RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABF07169.1 rmet0 ABF07169.1 GIB00349CH01 "peptidase M16-like
protein"
         (454 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1bccA [d.185.1 - d.185.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE       207   6e-56
3cwbA [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE          204   5e-55
3cwbN [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE          203   7e-55
3cwbO [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE          202   2e-54
3e50A [x.x.x] INSULIN-DEGRADING ENZYME                                194   4e-52
3cwwA [x.x.x] INSULIN-DEGRADING ENZYME                                194   4e-52
3cwbB [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE          193   1e-51
3e4aA [x.x.x] INSULIN-DEGRADING ENZYME                                192   1e-51
1be3B [d.185.1 - d.185.1] CYTOCHROME BC1 COMPLEX                      192   2e-51
3e4zA [x.x.x] INSULIN-DEGRADING ENZYME                                191   2e-51
3e50B [x.x.x] INSULIN-DEGRADING ENZYME                                188   2e-50
3d3yA [x.x.x] UNCHARACTERIZED PROTEIN                                 182   1e-48
3cx5A [d.185.1 - d.185.1 (1kb9A)] CYTOCHROME B-C1 COMPLEX SUBUNI...   179   1e-47
1bccB [d.185.1 - d.185.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE       177   4e-47
3cx5B [d.185.1 - d.185.1 (1ezvB)] CYTOCHROME B-C1 COMPLEX SUBUNI...   157   7e-41
3e4zB [x.x.x] INSULIN-DEGRADING ENZYME                                 77   8e-17

>1bccA [d.185.1 - d.185.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
          Length = 442

 Score =  207 bits (527), Expect = 6e-56
 Identities = 60/427 (14%), Positives = 136/427 (31%), Gaps = 21/427 (4%)

Query: 39  IESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQDG 98
            +      G +V    S   P   V +  DAGSRY+                        
Sbjct: 11  TQVSQLDNGVRVASEQSSQ-PTCTVGVWIDAGSRYESEKNNGAGYFLEHLAFKGT---KN 66

Query: 99  QPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTYPD 158
           +P     +                              S +  +++ L A ++++ +  D
Sbjct: 67  RPQNALEKEVESMGAHLNAYSSREHTAYYIK-----ALSKDVPKAVELLADIVQNCSLED 121

Query: 159 AVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVS--ATAETVGSITHDDLVK 216
           + + +E+  ++  ++E DT    +    L    +       S    +E +  ++  DL +
Sbjct: 122 SQIEKERDVIVRELQENDTSMREVVFNYLHATAFQGTGLAQSVEGPSENIRKLSRADLTE 181

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPH 276
           +   +YTA R V+   G ++ +Q  ++A++   G+P       +P +        Q    
Sbjct: 182 YLSTHYTAPRMVLAAAGGVEHQQLLELAQKHFGGVPFTYDDDAVPTLSKCRFTGSQIRHR 241

Query: 277 --PAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXX-------FSSRLTDQVREKRGLT 327
                 A VA+         PD                       SS     +     L 
Sbjct: 242 EDGLPLAHVAIAVEGPGWAHPDLVALQVANAIIGHYDRTYGGGLHSSSPLASIAVTNKLC 301

Query: 328 YGVDSYFSPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVN 387
               ++     + G F       + + ++ + +++    + +    +++E+   K+ L N
Sbjct: 302 QSFQTFSICYSETGLFGFYFVCDRMSIDDMMFVLQGQWMR-LCTSISESEVLRGKNFLRN 360

Query: 388 GFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATV 447
                +D    +  ++            L+ W  ++ +V    VR    ++++    A  
Sbjct: 361 ALVSHLDGTTPVCEDIGRELLTYGRRIPLEEWEERLAEVDARMVREVCSKYIYDQCPAVA 420

Query: 448 IVGGPEK 454
             G  E+
Sbjct: 421 GPGPIEQ 427



 Score = 42.8 bits (100), Expect = 2e-06
 Identities = 9/90 (10%), Positives = 24/90 (26%)

Query: 157 PDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSITHDDLVK 216
            ++ V R K  L  A+         + +    + +       +    E +  +    + +
Sbjct: 347 SESEVLRGKNFLRNALVSHLDGTTPVCEDIGRELLTYGRRIPLEEWEERLAEVDARMVRE 406

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEE 246
                   +   V   G I++         
Sbjct: 407 VCSKYIYDQCPAVAGPGPIEQLPDYNRIRS 436


>3cwbA [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
          Length = 443

 Score =  204 bits (519), Expect = 5e-55
 Identities = 61/427 (14%), Positives = 130/427 (30%), Gaps = 21/427 (4%)

Query: 39  IESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQDG 98
               T   G +V    S   P   V +   AGSRY+                        
Sbjct: 13  TNVTTLDNGLRVASEESSQ-PTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGT---KK 68

Query: 99  QPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTYPD 158
           +P     +                              S +  + + L A ++++    +
Sbjct: 69  RPCAAFEKEVESMGAHFNGYTSREQTAFYIK-----ALSKDMPKVVELLADVVQNCALEE 123

Query: 159 AVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVS--ATAETVGSITHDDLVK 216
           + + +E+  ++  ++E D     +    L    +       +   T E +  +T  DL  
Sbjct: 124 SQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLAS 183

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPH 276
           +   ++ A R V+   G I  K+    A +   G+        +P +        +    
Sbjct: 184 YIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRAR 243

Query: 277 --PAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXX-------FSSRLTDQVREKRGLT 327
                 A VAL        DPD                        S     +  +  L 
Sbjct: 244 DDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLC 303

Query: 328 YGVDSYFSPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVN 387
           +   ++ +     G F         + ++ +   +    + +    T++E++ AK++L +
Sbjct: 304 HSFQTFNTSYSDTGLFGFHFVADPLSIDDMMFCAQGEWMR-LCTSTTESEVKRAKNHLRS 362

