     1   247 []    31.4  9.8e-09
0046258    1/1      26   262 ..     1   246 []    16.7  6.8e-06
0047394    1/1      26   285 ..     1   238 []    26.6  4.5e-07
0047420    1/1      26   287 ..     1   231 []    36.3  7.3e-11
0038674    1/1      27   285 ..     1   238 []    28.0  2.2e-07
0037996    1/1      28   302 ..     1   333 []    19.4    4e-05
0042094    1/1      28   285 ..     1   293 []    28.5  1.1e-07
0036729    1/1      31   285 ..     1   258 []    28.7  3.3e-08
0047073    1/1      31   190 ..     1   147 [.    19.6  7.6e-06
0052726    1/1      34   205 ..     1   283 []    19.6  5.2e-05
0048255    1/1      58   184 ..     1   167 [.    15.6  0.00017
0051289    1/1      62   215 ..     1   178 []    19.5  3.8e-05

Alignments of top-scoring domains:
0039472: domain 1 of 1, from 13 to 217: score 37.1, E = 2.2e-11
                   *->lvslleslelplleklrpvllddvvgreealeallealrr......g
                      l+  +  ++lp  e++   + d+++g  +a+eal ++   ++  +++
  ABF09882.1    13    LPAAQGLARLPADERIHRLRADRWIGYPRAVEALNRLEILytwpnkQ 59   

                   pprnvlLvGppGvGKTtlakalakelaag.....sgpilldgvpvvrldl
                   +++n+lLvGp+  GK+++++   +  +a+++++++      ++pv+++++
  ABF09882.1    60 RMPNLLLVGPTNNGKSMIVEKFRRTHPARadadqE------HIPVLVVQM 103  

                   sellsv..............sdlvgelegglrglltealalakpsvlflD
                   ++  sv+  +++  +++ +  + +  l++ ++ +l+++++ +    l++D
  ABF09882.1   104 PSEPSVirfyvallaamgapLRPRPRLPEMEQLALALLRKVG-VRMLVID 152  

                   EidrlldardsesslevlnaLlrlledgnvlviattnrpellgrleldpa
                   E++ +l   +s+ ++e+ln+L+ l +++++ ++++++r  +l   + d+ 
  ABF09882.1   153 ELHNVLAG-NSVNRREFLNLLRFLGNELRIPLVGVGTRDAYLAI-RSDDQ 200  

                   llrrfdvielgppdeeelleilkiPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkgle
                      +P  + l+  +p  e++ +   d+ +g ++a+eal ++  + +++ +
  ABF09882.1    13    LPAAQGLAR-LPADERIHRLRADRWIGYPRAVEALNRLEILYTWPNK 58   

                   lgirpggnvllvGPpGvGKTtlakalagllfp......sgvpfirinlse
                      +   n+llvGP+  GK+++++ + +  +  +++++ + p++++++++
  ABF09882.1    59 QRMP---NLLLVGPTNNGKSMIVEKFRRTHPAradadqEHIPVLVVQMPS 105  

                   ltekllvselighppgyvGede.........lgvlfeaarkappsvlllD
                    ++   v +++ ++    G+         +++ ++++++rk +   l++D
  ABF09882.1   106 EPS---VIRFYVALLAAMGAPLrprprlpemEQLALALLRKVGVRMLVID 152  

                   Eidkl.......dpdvlnaLlqlleegevtdlggrvvdlsnviviattnp
                   E++ + + + ++++++ln+L+ l +e +             + +++  ++
  ABF09882.1   153 ELHNVlagnsvnRREFLNLLRFLGNELR-------------IPLVGVGTR 189  

                   glegivellldllllgrlrelvedelrdrldpallrRfdrviefpppdee
                   +                           r d+ l +Rf + + +p +   
  ABF09882.1   190 DAYL----------------------AIRSDDQLENRF-EPMMLPVW--- 213  

                   elleilrlllkkllkrlalkgeglelsdealealaelaytyggsardllr
                   e  +  + ll  + + l l++     + + +++l  ++   +g++ +l +
  ABF09882.1   214 EANHDCCSLLASFAASLPLRRPSSIATLDMARYLLTRS---EGTIGELAH 260  

                   lleralllallelilavdledvllvrllveellrvfldrltlpaleseardltekarpvlldd.viGqeeaierl..lealerg...
                       lpa ++ ar  +++ + +l  d +iG  +a+e+l+ le+l ++ ++
  ABF09882.1    13    -LPAAQGLARLPADERIHRLRADrWIGYPRAVEALnrLEILYTWpnk 58   

                   .ppgnvLlvGppGtGKTtlaralakelargd.............vpevlv
                   ++++n+LlvGp+  GK+++++ + +  + + +++++++ + ++++p    
  ABF09882.1    59 qRMPNLLLVGPTNNGKSMIVEKFRRTHPARAdadqehipvlvvqMPSEPS 108  

                   gvpvieinassllfGskyvgefeealrrlfgeaekanggviLflDEidkl
                     +++   +++  ++ + +  + e  + ++ +++k + ++ L++DE++ +
  ABF09882.1   109 VIRFYVALLAAMGAPLRPRPRLPEMEQLALALLRKVGVRM-LVIDELHNV 157  

                   agarg.sggspdvqnaLlrllergnvrvIaatnrpellkfeldpallrRf
                   +   +++   ++++n+L+ l +  ++ +++ ++r+ +l ++ d+ l +Rf
  ABF09882.1   158 LAGNSvN--RREFLNLLRFLGNELRIPLVGVGTRDAYLAIRSDDQLENRF 205  

                   lvielppp.dleerleilklllkklelgegve.lsdealealaelsdgni
                   +   lp ++   +  ++l  ++  l+l++  ++ + +  ++l+ +s+g i
  ABF09882.1   206 EPMMLPVWeANHDCCSLLASFAASLPLRRPSSiATLDMARYLLTRSEGTI 255  

                   garplprdlinlldeaaalallegiskvtlldildrkllqleiekellkk
                         ++l +ll  aa+ a+ +g++ +                      
  ABF09882.1   256 ------GELAHLLMAAAIVAVESGEEAI---------------------- 277  

                   eldlallerlalllkelaeleeelaeleerweaekelleeilelkeelee
                                                                     
  ABF09882.1     - -------------------------------------------------- -    

                   lkleleeaeregdlekaaelkygrllelekeleeleeelrelrllkeevs
                                                                     
  ABF09882.1     - -------------------------------------------------- -    

                   eeeiasllskltgvlektgipltkllrpvllddviGqeealeallealrr......rpgr
                       +  +++p  +++ + + d++iG  +a+eal ++  +++  ++++  
  ABF09882.1    16    AQGLARLPADERIHRLRADRWIGYPRAVEALNRLEILytwpnkQRMP 62   

                   nvllvGppGvGKTtlaralagllvrssgpilldgvpfvrldaselle...
                   n+llvGp+  GK+++++   +  + +       + p++ +++++ ++++ 
  ABF09882.1    63 NLLLVGPTNNGKSMIVEKFRRTHPARADADQE-HIPVLVVQMPSEPSvir 111  

