RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABF08260.1 rmet0 ABF08260.1 GIB00349CH01 "Sulfate ABC
transporter, permease protein CysW"
         (305 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3dhwA [x.x.x] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN[MAS...    51   4e-09

>3dhwA [x.x.x] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN[MASQUE
           : MEMB(X) 115 / COIL(x) 0]
          Length = 203

 Score = 51.1 bits (123), Expect = 4e-09
 Identities = 10/32 (31%), Positives = 15/32 (46%)

Query: 197 EAAIVLGASGWQTFWHVTLPNIRWGLLYGVIL 228
           EA+  +GA+  Q    V LP    GL+    +
Sbjct: 116 EASRAMGATPMQIVRKVLLPEALPGLVNAATI 147


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0481    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 24,315,756
Number of extensions: 1518319
Number of successful extensions: 19505
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 9282
Number of HSP's successfully gapped: 1209
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)