Query: 388 GFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATV 447
               ++D    +   + +          L+ W S+I+ V    VR    ++++    A  
Sbjct: 363 AMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRISAVDARMVRDVCSKYIYDKCPALA 422

Query: 448 IVGGPEK 454
            VG  E+
Sbjct: 423 AVGPIEQ 429



 Score = 40.1 bits (93), Expect = 1e-05
 Identities = 10/108 (9%), Positives = 29/108 (26%), Gaps = 2/108 (1%)

Query: 141 EQSLRLAAQLIKS--PTYPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYG 198
           +  +  A         +  ++ V R K  L +A+         + +   S  +       
Sbjct: 331 DDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRIS 390

Query: 199 VSATAETVGSITHDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEE 246
           +      + ++    +          K   +  +G I++         
Sbjct: 391 LEEWDSRISAVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRS 438


>3cwbN [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
          Length = 442

 Score =  203 bits (518), Expect = 7e-55
 Identities = 61/427 (14%), Positives = 130/427 (30%), Gaps = 21/427 (4%)

Query: 39  IESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQDG 98
               T   G +V    S   P   V +   AGSRY+                        
Sbjct: 12  TNVTTLDNGLRVASEESSQ-PTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGT---KK 67

Query: 99  QPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTYPD 158
           +P     +                              S +  + + L A ++++    +
Sbjct: 68  RPCAAFEKEVESMGAHFNGYTSREQTAFYIK-----ALSKDMPKVVELLADVVQNCALEE 122

Query: 159 AVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVS--ATAETVGSITHDDLVK 216
           + + +E+  ++  ++E D     +    L    +       +   T E +  +T  DL  
Sbjct: 123 SQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLAS 182

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRI-- 274
           +   ++ A R V+   G I  K+    A +   G+        +P +        +    
Sbjct: 183 YIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRAR 242

Query: 275 PHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXX-------FSSRLTDQVREKRGLT 327
                 A VAL        DPD                        S     +  +  L 
Sbjct: 243 DDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLC 302

Query: 328 YGVDSYFSPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVN 387
           +   ++ +     G F         + ++ +   +    + +    T++E++ AK++L +
Sbjct: 303 HSFQTFNTSYSDTGLFGFHFVADPLSIDDMMFCAQGEWMR-LCTSTTESEVKRAKNHLRS 361

Query: 388 GFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATV 447
               ++D    +   + +          L+ W S+I+ V    VR    ++++    A  
Sbjct: 362 AMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRISAVDARMVRDVCSKYIYDKCPALA 421

Query: 448 IVGGPEK 454
            VG  E+
Sbjct: 422 AVGPIEQ 428



 Score = 38.9 bits (90), Expect = 3e-05
 Identities = 9/90 (10%), Positives = 25/90 (27%)

Query: 157 PDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSITHDDLVK 216
            ++ V R K  L +A+         + +   S  +       +      + ++    +  
Sbjct: 348 TESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRISAVDARMVRD 407

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEE 246
                   K   +  +G I++         
Sbjct: 408 VCSKYIYDKCPALAAVGPIEQLLDYNRIRS 437


>3cwbO [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
          Length = 422

 Score =  202 bits (514), Expect = 2e-54
 Identities = 56/425 (13%), Positives = 113/425 (26%), Gaps = 25/425 (5%)

Query: 39  IESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQDG 98
           +E      G  +  + + S P   + +   AGSRY+                       G
Sbjct: 7   LEITKLPNGLIIASLENFS-PASRIGVFIKAGSRYETTANLGTAHLLRLASPLTT---KG 62

Query: 99  QPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTYPD 158
             +    +                                  +  +     +  +P +  
Sbjct: 63  ASSFRITRGIEAVGGSLSVYSTREKMTYCVE-----CLRDHVDTVMEYLLNVTTAPEFRP 117

Query: 159 AVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVS--ATAETVGSITHDDLVK 216
             V   + +L          P V   + L  A                 +G IT + L  
Sbjct: 118 WEVTDLQPQLKVDKAVAFQSPQVGVLENL-HAAAYKTALANPLYCPDYRIGKITSEQLHH 176

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPH 276
           F Q+N+T+ R  +  IG       +Q+AE+                        E R  +
Sbjct: 177 FVQNNFTSARMALVGIGVKH-SDLKQVAEQFLNIRSGAGTSSAKATY----WGGEIREQN 231

Query: 277 PAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXX-------FSSRLTDQVREKRGLTYG 329
                  A+     A G  +                       +S+L   V +     + 
Sbjct: 232 GHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFD 291

Query: 330 VDSYFSPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGF 389
             ++       G F     ++  +  E +      +      G T+ ++  AK+ L   +
Sbjct: 292 ASAFNVNYSDSGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATY 351

Query: 390 PLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATVIV 449
            + +++ + LL  + +                +I+ VT   V  A ++ V     +    
Sbjct: 352 LMSVETAQGLLNEIGSEALLSGTHTAPSVVAQKIDSVTSADVVNAAKKFV-SGKKSMAAS 410

Query: 450 GGPEK 454
           G    
Sbjct: 411 GDLGS 415


>3e50A [x.x.x] INSULIN-DEGRADING ENZYME
          Length = 961

 Score =  194 bits (494), Expect = 4e-52
 Identities = 55/432 (12%), Positives = 117/432 (27%), Gaps = 24/432 (5%)

Query: 39  IESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQDG 98
                 + G KV  +  P+       +D   GS  DPP                      
Sbjct: 22  YRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCQHMLF---LGTKK 78

Query: 99  QPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTYPD 158
            P  NE                               +    E +L   AQ    P + +
Sbjct: 79  YPKENE----YSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDE 134