                   ...........fgkyvgafegglrqllglaraakpgvlflDEidsllgar
                    +++  +++ ++ + +  + ++ +  l+l+r+ +   l++DE++++l  +
  ABF09882.1   112 fyvallaamgaPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAGN 161  

                   g.gsgvdpevqnaLlrlleegnvrviaatnrpelvklgeldpallrRfdv
                   +++   ++e++n+L+ l +e+++ ++++++r+ +++  + d+ l +Rf+ 
  ABF09882.1   162 SvN---RREFLNLLRFLGNELRIPLVGVGTRDAYLAI-RSDDQLENRFEP 207  

                   ielplp.dleerleilklllekllkrlglelsdea.lealaelsyglpga
                   + lp+++  ++  ++l  ++  l  r + +++   ++++l+ +s+g    
  ABF09882.1   208 MMLPVWeANHDCCSLLASFAASLPLRRPSSIATLDmARYLLTRSEGT--- 254  

                   rplvrelenlleralalallrlllkggevitledleealekvlpsfifldlrplallplp...drlvgrdeeiealskalgg..aldgvsls
                        +l ++p ++      +dr +g  +++eal ++   ++  +     
  ABF09882.1    16    AQGLARLPADERIHRlraDRWIGYPRAVEALNRLEILytWPNK---- 58   

                   iepggivllvGppGvGKTtLakllagllkpkfgeillfgkvvyvnvsell
                    ++  ++llvGp+  GK+ ++ ++ +  +++++     ++v+ v +++ +
  ABF09882.1    59 -QRMPNLLLVGPTNNGKSMIVEKFRRTHPARADADQEHIPVLVVQMPSEP 107  

                   dlkellrlllealglpppyq.lsggerlrvalaeallalgkpdllilDEi
                   ++++++ +ll+a+g+p   +   +++++   la all++ +  +l++DE 
  ABF09882.1   108 SVIRFYVALLAAMGAPLRPRpRLPEMEQ---LALALLRKVGVRMLVIDEL 154  

                   tnlldpetl.spdvlelLlrlleegkltdkllgltlilt.thdldllerl
                   +n+l  ++++++++l+lL+ l +e++       + l+++ t+d +l+ r 
  ABF09882.1   155 HNVLAGNSVnRREFLNLLRFLGNELR-------IPLVGVgTRDAYLAIRS 197  

                   adrllsrfngkgivielpplse.eelleilkkrlfeagvel...vfddea
                   +d+l +rf    ++++lp   +++++ ++l   +  + ++    + + ++
  ABF09882.1   198 DDQLENRF----EPMMLPVWEAnHDCCSLLASFAASLPLRRpssIATLDM 243  

                   lellaelsarivkkcgglrlaldllrralelaelegwekileelvreale
                   +++l  +s       g    +  ll  a+  a   g e i ++ +++a  
  ABF09882.1   244 ARYLLTRSE------GTIGELAHLLMAAAIVAVESGEEAINHRTLSMA-- 285  

                   elkerllllelrnvllddviGqeeakealsealelplkrpelfdglgve
                         +  +++     d+ iG  +a+eal++   l+    +        
  ABF09882.1    20    ARLPADERIHRLRADRWIGYPRAVEALNRLEILYTWPNKQ------- 59   

                   lpgknvlLvGppGvGKTtlaralakll.........gapfiridgselte
                    +  n+lLvGp+  GK+++++   +   + ++++++  p++ +++++  +
  ABF09882.1    60 -RMPNLLLVGPTNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSEPS 108  

                   kdyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvseliga
                              +r                             +v+     
  ABF09882.1   109 V----------IR----------------------------FYVA----- 115  

                   ppgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasv
                                                                    +
  ABF09882.1   116 -------------------------------------------------L 116  

                   iallgggrelrdgellkalkeaeaeellellglkdlllrkpsqlSgGqkq
                   +a++g  +++r+++                                 + +
  ABF09882.1   117 LAAMGAPLRPRPRLP--------------------------------EME 134  

                   RvalaralladpgvlflDEidklldargssggdesrervlnaLlellegg
                    +ala +++     l++DE+++ l       +++ r+++ln+L+ l  ++
  ABF09882.1   135 QLALALLRKVGVRMLVIDELHNVLAG-----NSVNRREFLNLLRFLGNEL 179  

                   evlsnvtviaatnrlliaigafeflkadeldpaLlrRfdlvievplp.de
                       ++ ++++ +r+        +l   + d+ L +Rf + + +p  +  
  ABF09882.1   180 ----RIPLVGVGTRD-------AYLAI-RSDDQLENRF-EPMMLPVWeAN 216  

                   eerleilklllkklel...qlvdlselakltlglsdaaldllaeaaarlr
                    +   +l   +++l+l   + ++ +++a+  l+ s+  + +la +     
  ABF09882.1   217 HDCCSLLASFAASLPLrrpSSIATLDMARYLLTRSEGTIGELAHLL---- 262  

                   lydeeggaRellrllerllllaladriavleggkviteedveealekllp
                                         +a +i+++e g++          ++ +p
  ABF09882.1   263 ----------------------MAAAIVAVESGEEAINHRTLSMADYTGP 290  

                   srdleeleflglllveklrpkllddvvgqeealerlllalk......agklphlll
                        l+  e++   + d+++g  +a+e+l+++   ++  ++ ++p+lll
  ABF09882.1    20    ARLPADERIHRLRADRWIGYPRAVEALNRLEIlytwpnKQRMPNLLL 66   

