RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABF07913.1 rmet0 ABF07913.1 GIB00349CH01 "iron-sulfur cluster
assembly protein IscA"
         (113 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2apnA [x.x.x] PROTEIN HI1723                                          121   1e-30
2d2aA [x.x.x] SUFA PROTEIN                                            121   1e-30
2d2aB [x.x.x] SUFA PROTEIN                                             95   1e-22

>2apnA [x.x.x] PROTEIN HI1723
          Length = 114

 Score =  121 bits (305), Expect = 1e-30
 Identities = 33/114 (28%), Positives = 49/114 (42%), Gaps = 1/114 (0%)

Query: 1   MFDSKAKMISMTEKAAKHVARYLEXXXXXXXXXXXXXXXX-CSGLAYKLEYVDEVLPEDQ 59
           M D  A  ++ T+ AA  V   +                  CSG  Y   + ++V   D 
Sbjct: 1   MIDDMAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDL 60

Query: 60  VFETHGIKVIVDPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 113
             E  G+++++DP SL Y+ G  +D+        F  NNPN    CGCG SF +
Sbjct: 61  TIEKSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI 114


>2d2aA [x.x.x] SUFA PROTEIN
          Length = 114

 Score =  121 bits (304), Expect = 1e-30
 Identities = 44/111 (39%), Positives = 64/111 (57%)

Query: 3   DSKAKMISMTEKAAKHVARYLEXXXXXXXXXXXXXXXXCSGLAYKLEYVDEVLPEDQVFE 62
           D   + +++T  AA H+   +                 C+G  Y L+ V E   +D +FE
Sbjct: 4   DFAWQGLTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFE 63

Query: 63  THGIKVIVDPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 113
             G K+ V  +++P+IDGTE+DF REGLN+ FKF+NP  ++ECGCGESF V
Sbjct: 64  HDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 114


>2d2aB [x.x.x] SUFA PROTEIN
          Length = 102

 Score = 94.9 bits (236), Expect = 1e-22
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 5/99 (5%)

Query: 3   DSKAKM-ISMTEKAAKHVARYLEXXXXXXXXXXXXXXXXCSGLAYKLEYVDEVLPEDQVF 61
              A   +++T  AA H+   +                   G  Y L+ V E   +D +F
Sbjct: 7   QDFAWQGLTLTPAAAIHIRELVAKQPGMVGVRLGV----KQGFGYVLDSVSEPDKDDLLF 62

Query: 62  ETHGIKVIVDPKSLPYIDGTELDFAREGLNEGFKFNNPN 100
           E  G K+ V  +++P+IDGTE+DF REGLN+ FKF+NP 
Sbjct: 63  EHDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPK 101


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0476    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 21,590,641
Number of extensions: 1307428
Number of successful extensions: 14951
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5950
Number of HSP's successfully gapped: 474
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)