Query: 159 AVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSA--TAETVGSI------- 209
           +   RE   + +   +          +       P HP+         T+ +        
Sbjct: 135 SCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGID 194

Query: 210 THDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAP-PTMPD--VQMT 266
              +L+KF    Y++    V ++G         +  +L   +     P P  P+   Q  
Sbjct: 195 VRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEE 254

Query: 267 IPASEQRIPHPAQQASVALGQP-AIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRG 325
                 +I       ++ +  P    +      P                L  +++ K  
Sbjct: 255 HLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHE-GPGSLLSELKSKGW 313

Query: 326 LTYGVDSYFSPSKQPGPFSVSLQT---KKENTNEALALVREIVAKYVAEGPTDAELRAAK 382
           +   V      ++    F +++        +  + +  + + + K  AEGP +   +  K
Sbjct: 314 VNTLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECK 373

Query: 383 DNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPD 442
           D     F  +     +  T+      +  PL+ + T    + +   + +     +    +
Sbjct: 374 DLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPEN 433

Query: 443 AMATVIVGGPEK 454
               ++    E 
Sbjct: 434 VRVAIVSKSFEG 445



 Score =  188 bits (478), Expect = 3e-50
 Identities = 46/431 (10%), Positives = 103/431 (23%), Gaps = 30/431 (6%)

Query: 39  IESWTASTGAKVFFVPSP--SIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQ 96
                 +  +K++F       +P   +N +F +   Y  P                 +  
Sbjct: 506 PALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELLKDSLNEY 565

Query: 97  DGQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTY 156
                                                   + ++   L+   + + +   
Sbjct: 566 AYAAELAGLSYDLQNTIYGMYLSVK-------------GYNDKQPILLKKIIEKMATFEI 612

Query: 157 PDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSITHDDLVK 216
            +      K+  + ++                + +     +      E +  +T   L  
Sbjct: 613 DEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKA 672

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQ------MTIPAS 270
           F     +       L G I ++ A  I + +   L   A    +   Q      + +P  
Sbjct: 673 FIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPDR 732

Query: 271 EQRIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGV 330
              +     +     G     + D                  S    + +R K  L Y V
Sbjct: 733 GWFVYQQRNEVHNNCGIEIYYQTDMQSTS-ENMFLELFCQIISEPCFNTLRTKEQLGYIV 791

Query: 331 DSYFSPSKQPGPFSVSLQTKK--ENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNG 388
            S    +         +Q++K        +      + K   E  T+   +     L   
Sbjct: 792 FSGPRRANGIQGLRFIIQSEKPPHYLESRVEAFLITMEK-SIEDMTEEAFQKHIQALAIR 850

Query: 389 FPLRIDSNRKLLTNVA-NIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATV 447
              +              I       D  +T  + +  +T+E +   ++  +  DA    
Sbjct: 851 RLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRH 910

Query: 448 IVG----GPEK 454
            V       E 
Sbjct: 911 KVSVHVLAREM 921


>3cwwA [x.x.x] INSULIN-DEGRADING ENZYME
          Length = 953

 Score =  194 bits (494), Expect = 4e-52
 Identities = 56/433 (12%), Positives = 119/433 (27%), Gaps = 24/433 (5%)

Query: 38  PIESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQD 97
                  + G KV  +  P+       +D   GS  DPP                     
Sbjct: 21  EYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFLQHMLF---LGTK 77

Query: 98  GQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTYP 157
             P  NE                               +    E +L   AQ   SP + 
Sbjct: 78  KYPKENE----YSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLSPLFD 133

Query: 158 DAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSA--TAETVGSI------ 209
           ++   RE   + +   +          +       P HP+         T+ +       
Sbjct: 134 ESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGI 193

Query: 210 -THDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAP-PTMPD--VQM 265
               +L+KF    Y++    V ++G         +  +L   +     P P  P+   Q 
Sbjct: 194 DVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQE 253

Query: 266 TIPASEQRIPHPAQQASVALGQPA-IARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKR 324
                  +I       ++ +  P    +      P                L  +++ K 
Sbjct: 254 EHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHE-GPGSLLSELKSKG 312

Query: 325 GLTYGVDSYFSPSKQPGPFSVSLQTK---KENTNEALALVREIVAKYVAEGPTDAELRAA 381
            +   V    + ++    F +++        +  + +  + + + K  AEGP +   +  
Sbjct: 313 WVNTLVGGQKAGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQEL 372

Query: 382 KDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHP 441
           KD     F  +     +  T+      +  PL+ + T    + +   + +     +    
Sbjct: 373 KDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPE 432

Query: 442 DAMATVIVGGPEK 454
           +    ++    E 
Sbjct: 433 NVRVAIVSKSFEG 445



 Score =  187 bits (475), Expect = 6e-50
 Identities = 47/431 (10%), Positives = 106/431 (24%), Gaps = 30/431 (6%)

Query: 39  IESWTASTGAKVFFVPSP--SIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQ 96
                 +  +K++F       +P  ++N +F +   Y  P                 +  
Sbjct: 506 PALIKDTAMSKLWFKQDDKFFLPKANLNFEFFSPFAYVDPLHSNMAYLYLELLKDSLNEY 565

Query: 97  DGQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTY 156
                                                   + ++   L+   + + +   
Sbjct: 566 AYAAELAGLSYDLQNTIYGMYLSVK-------------GYNDKQPILLKKIIEKMATFEI 612

Query: 157 PDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSITHDDLVK 216
            +A     K+  + ++                + +     +      E +  +T   L  
Sbjct: 613 DEARFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALADVTLPRLKA 672

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQ------MTIPAS 270
           F     +       L G I ++ A  I + +   L   A    +   Q      + +P  
Sbjct: 673 FIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLAAYREVQLPDR 732