                   vGppGvGKTtlaralarlllgs....gggvdvieldasdlrgvddlreli
                   vGp+  GK+++++++ r  +++++++ ++++v+++ +++  +v ++   +
  ABF09882.1    67 VGPTNNGKSMIVEKFRRTHPARadadQEHIPVLVVQMPSEPSVIRFYVAL 116  

                   gevlqalglllgg...............kpdvlllDEidrl...dpdaqn
                    ++++a+  +  +  ++++ + +   +++ + l++DE++++ + +   + 
  ABF09882.1   117 LAAMGAPLRPRPRlpemeqlalallrkvGVRMLVIDELHNVlagNSVNRR 166  

                   allklleel..pagvtlilttnrle....ellpallsrfdiiefkpl.se
                   ++l+ll+ l +  ++ l+++ +r  + +++ ++ l +rf  + +++++  
  ABF09882.1   167 EFLNLLRFLgnELRIPLVGVGTRDAylaiRSDDQLENRFEPMMLPVWeAN 216  

                   eelleilkrileeegvklsd.....ealealaelsggdpraalnlleraa
                   ++ + +l  +++ ++++ +  +++ + +++l+ +s+g++  +  ll +aa
  ABF09882.1   217 HDCCSLLASFAASLPLRRPSsiatlDMARYLLTRSEGTIGELAHLLMAAA 266  

                   a.....grelitledvkellgedrllleelrpvllddviGqeeakealsealrlplkrlelferlglrr
                        +  e++     d+ iG+ +a+eal++   l+    +         
  ABF09882.1    21    RLPADERIHRLRADRWIGYPRAVEALNRLEILYTWPNKQ-------- 59   

                   pgknvlLvGppGvGKTtlaralAkll.........gapfvevdaselteg
                   +  n+lLvGp+  GK+++++   +   + ++++++  p++ v++++  ++
  ABF09882.1    60 RMPNLLLVGPTNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSEPSV 109  

                   gyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrligap
                                                                     
  ABF09882.1     - -------------------------------------------------- -    

                   pgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllg
                                                    +++ v ll a+ ++l  
  ABF09882.1   110 ---------------------------------IRFYVALLAAMGAPLRP 126  

                   glglpevgelllellddvgltdllgrtvdfkntiiiltsnvgelsggqrq
                    + lpe+ +l+l ll++                                 
  ABF09882.1   127 RPRLPEMEQLALALLRK--------------------------------- 143  

                   rvalarallaepgilflDEiDklagkrggggtnrldeevlnaLlelleel
                                 l++DE++ ++   + ++     +e ln L+ l +el
  ABF09882.1   144 ---------VGVRMLVIDELHNVLAGNSVNR-----REFLNLLRFLGNEL 179  

                   qvtgeyitvksdvtviaatnrpeeldpallrpalldRfdlvielplpdee
                              ++ ++++ +r+ +   +  ++ l +Rf + + lp     
  ABF09882.1   180 -----------RIPLVGVGTRDAY-LAIRSDDQLENRF-EPMMLP----- 211  

                   erleilklllekllkqyikllgeegvglelsdealealaeltegysgadr
                                               e   + + +la +         
  ABF09882.1   212 --------------------------VWEANHDCCSLLASF--------- 226  

                   eggaRellrllerllrdaaldaldeaggrvvitledleealgkvlpsldk
                                                                     
  ABF09882.1     - -------------------------------------------------- -    

                   sliehdrplleklrpvllddviGqeeakkallealalplkrlelfeklrgir
                        p  e++ + + d++iG+  a++al ++  l + ++++       +
  ABF09882.1    21    RLPADERIHRLRADRWIGYPRAVEALNRLEIL-YTWPNK-------Q 59   

                   pgknvlLvGppGtGKTtlaralakll.........grpfirvdaseltea
                   + +n+lLvGp+  GK+++++   +   + +++++++ p++ v++++ +++
  ABF09882.1    60 RMPNLLLVGPTNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSEPSV 109  

                   elvGy...........esgarlrelfaragigllaladpgvlflDEidkl
                    ++ y++  +++ +  +   rl e+ + a ++l ++     l++DE++ +
  ABF09882.1   110 -IRFYvallaamgaplRPRPRLPEMEQLALALL-RKVGVRMLVIDELHNV 157  

                   lpargssggdvsredvlnaLlrlleegeltilgggvdlpnvlviaatnpd
                   l      g++v r++ ln+L  l  e +            + +++ +++d
  ABF09882.1   158 LA-----GNSVNRREFLNLLRFLGNELR------------IPLVGVGTRD 190  

                   lyrpdeldpallrRfdlvielplpdleerleilklllerllkrlaallgl
                    y+  + d+ l +Rf + + lp  + +     l   +       aa l l
  ABF09882.1   191 AYLAIRSDDQLENRF-EPMMLPVWEANHDCCSLLASF-------AASLPL 232  

                   kklglklsdealealaelavrlrgyteggsardllnlleraaalallell
                   ++     + + +++l+ ++        +g++ +l +ll  aa+ a+ +  
  ABF09882.1   233 RRPSSIATLDMARYLLTRS--------EGTIGELAHLLMAAAIVAVES-- 272  

                   llgdgrvvitledleealelilpsldksglelslllvekyrpvllddvvgqeeakeallealalararplkrpelflsl
                       l+  e+++  + d+++g + a+eal ++  l+              
  ABF09882.1    21    RLPADERIHRLRADRWIGYPRAVEALNRLEILYTWP----------- 56   

                   girpgrillLyGppGvGKTtlakalakel.........gapvieidasel
                   ++++ ++llL+Gp+  GK+++++ + +   + +++++++ pv+ + +++ 
  ABF09882.1    57 NKQRMPNLLLVGPTNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSE 106  

                   rd...........vddlsgyvgelsggeklrellaealteavlkgkpsvl
                    +++  +++  ++     + +  l+++   + +la +     +k     l
  ABF09882.1   107 PSvirfyvallaaMGAPLRPRPRLPEM--EQLALALL-----RKVGVRML 149  

                   llDEidal...dpdvlnallklldglrdlsgvliilttndpe....eldp
                   ++DE++++ + +   ++++l+ll+ l  + ++++++++++  + +++ d+
  ABF09882.1   150 VIDELHNVlagNSVNRREFLNLLRFLGNELRIPLVGVGTRDAylaiRSDD 199  

                   allrRfdiiefppp.deeelleilkrilekeglkldd.....ealealae
                    l +Rf+ + +p  +   +++++l  ++  ++l+ +  +++ + +++l+ 
  ABF09882.1   200 QLENRFEPMMLPVWeANHDCCSLLASFAASLPLRRPSsiatlDMARYLLT 249  

                   lsegsprdllnlleraal.....grkvitledveealgkvlpsidlrplveklrpknlddvygqeevlkalslale......kgrpehlllv
                        p  e+++    d+++g  ++++al++    ++  +k r+++lllv
  ABF09882.1    21    RLPADERIHRLRADRWIGYPRAVEALNRLEIlytwpnKQRMPNLLLV 67   

                   GppGtGKTtlakalaglllptsg....gvrvlgidaselld.........
                   Gp+  GK++++  + +  + +  ++++ ++vl +++++ ++++  +++  
  ABF09882.1    68 GPTNNGKSMIVEKFRRTHPARADadqeHIPVLVVQMPSEPSvirfyvall 117  

                   .......pselsggerqrvliaralladpkvlllDEidal...dpeaqna
                   +++ +      +  e   +++a  ++ + + l++DE++++ + +   +++
  ABF09882.1   118 aamgaplRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVlagNSVNRRE 167  

                   Llklleel.pk.gvtvilttnrlee....ldpallsRfdviefppp.dee
                   +l+ll+ l ++ ++ ++++ +r  + ++  d+ l +Rf  +++p ++   
  ABF09882.1   168 FLNLLRFLgNElRIPLVGVGTRDAYlairSDDQLENRFEPMMLPVWeANH 217  

                   elleilklilkkeglk.....lddealellaelsggsprdalnlldraav
                   +  ++l  +++ ++l+    + + + +++l+ +s+g++ +++ ll  aa+
  ABF09882.1   218 DCCSLLASFAASLPLRrpssiATLDMARYLLTRSEGTIGELAHLLMAAAI 267  

                   laagriveegtpedllealekyeplveklrpvllddlvgqeeakealleala......ggrpprpvll
                        p  e++   + d+ +g ++a+eal ++   ++  ++ r+p+ +ll
  ABF09882.1    22    -LPADERIHRLRADRWIGYPRAVEALNRLEIlytwpnKQRMPN-LLL 66   

                   vGppGtGKTtlaralanelgrpfvpvallcfvrvncaallelsasdll..
                   vGp+  GK+++++ + +  +++   ++    v v    + + s ++++  
  ABF09882.1    67 VGPTNNGKSMIVEKFRRTHPARADADQEHIPVLV----VQMPSEPSVIrf 112  

                   ..........eselfgeekeaflgallerlgklalagggtvlflDEidkl
                   +++  +++ ++ ++  +   ++ +  l  l+k+ ++     l++DE++++
  ABF09882.1   113 yvallaamgaPLRPRPR-LPEMEQLALALLRKVGVR----MLVIDELHNV 157  

                   .......dpdvqnaLlrlleeppsnvrvilttnrpekl....dpallsRf
                    + + +++++++n L+ l +e   ++ +++ ++r   l++  d++l +Rf
  ABF09882.1   158 lagnsvnRREFLNLLRFLGNE--LRIPLVGVGTRDAYLairsDDQLENRF 205  

                   lvielppp.sleerleilkllleklglplsd.....ealealaelsggnp
                   + + lp  +   +  ++l  ++  l+l+ +  +++ + +++l+ +s+g +
  ABF09882.1   206 EPMMLPVWeANHDCCSLLASFAASLPLRRPSsiatlDMARYLLTRSEGTI 255  

                   rellnlleralllaleellteidlellgkkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiay
                                                                     
  ABF09882.1     -    ----------------------------------------------- -    

                   qyallakedenaaaflksnrqkklvrdladrviaeerlellekiieellr
                                                                     
  ABF09882.1     - -------------------------------------------------- -    

                   irldklledldeiveelppvlfddlvgqeeakeal..lenlklflkgpel
                             ++  e+++  + d+ +g+ +a+eal+ le+l+ +      
  ABF09882.1    22 ----------LPADERIHRLRADRWIGYPRAVEALnrLEILYTWPN---- 57   

                   lldlglpkgrgllLyGPpGtGKTtlakalanel.........ggpvi...
                        ++++ +llL+GP++ GK++++    +   + +++++++ pv++++
  ABF09882.1    58 -----KQRMPNLLLVGPTNNGKSMIVEKFRRTHparadadqeHIPVLvvq 102  

                   ..........................elnaseerlkdllerllg..psvl
                   +  +  ++  +++  +++ +      +l +   +++ +l+ l+++   +l
  ABF09882.1   103 mpsepsvirfyvallaamgaplrprpRLPE---MEQLALALLRKvgVRML 149  

                   vlDeidklfpdgksldskalkgvldallnlldggvpiiattnlpdldpal
                   v+De++    +g+s++ ++   +l                          
  ABF09882.1   150 VIDELHNVL-AGNSVNRREFLNLL-------------------------- 172  

                   lrpgrfdrielplpldleqrrellklllekegldldldlsellvtvglsp
                       rf   el++p                                    
  ABF09882.1   173 ----RFLGNELRIP------------------------------------ 182  

                   adlalllnlagllavrrleeeieellerlkeildkeieeylflsylgkll
                                                                     
  ABF09882.1     - -------------------------------------------------- -    

                   egldileplveklrpvllddvigqeeakeallealaglrlllkdlslgippgkn
                      p  e+++  + d+ ig ++a+eal ++      + k      ++  n
  ABF09882.1    23    PADERIHRLRADRWIGYPRAVEALNRLEILYTWPNK------QRMPN 63   

                   vllvGppGtGKTtlakalagel.........gvpfvrisase........
                   +llvGp+  GK+++++ + +   + +++++++ p++ ++++++  ++  +
  ABF09882.1    64 LLLVGPTNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSepsvirfy 113  