Query: 271 EQRIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGV 330
              +     +     G     + D                  S    + +R K  L Y V
Sbjct: 733 GWFVYQQRNEVHNNSGIEIYYQTDMQSTS-ENMFLELFAQIISEPAFNTLRTKEQLGYIV 791

Query: 331 DSYFSPSKQPGPFSVSLQTKK--ENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNG 388
            S    +         +Q++K        +      + K   E  T+   +     L   
Sbjct: 792 FSGPRRANGIQGLRFIIQSEKPPHYLESRVEAFLITMEK-SIEDMTEEAFQKHIQALAIR 850

Query: 389 FPLRIDSNRKLLTNVA-NIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMA-- 445
              +              I       D  +T  + +  +T+  +   ++  +  DA    
Sbjct: 851 RLDKPKKLSAESAKYWGEIISQQYNFDRDNTEVAYLKTLTKADIIKFYKEMLAVDAPRRH 910

Query: 446 --TVIVGGPEK 454
             +V V   E 
Sbjct: 911 KVSVHVLAREM 921


>3cwbB [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
          Length = 421

 Score =  193 bits (490), Expect = 1e-51
 Identities = 46/323 (14%), Positives = 94/323 (29%), Gaps = 16/323 (4%)

Query: 141 EQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVS 200
           +  +     +  +P +    V   + +L          P V   + L  A          
Sbjct: 99  DTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVGVLENL-HAAAYKTALANP 157

Query: 201 --ATAETVGSITHDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPP 258
                  +G IT + L  F Q+N+T+ R  +  IG       +Q+AE+            
Sbjct: 158 LYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSD-LKQVAEQFLNIRSGAGTSS 216

Query: 259 TMPDVQMTIPASEQRIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXX------- 311
                       E R  +       A+     A G  +                      
Sbjct: 217 AKATY----WGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSS 272

Query: 312 FSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAE 371
            +S+L   V +     +   ++       G F     ++  +  E +      +      
Sbjct: 273 VTSKLYQGVAKATTQPFDASAFNVNYSDSGLFGFYTISQAAHAGEVIRAAMNQLKAAAQG 332

Query: 372 GPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQV 431
           G T+ ++  AK+ L   + + +++ + LL  + +                +I+ VT   V
Sbjct: 333 GVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVVAQKIDSVTSADV 392

Query: 432 RAAFQRHVHPDAMATVIVGGPEK 454
             A ++ V     +    G    
Sbjct: 393 VNAAKKFV-SGKKSMAASGDLGS 414



 Score = 37.4 bits (86), Expect = 8e-05
 Identities = 9/38 (23%), Positives = 16/38 (42%), Gaps = 1/38 (2%)

Query: 39 IESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPP 76
          +E      G  +  + + S P   + +   AGSRY+  
Sbjct: 6  LEITKLPNGLIIASLENFS-PASRIGVFIKAGSRYETT 42


>3e4aA [x.x.x] INSULIN-DEGRADING ENZYME
          Length = 961

 Score =  192 bits (489), Expect = 1e-51
 Identities = 45/422 (10%), Positives = 103/422 (24%), Gaps = 26/422 (6%)

Query: 39  IESWTASTGAKVFFVPSP--SIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQ 96
                 +  +K++F       +P  ++N +F +   Y  P                 +  
Sbjct: 506 PALIKDTAMSKLWFKQDDKFFLPKANLNFEFFSPFAYVDPLHSNMAYLYLELLKDSLNEY 565

Query: 97  DGQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTY 156
                                                   + ++   L+   + + +   
Sbjct: 566 AYAAELAGLSYDLQNTIYGMYLSVK-------------GYNDKQPILLKKIIEKMATFEI 612

Query: 157 PDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSITHDDLVK 216
            +      K+  + ++                + +     +      E +  +T   L  
Sbjct: 613 DEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKA 672

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQ------MTIPAS 270
           F     +       L G I ++ A  I + +   L   A    +   Q      + +P  
Sbjct: 673 FIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPDR 732

Query: 271 EQRIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGV 330
              +     +     G     + D                  S    + +R K  L Y V
Sbjct: 733 GWFVYQQRNEVHNNSGIEIYYQTDMQSTS-ENMFLELFAQIISEPAFNTLRTKEQLGYIV 791

Query: 331 DSYFSPSKQPGPFSVSLQTKK--ENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNG 388
            S    +         +Q++K        +      + K   E  T+   +     L   
Sbjct: 792 FSGPRRANGIQGLRFIIQSEKPPHYLESRVEAFLITMEK-SIEDMTEEAFQKHIQALAIR 850

Query: 389 FPLRIDSNRKLLTNVA-NIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATV 447
              +              I       D  +T  + +  +T+E +   ++  +  DA    
Sbjct: 851 RLDKPKKLSAESAKYWGEIISQQYNFDRDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRH 910

Query: 448 IV 449
            V
Sbjct: 911 KV 912



 Score =  191 bits (487), Expect = 2e-51
 Identities = 56/433 (12%), Positives = 118/433 (27%), Gaps = 24/433 (5%)

Query: 38  PIESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQD 97
                  + G KV  +  P+       +D   GS  DPP                     
Sbjct: 21  EYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFLQHMLFLGT---K 77

Query: 98  GQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTYP 157
             P  NE                               +    E +L   AQ   SP + 
Sbjct: 78  KYPKENE----YSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLSPLFD 133

Query: 158 DAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSA--TAETVGSI------ 209
           ++   RE   + +   +          +       P HP+         T+ +       
Sbjct: 134 ESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGI 193

Query: 210 -THDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAP-PTMPD--VQM 265
               +L+KF    Y++    V ++G         +  +L   +     P P  P+   Q 
Sbjct: 194 DVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQE 253