                   ..llg......kyvgelsgglrqrlalaraadpgvlllDEidalldarsg
                   ++ll+++ +  +++  l + ++ +lal+r+ +   l++DE++++l     
  ABF09882.1   114 vaLLAamgaplRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAG--- 160  

                   sgsggdsssrrvlnaLlrlleelrllsgvtviattn.dle...eldpall
                       +++ +r+ ln L+ l  el    +++++++++ d + +++ d+ l 
  ABF09882.1   161 ----NSVNRREFLNLLRFLGNEL----RIPLVGVGTrDAYlaiRSDDQLE 202  

                   rpgrfdrvielplp.dleerleilkllleklgle..sdealealaelt..
                   +  rf + ++lp  +  ++  ++l  ++  l+l+  s++a   +a++  +
  ABF09882.1   203 N--RF-EPMMLPVWeANHDCCSLLASFAASLPLRrpSSIATLDMARYLlt 249  

                   .egfsardlrnlleralalallegrvvitledleealekvlpsrllveklrpvllddlvgqeeakealleala......agrpghvllvGp
                      +  e++   + d+ +g ++a+eal ++   ++  +++r++++llvGp
  ABF09882.1    23    PADERIHRLRADRWIGYPRAVEALNRLEIlytwpnKQRMPNLLLVGP 69   

                   pGtGKTtlaralanellrlgvl...glpfvrvnasellealllsdlfgel
                   +  GK+++++ + +  + +   ++++ p+++v++++ ++     +++ + 
  ABF09882.1    70 TNNGKSMIVEKFRRTHPARADAdqeHIPVLVVQMPSEPSVI---RFYVA- 115  

                   lgallralfellrgalela..........kggvlflDEidrl.......s
                   l a ++a ++ +++++e+ + + +   +++   l++DE++++ + + +++
  ABF09882.1   116 LLAAMGAPLRPRPRLPEMEqlalallrkvGVRMLVIDELHNVlagnsvnR 165  

                   pdvqnaLlrlleelpsnvrviattnrpel....ldpallsRflvielppp
                   ++++n L+ l +e   ++ +++ ++r+ + ++  d+ l +Rf+ + lp +
  ABF09882.1   166 REFLNLLRFLGNE--LRIPLVGVGTRDAYlairSDDQLENRFEPMMLPVW 213  

                   .sleerleilkllleklglelsd.....ealealaelspgnprellnlle
                   +  ++  ++l  +++ l+l+ +  +++ + +++l+++s+g ++el +ll 
  ABF09882.1   214 eANHDCCSLLASFAASLPLRRPSsiatlDMARYLLTRSEGTIGELAHLLM 263  

                   raallalleglgkvitledllealdvplveklrpvllddvigqeeakeallealarlkapelflslglrpgkg
                      p  e+++  + d++ig+++a+eal ++  ++  p      ++++ ++
  ABF09882.1    23    PADERIHRLRADRWIGYPRAVEALNRLEILYTWP------NKQRMPN 63   

                   vlLvGppGtGKTtlaralagll.........gapfvrlsaselvg.....
                   +lLvGp+  GK+++++   +   + +++++++ p++ +++++  +++  +
  ABF09882.1    64 LLLVGPTNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSEPSvirfy 113  

                   ...........kyvgelegglrqllalaraanpgvlflDEidklapkrsp
                   ++  +++ +  + +  l+++ + +lal+r+     l++DE++ ++ +   
  ABF09882.1   114 vallaamgaplRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAG--- 160  

                   tsglddvsrrrvlnaLlrllegledlsnvlviaatnrpe....eldpall
                       + v rr++ln+L+ l ++l+    + ++++++r  + +++ d+ l 
  ABF09882.1   161 ----NSVNRREFLNLLRFLGNELR----IPLVGVGTRDAylaiRSDDQLE 202  

                   rpgRfdlvielplp.dleerleilkrlleklgle......sdealealae
                   +  Rf + + lp ++  ++   +l  +++ l+l+    +++ +  ++l  
  ABF09882.1   203 N--RF-EPMMLPVWeANHDCCSLLASFAASLPLRrpssiaTLDMARYLLT 249  

                   ltegfsardlrnlleralllallegrvvitledleealekvllveklrpknldkvigqeealkdlslalk......pgeiphalllvGp
                        e+++  + d  ig  +a+++l++    ++  +++++p+ lllvGp
  ABF09882.1    24    ADERIHRLRADRWIGYPRAVEALNRLEIlytwpnKQRMPN-LLLVGP 69   

                   pGsGKttlaralagllgpdsgkilldgkdi...rrgiglvfqliglfphl
                   +  GK+++++ + +   ++       + d ++++  +  ++ ++ ++   
  ABF09882.1    70 TNNGKSMIVEKFRRTHPAR------ADADQehiPVLVVQMPSEPSVIRF- 112  

                   tvlelvalglggilveevrellkellsgGqkqrvaiaralagdpkvlllD
                   +v  l a+g++  ++  + e+ +++          +a     + + l++D
  ABF09882.1   113 YVALLAAMGAPLRPRPRLPEMEQLA----------LALLRKVGVRMLVID 152  

                   Ept.al..dpdaqnaLlklleelak..gvtvilathdls....ellpall
                   E+++ l+ +   ++++l+ll+ l ++ +++++++ ++  + +++ ++ l 
  ABF09882.1   153 ELHnVLagNSVNRREFLNLLRFLGNelRIPLVGVGTRDAylaiRSDDQLE 202  

                   srcqvirfpplseee.....lleildrilvleggklvedgaleelaelsg
                   +r+  +++p+ +++++    l++++  +  ++   + + + +++l+++s+
  ABF09882.1   203 NRFEPMMLPVWEANHdccslLASFAASLPLRRPSSIATLDMARYLLTRSE 252  

                   gdprkalnlldraaalarlellslvleivellpkvtlddlvgleelkealkealell.slgikpgeivllyGppG
                       e++++++ d  +g+++++eal ++  l +  ++++  ++ll+Gp+ 
  ABF09882.1    25    DERIHRLRADRWIGYPRAVEALNRLEILYtWPNKQRMPNLLLVGPTN 71   

                   tGKTtlakalanelkkr......ggrvlyvsa..................
                    GK++++ ++ +  ++r++++++  +vl+v +  +  ++  +++  +++ 
  ABF09882.1    72 NGKSMIVEKFRRTHPARadadqeHIPVLVVQMpsepsvirfyvallaamg 121  

                   ....delvsklsgglqeqrvaiafalark..pdllllDEidal.gldpel
                   +   ++ +          +  +a+al+rk+ +  l++DE++ + +++   
  ABF09882.1   122 aplrPRPR-------LPEMEQLALALLRKvgVRMLVIDELHNVlAGNSVN 164  

                   qeellelldelaer.gvtlilttnnrpeeldqallrllsrldrvivldlp
                   ++e+l+ll+ l ++  ++l+ + ++   +  +  + l +r++  ++l+++
  ABF09882.1   165 RREFLNLLRFLGNElRIPLVGVGTRDAYLAIRSDDQLENRFE-PMMLPVW 213  

                   pdleergeilkrlaeklglp.....lsdevlellaert.gngrelinlle
                      ++   +l + a  l+l     + + +++++l++r++g++ el +ll 
  ABF09882.1   214 EANHDCCSLLASFAASLPLRrpssiATLDMARYLLTRSeGTIGELAHLLM 263  

                   raadleklrpvllddvvgqeeakeallealagarlaledlslgirpgknvlL
                      e++++ + d+ +g++ a+eal ++  ++ ++ +      ++ +n+lL
  ABF09882.1    26    ERIHRLRADRWIGYPRAVEALNRLEILYTWPNK------QRMPNLLL 66   

                   vGppGvGKTtlaralagll.........gapfgrvdasdllg........
                   vGp+  GK+++++   +   + ++++++++p++ v +++  +++  +++ 
  ABF09882.1    67 VGPTNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSEPSvirfyval 116  

                   ........kyvgelsgglrqrlarallakpsvlllDEidklapkrsptsg
                    +++ +  +++  l + ++  la +++ +   l++DE++          +
  ABF09882.1   117 laamgaplRPRPRLPEMEQLALALLRKVGVRMLVIDELH-------NVLA 159  

                   ldvelrrrvlnaLlrlleglrllsgvtviattnrpe....eldpallrpg
                   ++   rr+ ln+L+ l ++     ++ ++++ +r  + +++ d+ l +  
  ABF09882.1   160 GNSVNRREFLNLLRFLGNE----LRIPLVGVGTRDAylaiRSDDQLEN-- 203  

                   rfdriieldlp.dleerleilkllleklgleldd.....dalellaeteg
                   rf + + l+  +  ++  ++l  ++  l+l+ +  +++ d++++l+ +++
  ABF09882.1   204 RF-EPMMLPVWeANHDCCSLLASFAASLPLRRPSsiatlDMARYLLTRSE 252  

                   gsardllnlleraaalallegrevitledleealeedleslllnplvkfedivpkvlddleealealaea.klp...ppkgv
                      e++++l  + ++++   v        eal++l  ++ +p+++++ ++
  ABF09882.1    26    ERIHRLRADRWIGYPRAV--------EALNRLEILyTWPnkqRMPNL 64   

                   llyGppGtGKTtlaralakel.........glpfvrinasd.........
                   ll+Gp+  GK+++++ + +   + +++++++ p++ ++++++  ++  ++
  ABF09882.1    65 LLVGPTNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSepsvirfyv 114  

                   ......llvgllvgelegrlrglfteavlanpgvlflDEidrlplkrqag
                   +  +++  + ++   l++ +  ++   ++ +   l++DE++ +++  ++ 
  ABF09882.1   115 allaamGAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAGNSV- 163  

                   gdllrallealltlldglislp.snvrviaatnrpee....ldpasllrR
                      +r+ +  ll++l+     ++ ++ +++  +r  + ++  d+  l +R
  ABF09882.1   164 ---NRREFLNLLRFLG-----NeLRIPLVGVGTRDAYlairSDDQ-LENR 204  

                   fdviielplpldleerleilkll..........lelsdealealarltpg
                   f  ++ lp      +   +l  +++           + + +++l+ +++g
  ABF09882.1   205 FEPMM-LPVWEANHDCCSLLASFaaslplrrpsSIATLDMARYLLTRSEG 253  

                   kllyfnvrellnlleisleldpeellelllallllelllllleklrpvllddvvgqeevkkalllalalallrge.pgehvlLvGppGt
                      e++ + + d  +g  ++++al+++  l+   ++++++++lLvGp+  
  ABF09882.1    26    ERIHRLRADRWIGYPRAVEALNRLEILYTWPNKqRMPNLLLVGPTNN 72   

                   GKTtlaralagllga.........pfielsasdllg..............
                   GK+++++ + +  +a ++++++++p++ +++++  +++  +++  +++ +
  ABF09882.1    73 GKSMIVEKFRRTHPAradadqehiPVLVVQMPSEPSvirfyvallaamga 122  

                   ....esdlrggfkqa......akpgvlflDEidrl.......drevqnaL
                         +l ++++ a +   +     l++DE++ + + + +++re +n L
  ABF09882.1   123 plrpRPRLPEMEQLAlallrkVGVRMLVIDELHNVlagnsvnRREFLNLL 172  

                   lelleelqvtilggglvvvelllllpsgvlviaatnrpel....ldpall
                   + l +el+                    + ++++++r  + ++  d+ l 
  ABF09882.1   173 RFLGNELR--------------------IPLVGVGTRDAYlairSDDQLE 202  

                   sRfdlvielppp.dleerleilkrllkkegve.....lddealellaela
                   +Rf+    lp  +   +   +l  +++ ++++    + + + +++l+ ++
  ABF09882.1   203 NRFE-PMMLPVWeANHDCCSLLASFAASLPLRrpssiATLDMARYLLTRS 251  

                   ggsardllnlleraaalallegrdvitledveealglvlpsrdeelelleklslllveklrpvllddlvgqeeakeallealr......
                                     e+++  + d+ +g ++a+eal ++   ++  +
  ABF09882.1    26    ---------------ERIHRLRADRWIGYPRAVEALNRLEIlytwpn 57   

                   agrpghvllvGppGtGKTtlaralanelprs....lpglpfvrvnasdlt
                   ++r++++llvGp+  GK+++++ + +  p +++++  + p++ v++++ +
  ABF09882.1    58 KQRMPNLLLVGPTNNGKSMIVEKFRRTHPARadadQEHIPVLVVQMPSEP 107  

                   d.....vglleellgkllgaat...........fllakpgvlflDEidkl
                   +++  +v ll+++   l+ +++  ++++ + + +++ +   l++DE++ +
  ABF09882.1   108 SvirfyVALLAAMGAPLRPRPRlpemeqlalalLRKVGVRMLVIDELHNV 157  