Query: 266 TIPASEQRIPHPAQQASVALGQPA-IARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKR 324
                  +I       ++ +  P    +      P                L  +++ K 
Sbjct: 254 EHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHE-GPGSLLSELKSKG 312

Query: 325 GLTYGVDSYFSPSKQPGPFSVSLQT---KKENTNEALALVREIVAKYVAEGPTDAELRAA 381
            +   V      ++    F +++        +  + +  + + + K  AEGP +   +  
Sbjct: 313 WVNTLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQEL 372

Query: 382 KDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHP 441
           KD     F  +     +  T+      +  PL+ + T    + +   + +     +    
Sbjct: 373 KDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPE 432

Query: 442 DAMATVIVGGPEK 454
           +    ++    E 
Sbjct: 433 NVRVAIVSKSFEG 445


>1be3B [d.185.1 - d.185.1] CYTOCHROME BC1 COMPLEX
          Length = 419

 Score =  192 bits (489), Expect = 2e-51
 Identities = 56/427 (13%), Positives = 118/427 (27%), Gaps = 27/427 (6%)

Query: 38  PIESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQD 97
            +E      G  +  + + + P   + +   AGSRY+                       
Sbjct: 3   DLEFTRLPNGLVIASLENYA-PASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGAS 61

Query: 98  -GQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTY 156
             +  R                                    + +  +     +  +P +
Sbjct: 62  SFKITRGIEAVGGKLSVTSTRENMAYTVE---------CLRDDVDILMEFLLNVTTAPEF 112

Query: 157 PDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVS--ATAETVGSITHDDL 214
               VA  + +L          P     + L  A    +    S       +G +T  +L
Sbjct: 113 RRWEVAALQPQLRIDKAVALQNPQAHVIENL-HAAAYRNALANSLYCPDYRIGKVTPVEL 171

Query: 215 VKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRI 274
             + Q+++T+ R  +  +G       +Q+AE+                        E R 
Sbjct: 172 HDYVQNHFTSARMALIGLGVSH-PVLKQVAEQFLNIRGGLGLSGAKA----KYHGGEIRE 226

Query: 275 PHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXX-------FSSRLTDQVREKRGLT 327
            +       AL   + A G  +                       +S L   V +     
Sbjct: 227 QNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQP 286

Query: 328 YGVDSYFSPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVN 387
           + V ++ +     G F     ++  +  + +      V        ++ +++AAK+ L  
Sbjct: 287 FDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKA 346

Query: 388 GFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATV 447
           G+ + ++S+   L  V +            T   QI+ V    V  A ++ V     +  
Sbjct: 347 GYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGR-KSMA 405

Query: 448 IVGGPEK 454
             G    
Sbjct: 406 ASGNLGH 412


>3e4zA [x.x.x] INSULIN-DEGRADING ENZYME
          Length = 953

 Score =  191 bits (487), Expect = 2e-51
 Identities = 55/429 (12%), Positives = 117/429 (27%), Gaps = 24/429 (5%)

Query: 38  PIESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQD 97
                  + G KV  +  P+       +D   GS  DPP                     
Sbjct: 21  EYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFLQHMLF---LGTK 77

Query: 98  GQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTYP 157
             P  NE                               +    E +L   AQ   SP + 
Sbjct: 78  KYPKENE----YSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLSPLFD 133

Query: 158 DAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSA--TAETVGSI------ 209
           ++   RE   + +   +          +       P HP+         T+ +       
Sbjct: 134 ESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGI 193

Query: 210 -THDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAP-PTMPD--VQM 265
               +L+KF    Y++    V ++G         +  +L   +     P P  P+   Q 
Sbjct: 194 DVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQE 253

Query: 266 TIPASEQRIPHPAQQASVALGQP-AIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKR 324
                  +I       ++ +  P    +      P                L  +++ K 
Sbjct: 254 EHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHE-GPGSLLSELKSKG 312

Query: 325 GLTYGVDSYFSPSKQPGPFSVSLQTK---KENTNEALALVREIVAKYVAEGPTDAELRAA 381
            +   V      ++    F +++        +  + +  + + + K  AEGP +   +  
Sbjct: 313 WVNTLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQEL 372

Query: 382 KDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHP 441
           KD     F  +     +  T+      +  PL+ + T    + +   + +     +    
Sbjct: 373 KDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPE 432

Query: 442 DAMATVIVG 450
           +    ++  
Sbjct: 433 NVRVAIVSK 441



 Score =  185 bits (471), Expect = 2e-49
 Identities = 47/423 (11%), Positives = 104/423 (24%), Gaps = 27/423 (6%)

Query: 38  PIESWTASTGAKVFFVPSP--SIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSA 95
                  +  +K++F       +P  ++N +F +   Y  P                 + 
Sbjct: 505 YPALIKDTAMSKLWFKQDDKFFLPKANLNFEFFSPFAYVDPLHSNMAYLYLELLKDSLNE 564

Query: 96  QDGQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPT 155
                                                    + ++   L+   + + +  
Sbjct: 565 YAYAAELAGLSYDLQNTIYGMYLSVK-------------GYNDKQPILLKKIIEKMATFE 611

Query: 156 YPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSITHDDLV 215
             +      K+  + ++          A   L   +     +      E +  +T   L 
Sbjct: 612 IDEKRFEIIKEAYMRSLNNFRAEQPHHAMYYLRLLMTEVA-WTKDELKEALDDVTLPRLK 670

Query: 216 KFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQ------MTIPA 269
            F     +       L G I ++ A  I + +   L   A    +   Q      + +P 
Sbjct: 671 AFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPD 730

Query: 270 SEQRIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYG 329
               +     +     G     + D                  S    + +R K  L Y 
Sbjct: 731 RGWFVYQQRNEVHNNSGIEIYYQTDMQSTSENMFLELFAQI-ISEPAFNTLRTKEQLGYI 789