                   .......dpdvqnaLlrlleelpsnvrviattnrpl..eldpallsRflv
                    + + +++++++n L+ l +el+ +++ ++t +  l+++ d+ l +Rf+ 
  ABF09882.1   158 lagnsvnRREFLNLLRFLGNELRIPLVGVGTRDAYLaiRSDDQLENRFEP 207  

                   ielppp.dleerleilkllleklglelsd.....ealealaelspgnpre
                   + lp ++  ++  ++l  ++  l+l+ +  +++ + +++l+ +s+g++ e
  ABF09882.1   208 MMLPVWeANHDCCSLLASFAASLPLRRPSsiatlDMARYLLTRSEGTIGE 257  

                   llnlleralllallegielidll.....elklrpvllddvvgqeeakeallealkavll.girpgehllLvGppGtG
                      +++  + d+ +g  +a+eal ++  +    ++++ ++llLvGp+  G
  ABF09882.1    27    RIHRLRADRWIGYPRAVEALNRLEILYTWpNKQRMPNLLLVGPTNNG 73   

                   KTtlaralagel.........gapfvrldaselsg...............
                   K+++++   +   + +++++++ p++ +++++  +++  +++  +++ + 
  ABF09882.1    74 KSMIVEKFRRTHparadadqeHIPVLVVQMPSEPSvirfyvallaamgap 123  

                   .......geklrgllarala.kpgvlllDEida.l..dpdvqeallelle
                          +e    +la +++++   l++DE++++l+ +   ++++l+ll+
  ABF09882.1   124 lrprprlPEMEQLALALLRKvGVRMLVIDELHNvLagNSVNRREFLNLLR 173  

                   egeltivgggllteldglllpsgvlviattnrpel....ldpallsRfdl
                                    l  + ++ ++++ +r  + ++  d+ l +Rf +
  ABF09882.1   174 F----------------LGNELRIPLVGVGTRDAYlairSDDQLENRF-E 206  

                   vielppp.deeerleilkrllkkegleldd.....ealealaelaegspr
                    + lp  +  ++ + +l  +++ ++l+ +  +++ + +++l+ ++eg++ 
  ABF09882.1   207 PMMLPVWeANHDCCSLLASFAASLPLRRPSsiatlDMARYLLTRSEGTIG 256  

                   dllnlleraaalallegrvvitledveealglvlpsryrpvdfddivGqeealralslalaag......ppegvllvGppGtGK
                      ++  + d  +G  +a++al++     +  +++++ ++llvGp+  GK
  ABF09882.1    28    IHRLRADRWIGYPRAVEALNRLEILYtwpnkqRMPNLLLVGPTNNGK 74   

                   stlaralagllppdsg.....rivlvgnlsdlldpkdlrellragiplvf
                   s+++    +  p+ + ++++++ vlv+++++  ++ ++  +l+a ++   
  ABF09882.1    75 SMIVEKFRRTHPARADadqehIPVLVVQMPSEPSVIRFYVALLAAMGAPL 124  

                   lnfaalpasllesellsggerqrvalaralalrpGllvlAdggvlllDEp
                   ++  +lp+             + +ala  ++           + l++DE+
  ABF09882.1   125 RPRPRLPE------------MEQLALALLRKVGV--------RMLVIDEL 154  

                   .dal..dpevqaaLlrlleegevtieragitlllpagvtviaatnddlg.
                   ++ l+     ++++l+ll+            l  + ++ +++++++d + 
  ABF09882.1   155 hNVLagNSVNRREFLNLLRF-----------LGNELRIPLVGVGTRDAYl 193  

                   ..eldpalldRfdlvielgplrdreerleilrhllekearrlgflepvae
                   +++ d++l +Rf   + l+ +    +   +l  +++ +            
  ABF09882.1   194 aiRSDDQLENRF-EPMMLPVWEANHDCCSLLASFAASL------------ 230  

                   slealreaillarelllgvplsdealellaelaagtr.ggsvrdlenllr
                                    +++ + ++  l ++++  tr  g++ +l +ll 
  ABF09882.1   231 -----------------PLRRPSSIATLDMARYLLTRsEGTIGELAHLLM 263  

                   ralalaalegrdvvtaedvlealrlvlpsrlrelldrllkledklireli
                   +a++ a+ +g + ++++ +  a     ++r+r++  +l+           
  ABF09882.1   264 AAAIVAVESGEEAINHRTLSMADYTGPSERRRQFERELM----------- 302  

                   evldlrpvllddvigqeeakeallealalplkrldlglslgirpgkgvlly
                      ++  + d+ ig   a+eal ++ +l+          ++++ +++ll+
  ABF09882.1    28    IHRLRADRWIGYPRAVEALNRLEILYTWP-------NKQRMPNLLLV 67   

                   GppGtGKTtlakalagel.........gapfiridgsellg.........
                   Gp+  GK+++++ + +   + +++++++ p++ +++++  +++  +++  
  ABF09882.1    68 GPTNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSEPSvirfyvall 117  

                   .......kyvgelsgglrqllalaraakpsilllDEidklapkrsptsal
                   +++ +  + +  l++  +  lal+r+ +   l++DE++ +          
  ABF09882.1   118 aamgaplRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAG------- 160  

                   dadvrrevlnaLlrlldglqalsnvtviattnrpee....ldpallrpgR
                    +  rre ln+L+ l ++l+    ++++++++r  + ++  d+ l +  R
  ABF09882.1   161 NSVNRREFLNLLRFLGNELR----IPLVGVGTRDAYlairSDDQLEN--R 204  

                   fdlviefplp.deeerleilkllleklgle..sdealealae....lteg
                   f + + +p  +  ++   +l  ++  l+l+  s +a   +a++  +++eg
  ABF09882.1   205 F-EPMMLPVWeANHDCCSLLASFAASLPLRrpSSIATLDMARylltRSEG 253  

                   fsgrdlrnlldraaalallegrevitpedllealelllvlkligselili
                    ++ +l++ll  aa+ a+ +g e i +++l +a                 
  ABF09882.1   254 -TIGELAHLLMAAAIVAVESGEEAINHRTLSMA----------------- 285  

                   tledleealeklrpsldkedlellellsallkvtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGpp
                       + d ++g  +a+eal ++  l+    +       ++ +n+ll+Gp+
  ABF09882.1    31    LRADRWIGYPRAVEALNRLEILYTWPNK-------QRMPNLLLVGPT 70   

                   GtGKTtlaralanel.........gapfirvdaselleklvg........
                     GK+++++ + +   + ++++++++p++ v +++ ++ ++ +++  +++
  ABF09882.1    71 NNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSEPSVIRFyvallaam 120  

                   ........egegrlrgalaealradpgvlflDEidalagkrgsgtsrld.
                    +       ++++   ala +++ +   l++DE++ ++ +     + ++ 
  ABF09882.1   121 gaplrprpRLPEMEQLALALLRKVGVRMLVIDELHNVLAG-----NSVNr 165  

                   pevqnaLlrlleelrvlsgvlviattnrpeel....dpallrpgRfdlvi
                   +e++n L+ l +elr    ++++++++r   l++  d+ l +  Rf + +
  ABF09882.1   166 REFLNLLRFLGNELR----IPLVGVGTRDAYLairsDDQLEN--RF-EPM 208  

                   elplp.dleerleilkllleklgls..sdealealaelt...egfsarel
                   +lp  +  ++   +l  ++  l+l+  s  a   +a++  +  ++++ el
  ABF09882.1   209 MLPVWeANHDCCSLLASFAASLPLRrpSSIATLDMARYLltrSEGTIGEL 258  

                   lnlleraaalallegrevitledleealekvlpsrlkldklldlislarpltfddvvgqdeakeeleel..lagllgikkpkvillvGppGsGK
                         l+ d  +g++ a+e+l +l++l+ +++ ++++++llvGp+  GK
  ABF09882.1    31    ---LRADRWIGYPRAVEALNRLeiLYTWPNKQRMPNLLLVGPTNNGK 74   

                   TTlaralakel.........gagfilidg...ddlrekavgeleklgrdl
                   ++++++  +   + +++++++++++++ +  ++ +++++v  l+++g++l
  ABF09882.1    75 SMIVEKFRRTHparadadqeHIPVLVVQMpsePSVIRFYVALLAAMGAPL 124  

                   fqvareg.............glvpdilfideidallrkgpdvildgagrt
                      +r +++++ + +   ++g    +l+ide++ +l+++ +        +
  ABF09882.1   125 RPRPRLPemeqlalallrkvG--VRMLVIDELHNVLAGNSV--------N 164  

                   peqlealldlleelgrpvvviilttnrnpfilgpkvdledfigreeelkeleeal.........p.kivlltGp
                                 +  ig  +++++l+++ + ++  ++++++++ll+Gp
  ABF09882.1    34    -----------DRWIGYPRAVEALNRLEilytwpnkqRmPNLLLVGP 69   

                   rGsGKTtllkalakel.........gkpviyidlselsskgyvdleellr
                   +  GK++++ ++ +   + ++++++ +pv+ + + +  s     +  ++ 
  ABF09882.1    70 TNNGKSMIVEKFRRTHparadadqeHIPVLVVQMPSEPS-----VIRFYV 114  

                   elaeelgellellkkllkklsellglsilglelilglsggdleelleela
                   +l+ ++g                              +  +l e+ + ++
  ABF09882.1   115 ALLAAMGA--------------------------PLRPRPRLPEMEQLAL 138  

                   ellkklgkpvililDEiqsll...dvsskelleaLlrlldegknvtiilt
                    ll+k g +  l++DE++++l+ + v ++e+l++L+ l +e + + ++ +
  ABF09882.1   139 ALLRKVGVR-MLVIDELHNVLagnSVNRREFLNLLRFLGNELR-IPLVGV 186  

                   gsdlglldelllrpdlksplygRfdeiielkplsfeelleilkklleelg
                   g +   l       +  ++l +Rf                          
  ABF09882.1   187 GTRDAYLAI-----RSDDQLENRF-------------------------- 205  

                   isdealekiyeltgGlprylellleellllalleeileilledvkkllke
                                                                     
  ABF09882.1     - -------------------------------------------------- -    

                   elrelsryeverlstgipalDellgGglppgslvliaGppGsGKTtlalqlaana
                                          ++   +l++Gp++ GK+ ++  + + +
  ABF09882.1    58    -------------------KQRMPNLLLVGPTNNGKSMIVEKFRRTH 85   

                   alplelgklggkvlyisteeafsperlreralslgldleelldrllvida
                     + +  + + +vl++ +    +p  +r +   l    + l+        
  ABF09882.1    86 PARADADQEHIPVLVVQMPS--EPSVIRFYVALLAAMGAPLR-------- 125  

                   tdlldllellerlrrllsegkvdlvviDslallaraelldepllgldare
                    ++  l e+ + + +ll++ +v+++viD l  +          l+++   
  ABF09882.1   126 -PRPRLPEMEQLALALLRKVGVRMLVIDELHNV----------LAGNSVN 164  

                   lrellrlLkrlakelgvtvievilltGppGvGKTTlakalagel......gakfgsvsltgrdvrsa
                      +++ll+Gp+  GK+ ++ ++ +   + ++++ ++++v+++ +++   
  ABF09882.1    62    PNLLLVGPTNNGKSMIVEKFRRTHparadaDQEHIPVLVVQMPSEP- 107  

                   rrgigyvfqtveellgllaelvglevrgeleellktlikelsggekqrva
                            +v+++   l+   g + r+  +      +           a
  ABF09882.1   108 ---------SVIRFYVALLAAMGAPLRPRPRLPEMEQL-----------A 137  

                   larallakpdvlllDEidgl.......dpdvleallelleelkrsgvtvi
                   la + + +   l++DE++++ + + ++  ++l+ l+ l +   + +++++
  ABF09882.1   138 LALLRKVGVRMLVIDELHNVlagnsvnRREFLNLLRFLGN---ELRIPLV 184  

                   lttndldeleladriallrrgrivelgplseeelleilrrrlnr