Query: 330 VDSYFSPSKQPGPFSVSLQTKK--ENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVN 387
           V S    +         +Q++K        +      + K   E  T+   +     L  
Sbjct: 790 VFSGPRRANGIQGLRFIIQSEKPPHYLESRVEAFLITMEK-SIEDMTEEAFQKHIQALAI 848

Query: 388 GFPLRIDSNRKLLTNVA-NIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMAT 446
               +              I       D  +T  + +  +T+E +   ++  +  DA   
Sbjct: 849 RRLDKPKKLSAESAKYYGEIISQQYNFDRDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRR 908

Query: 447 VIV 449
             V
Sbjct: 909 HKV 911


>3e50B [x.x.x] INSULIN-DEGRADING ENZYME
          Length = 955

 Score =  188 bits (479), Expect = 2e-50
 Identities = 51/427 (11%), Positives = 112/427 (26%), Gaps = 21/427 (4%)

Query: 38  PIESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQD 97
                  + G KV  +  P+       +D   GS  DPP                     
Sbjct: 19  EYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCQHMLF---LGTK 75

Query: 98  GQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTYP 157
             P  NE                               +    E +L   AQ    P + 
Sbjct: 76  KYPKENE----YSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFD 131

Query: 158 DAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSA--TAETVGSI------ 209
           ++   RE   + +   +          +       P HP+         T+ +       
Sbjct: 132 ESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGI 191

Query: 210 -THDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIP 268
               +L+KF    Y++    V ++G         +  +L   +     P           
Sbjct: 192 DVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPQEE 251

Query: 269 ASEQ--RIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGL 326
             +Q  +I       ++ +  P                           L  +++ K  +
Sbjct: 252 HLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWV 311

Query: 327 TYGVDSYFSPSKQPGPFSVSLQT---KKENTNEALALVREIVAKYVAEGPTDAELRAAKD 383
              V      ++    F +++        +  + +  + + + K  AEGP +   +  KD
Sbjct: 312 NTLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKD 371

Query: 384 NLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDA 443
                F  +     +  T+      +  PL+ + T    + +   + +     +    + 
Sbjct: 372 LNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPENV 431

Query: 444 MATVIVG 450
              ++  
Sbjct: 432 RVAIVSK 438



 Score =  178 bits (453), Expect = 2e-47
 Identities = 46/430 (10%), Positives = 102/430 (23%), Gaps = 30/430 (6%)

Query: 39  IESWTASTGAKVFFVPSPS--IPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQ 96
                 +  +K++F       +P   +N +F +   Y  P                 +  
Sbjct: 503 PALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMALYLELLKDSL-NEY 561

Query: 97  DGQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTY 156
                                                   + ++   L+   + + +   
Sbjct: 562 AYAAELAGLSYDLQNTIYGMYLSVK-------------GYNDKQPILLKKIIEKMATFEI 608

Query: 157 PDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSITHDDLVK 216
            +      K+  + ++                + +     +      E +  +T   L  
Sbjct: 609 DEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKA 668

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQ------MTIPAS 270
           F     +       L G I ++ A  I + +   L   A    +   Q      + +P  
Sbjct: 669 FIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPDR 728

Query: 271 EQRIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGV 330
              +     +     G     + D                  S    + +R K  L Y V
Sbjct: 729 GWFVYQQRNEVHNNCGIEIYYQTDMQSTS-ENMFLELFCQIISEPCFNTLRTKEQLGYIV 787

Query: 331 DSYFSP-SKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGF 389
            S     + Q   F +  +         +      + K   E  T+   +     L    
Sbjct: 788 FSGPRRANGQGLRFIIQSEKPPHYLESRVEAFLITMEK-SIEDMTEEAFQKHIQALAIRR 846

Query: 390 PLRIDSNRKLLTNVA-NIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATVI 448
             +              I       D  +T  + +  +T+E +   ++  +  DA     
Sbjct: 847 LDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHK 906

Query: 449 VG----GPEK 454
           V       E 
Sbjct: 907 VSVHVLAREM 916


>3d3yA [x.x.x] UNCHARACTERIZED PROTEIN
          Length = 416

 Score =  182 bits (464), Expect = 1e-48
 Identities = 57/423 (13%), Positives = 118/423 (27%), Gaps = 19/423 (4%)

Query: 40  ESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQDGQ 99
            S     G  +  +P+     + + + F+    ++                   +     
Sbjct: 3   ASVQLVKGVNLHVIPTEKYKTVRLLVRFNTRLNHETITKRTLLSSLETNSLNYPNQVKLS 62

Query: 100 PARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPT---- 155
               E                                S    +++    ++I +P     
Sbjct: 63  ERLAELYGASFGIGVSKKGNQHWFNISNIVNDHYLQDSQVLAEAVDFLKEIIFAPNIQAG 122

Query: 156 -YPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSITHDDL 214
            +      REK+ L   +          A   L    +         +  TV ++  +  
Sbjct: 123 QFEAETFQREKENLKAYLESIVEDKQTYASLALQSVYFNQSEDQKIPSFGTVAALAEETA 182

Query: 215 VKF--WQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQ 272
                +       +  + ++G ++  +   + ++L              +  +     E+
Sbjct: 183 ASLAAYYQKLAEDQVDIFVLGDVNEAELVPLFKQLPFTPREEGKAAIFYNQPIRNVIEER 242

Query: 273 RIPHPAQQASVALGQPA-IARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGVD 331
                  Q+ + L     I  GD  YF               S+L   VREK  L Y   
Sbjct: 243 TEREVLAQSKLNLAYNTDIYYGDSYYFA-LQVFNGIFGGFPHSKL-FNVREKEHLAYYAS 300

Query: 332 SYFSPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGFPL 391
           S     +    F+V      +N N+ L L+   +         + E+   K  L N + L
Sbjct: 301 SSIDTFRG---FTVQTGIDGKNRNQVLRLISTELENIRLGKIRELEIEQTK-ALKNQYIL 356

Query: 392 RIDSNRKLLTNVANIGWYGLP-LDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATVIVG 450
            +D+    L          LP     + W ++IN VT  +++   +R     A+  +   
Sbjct: 357 ALDNAGAWLE---KEYLNELPQTLTAEEWIARINAVTIPEIQEVAKRLE-LQAIFFLEGE 412

Query: 451 GPE 453
              
Sbjct: 413 TEN 415


>3cx5A [d.185.1 - d.185.1 (1kb9A)] CYTOCHROME B-C1 COMPLEX SUBUNIT
           1, MITOCHONDRIAL
          Length = 431

 Score =  179 bits (455), Expect = 1e-47
 Identities = 50/331 (15%), Positives = 100/331 (30%), Gaps = 20/331 (6%)

Query: 141 EQSLRLAAQLIKSP---TYPDAVVAREKQRLITAIREG-DTRPGVIADKKLSKAIYPNHP 196
           ++SL    Q            +     K+ ++  +++  D        + L    + N P
Sbjct: 88  DKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEDNDHPNRVLEHLHSTAFQNTP 147

Query: 197 YGVS--ATAETVGSITHDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAG 254
             +    T E++ ++   DL  F  +++    AVV   G I  +      E     L  G
Sbjct: 148 LSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTG 207

Query: 255 AAPPTMPDVQMTIPASEQRIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXF-- 312
             P           +  +       +A ++L         P+YF                
Sbjct: 208 TKPVLKKKAAFL-GSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFE 266

Query: 313 ------SSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTKK-ENTNEALALVREIV 365
                   +L D ++E   L    + +    K  G +  S  T+     ++ +    +  
Sbjct: 267 PASRLQGIKLLDNIQEY-QLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQW 325

Query: 366 AKYVAEGPTDAELRAAKDNLVNGFPLRIDSNRK--LLTNVANIGWYGLPLDYLDTWTSQI 423
            + +    TD E+  AK  L        +S         +            L     +I
Sbjct: 326 NR-LTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKI 384

Query: 424 NKVTREQVRAAFQRHVHPDAMATVIVGGPEK 454
           + +T + V+A   + +    +A    G  E 
Sbjct: 385 DAITVKDVKAWAGKRLWDQDIAIAGTGQIEG 415



 Score = 42.0 bits (98), Expect = 3e-06
 Identities = 10/37 (27%), Positives = 15/37 (40%)

Query: 40 ESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPP 76
          E    S G  V    +PS     V + F +G+  + P
Sbjct: 2  EVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENP 38



 Score = 37.4 bits (86), Expect = 8e-05
 Identities = 12/92 (13%), Positives = 28/92 (30%), Gaps = 2/92 (2%)

Query: 157 PDAVVAREKQRLITA-IREGDTRPGV-IADKKLSKAIYPNHPYGVSATAETVGSITHDDL 214
            D  V R K  L     +  ++   V  A+   ++ +       +    + + +IT  D+
Sbjct: 333 TDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDV 392

Query: 215 VKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEE 246
             +       +   +   G I+          
Sbjct: 393 KAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRS 424


>1bccB [d.185.1 - d.185.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
          Length = 406

 Score =  177 bits (451), Expect = 4e-47
 Identities = 59/420 (14%), Positives = 115/420 (27%), Gaps = 30/420 (7%)

Query: 38  PIESWTASTGAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQD 97
            +E      G  +  + + S P   + +   AGSRY+                       
Sbjct: 6   DLEITKLPNGLVIASLENYS-PGSTIGVFIKAGSRYENSSNLGTSHLLRLASSLTTKGAS 64

Query: 98  -GQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPEREQSLRLAAQLIKSPTY 156
             +  R                                    + E  +     +  +P +
Sbjct: 65  SFKITRGIEAVGGKLSVESTRENMAYTVE---------CLRDDVEILMEFLLNVTTAPEF 115

Query: 157 PDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVS--ATAETVGSITHDDL 214
               VA  + +L          P     + L  A Y  +    S       +G +T  +L
Sbjct: 116 RPWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYR-NALADSLYCPDYRIGKVTSVEL 174

Query: 215 VKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRI 274
             F Q+++T+ R  +  +G       + +AE+L                       E R 
Sbjct: 175 HDFVQNHFTSARMALVGLGVSH-PVLKNVAEQLLNIRGGLGLSGAKAKY----RGGEIRE 229

Query: 275 PHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGVDSYF 334
            +       A+   + A G  +                   L      KRG  + V ++ 
Sbjct: 230 QNGDSLVHAAIVAESAAIGGAEANAFSV---------LQHVLGANPHVKRGNPFDVSAFN 280

Query: 335 SPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGFPLRID 394
           +     G F     ++     + +      V        ++  ++AAK+ L   + + ++
Sbjct: 281 ASYSDSGLFGFYTISQAAYAGQVIKAAYNQVKTIAQGNVSNENVQAAKNKLKAKYLMSVE 340

Query: 395 SNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATVIVGGPEK 454
           S+   L  V +        +   T   QI+ V    V  A ++ V           G   
Sbjct: 341 SSEGFLEEVGSQALAAGSYNPPSTVLQQIDAVADADVIKAAKKFVSRQKSMAAS--GNLG 398


>3cx5B [d.185.1 - d.185.1 (1ezvB)] CYTOCHROME B-C1 COMPLEX SUBUNIT
           2, MITOCHONDRIAL
          Length = 352

 Score =  157 bits (397), Expect = 7e-41
 Identities = 34/292 (11%), Positives = 81/292 (27%), Gaps = 24/292 (8%)

Query: 141 EQSLRLAAQLIKSPTYPDAVVAREKQRLITA-IREGDTRPGVIADKKLSKAIYPNHPYGV 199
              +   A ++    +    +               +  P   A+ +L    +     G 
Sbjct: 83  PYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFR-KGLGN 141

Query: 200 SATAETVGSITHDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPT 259
               + V  ++  D+  F    YT +   V+    ++      + E L   LPAG +  +
Sbjct: 142 PLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVS 201

Query: 260 MPDVQMTIPASEQRIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQ 319
             +     P       +  +    ++    I                      ++ LT  
Sbjct: 202 KSE-----PKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEV---------LANYLTSA 247

Query: 320 VREKRGLTYGVDSYFSPSKQPGPFSVSLQTKKENTNEALALVREIVAKYVAEGPTDAELR 379
           + E  GL              G F++ ++       +  A+V   + K VA+     +L 
Sbjct: 248 LSELSGLISSAKLD--KFTDGGLFTLFVRD------QDSAVVSSNIKKIVADLKKGKDLS 299

Query: 380 AAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWTSQINKVTREQV 431
            A +       ++ +S    +    +         +       ++ +     
Sbjct: 300 PAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDE 351



 Score = 36.6 bits (84), Expect = 1e-04
 Identities = 7/111 (6%), Positives = 30/111 (27%), Gaps = 9/111 (8%)

Query: 343 FSVSLQTKKENTNEALALVREIVAKYVAEGP--TDAELRAAKDNLVN-GFPLRIDSNRKL 399
            ++     K++    +  + +++ K           EL  +        + +      K 
Sbjct: 71  ITLKATFLKDDLPYYVNALADVLYK-----TAFKPHELTESVLPAARYDYAVAEQCPVKS 125

Query: 400 LTNVANIGWYGLPLDYLDTWTSQINKVTREQVRAAFQRHVHPDAMATVIVG 450
             +      +   L         + +V+ + ++    +    + +      
Sbjct: 126 AEDQLYAITFRKGL-GNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGEN 175


>3e4zB [x.x.x] INSULIN-DEGRADING ENZYME
          Length = 952

 Score = 77.3 bits (190), Expect = 8e-17
 Identities = 58/382 (15%), Positives = 107/382 (28%), Gaps = 38/382 (9%)

Query: 47  GAKVFFVPSPSIPMLDVNIDFDAGSRYDPPXXXXXXXXXXXXXXXXXSAQDGQPARNEAQ 106
           G KV  +  P+       +D   GS  DPP                       P  NE  
Sbjct: 30  GIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFLQHMLFLGTK---KYPKENEYS 86

Query: 107 XXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPER-EQSLRLAAQLIKSPTYPDAVVAREK 165
                                         S E  E +L   AQ   SP + ++   RE 
Sbjct: 87  QFLSEHAGSSNAFTSGEHTNYYF-----DVSHEHLEGALDRFAQFFLSPLFDESAKDREV 141

Query: 166 QRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSAT--AETVGSI-------THDDLVK 216
             + +   +          +       P HP+    T    T+ +           +L+K
Sbjct: 142 NAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLK 201

Query: 217 FWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAP-PTMPDVQMTIPASEQRIP 275
           F    Y++    V ++G         +  +L   +     P P  P+        +Q   
Sbjct: 202 FHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEEHLKQLYK 261

Query: 276 H-PAQQA---SVALGQPAIAR----GDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLT 327
             P +      V    P + +        Y                  L  +++ K  + 
Sbjct: 262 IVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEG------PGSLLSELKSKGWVN 315

Query: 328 YGVDSYFSPSKQPGPFSVSLQ-TKK--ENTNEALALVREIVAKYVAEGPTDAELRAAKDN 384
             V      ++    F +++  T++   +  + +  + + + K  AEGP +   +  KD 
Sbjct: 316 TLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQELKDL 375

Query: 385 LVNGFPLRIDSNRKLLTNVANI 406
               F  R     +     + I
Sbjct: 376 NAVAF--RFKDKERPRGYTSKI 395



 Score = 36.1 bits (83), Expect = 2e-04
 Identities = 39/258 (15%), Positives = 72/258 (27%), Gaps = 30/258 (11%)

Query: 204 ETVGSITHDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDV 263
           E +  +T   L  F     +       L G I ++ A  I + +   L   A    +   
Sbjct: 659 EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS 718

Query: 264 QMTIPASEQ---------RIPHPAQQASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSS 314
           Q+      Q         +  +     S                              S 
Sbjct: 719 QLVRYREVQLPDRGWFVYQQRNEVHNNSGIEIYYQTDMQSTSEN----MFLELFAQIISE 774

Query: 315 RLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTKK-----ENTNEALALVREIVAKYV 369
              + +R K  L Y V S    +         +Q++K           L  + + +    
Sbjct: 775 PAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQSEKPPYLESRVEAFLITMEKSI---- 830

Query: 370 AEGPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVA----NIGWYGLPLDYLDTWTSQINK 425
            E  T+   +     L      R+D  +KL    A     I       D  +T  + +  
Sbjct: 831 -EDMTEEAFQKHIQALAI---RRLDKPKKLSAESAKYYGEIISQQYNFDRDNTEVAYLKT 886

Query: 426 VTREQVRAAFQRHVHPDA 443
           +T+E +   ++  +  DA
Sbjct: 887 LTKEDIIKFYKEMLAVDA 904


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.133    0.406 

Gapped
Lambda     K      H
   0.267   0.0363    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 22,403,767
Number of extensions: 1385542
Number of successful extensions: 16987
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8074
Number of HSP's successfully gapped: 554
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)