RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABF09846.1 rmet0 ABF09846.1 GIB00349CH01 "leucyl-tRNA
synthetase"
         (873 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2bteA [x.x.x] LEUCYL-TRNA SYNTHETASE                                  507   e-146
1abbA [c.87.1] GLYCOGEN PHOSPHORYLASE B                               265   3e-73
1c8kA [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)                       238   5e-65
2amvA [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)                       237   9e-65
1axrA [x.x.x] GLYCOGEN PHOSPHORYLASE                                  218   5e-59
3e3nF [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                     212   3e-57
3bjqF [x.x.x] PHAGE-RELATED PROTEIN                                   186   2e-49
2d5bA [x.x.x] METHIONYL-TRNA SYNTHETASE                               179   3e-47
3bjqI [x.x.x] PHAGE-RELATED PROTEIN                                   169   2e-44
2c1wC [x.x.x] ENDOU PROTEIN                                           169   4e-44
2d54A [x.x.x] METHIONYL-TRNA SYNTHETASE                               168   5e-44
2ajgA [x.x.x] LEUCYL-TRNA SYNTHETASE                                  167   9e-44
1a8hA [x.x.x] METHIONYL-TRNA SYNTHETASE                               161   8e-42
2c1wB [x.x.x] ENDOU PROTEIN                                           157   1e-40
1bs2A [d.67.2 - c.26.1 - a.27.1] PROTEIN (ARGINYL-TRNA SYNTHETASE)    156   3e-40
3dpgA [x.x.x] SGRAIR RESTRICTION ENZYME                               153   2e-39
2ajhB [x.x.x] LEUCYL-TRNA SYNTHETASE                                  150   1e-38
2ajgB [x.x.x] LEUCYL-TRNA SYNTHETASE                                  149   3e-38
2bvtA [x.x.x] BETA-1,4-MANNANASE                                      148   4e-38
3c8zB [x.x.x] CYSTEINYL-TRNA SYNTHETASE                               144   1e-36
3c8zA [x.x.x] CYSTEINYL-TRNA SYNTHETASE                               140   2e-35
2ag6A [x.x.x] TYROSYL-TRNA SYNTHETASE                                 139   3e-35
1b80A [a.93.1] PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8)             138   7e-35
2csxA [x.x.x] METHIONYL-TRNA SYNTHETASE                               134   1e-33
2c1fA [x.x.x] BIFUNCTIONAL ENDO-1,4-BETA-XYLANASE A                   133   2e-33
3bicB [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL                 130   1e-32
3bicA [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL                 130   1e-32
3cglD [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483              127   2e-31
2dlcX [x.x.x] TYROSYL-TRNA SYNTHETASE, CYTOPLASMIC                    126   2e-31
2ct8A [x.x.x] METHIONYL-TRNA SYNTHETASE                               126   3e-31
1d2rA [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)                 125   6e-31
3egbB [x.x.x] PROTEIN PELLINO HOMOLOG 2                               119   4e-29
3e3nB [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                     112   6e-27
3cglC [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483              111   7e-27
2aelB [x.x.x] TRICHODIENE SYNTHASE                                    111   9e-27
1cjyB [b.7.1 - c.19.1] PROTEIN (CYTOSOLIC PHOSPHOLIPASE A2)           109   2e-26
2aelA [x.x.x] TRICHODIENE SYNTHASE                                    108   8e-26
3dl5B [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR                           107   2e-25
1bt1A [a.86.1] PROTEIN (CATECHOL OXIDASE)                             106   2e-25
3d6uA [x.x.x] TYROSYL-TRNA SYNTHETASE                                 106   2e-25
2bcvA [x.x.x] DNA POLYMERASE LAMBDA                                   102   5e-24
2aekA [x.x.x] TRICHODIENE SYNTHASE                                    101   6e-24
1ei5A [e.3.1 - b.61.3 - b.61.3] D-AMINOPEPTIDASE                       99   3e-23
3e3nD [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      99   5e-23
3e3nH [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      99   5e-23
3d6vA [x.x.x] TYROSYL-TRNA SYNTHETASE                                  98   7e-23
2azxA [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE                             96   4e-22
3e3nA [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      95   9e-22
1a1xA [x.x.x] HMTCP-1                                                  93   2e-21
2cybB [x.x.x] TYROSYL-TRNA SYNTHETASE                                  92   6e-21
2bcrA [x.x.x] DNA POLYMERASE LAMBDA                                    90   3e-20
3c5fA [x.x.x] DNA POLYMERASE LAMBDA                                    89   4e-20
2bcqA [x.x.x] DNA POLYMERASE LAMBDA                                    89   5e-20
2a6tA [x.x.x] SPAC19A8.12                                              88   8e-20
2e50B [x.x.x] PROTEIN SET                                              88   8e-20
3c98A [e.25.1 (1dn1A)] SYNTAXIN-BINDING PROTEIN 1                      86   3e-19
2c1sA [x.x.x] BIOTIN BINDING PROTEIN A                                 77   2e-16
3cfiJ [x.x.x] TYPE II SECRETORY PATHWAY, PSEUDOPILIN EPSI              74   1e-15
2ab5B [x.x.x] MRNA MATURASE                                            74   2e-15
2arlA [x.x.x] GFP-LIKE NON-FLUORESCENT CHROMOPROTEIN                   73   3e-15
3ecjA [x.x.x] PROTEIN (HOMOPROTOCATECHUATE 2,3-DIOXYGENASE)            73   3e-15
3bjqH [x.x.x] PHAGE-RELATED PROTEIN                                    72   6e-15
2cycA [x.x.x] TYROSYL-TRNA SYNTHETASE                                  72   6e-15
3bjqE [x.x.x] PHAGE-RELATED PROTEIN                                    70   3e-14
3ci0I [x.x.x] PSEUDOPILIN GSPI                                         69   4e-14
2cfoB [x.x.x] GLUTAMYL-TRNA SYNTHETASE                                 67   2e-13
2cfoA [x.x.x] GLUTAMYL-TRNA SYNTHETASE                                 67   2e-13
2an2A [x.x.x] P332G A333S DOUBLE MUTANT OF NITRIC OXIDE                66   3e-13
1b25A [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN OXIDO...    63   3e-12
2cybA [x.x.x] TYROSYL-TRNA SYNTHETASE                                  60   3e-11
2c1qA [x.x.x] BIOTIN BINDING PROTEIN A                                 59   6e-11
3e4cB [x.x.x] CASPASE-1                                                53   3e-09
3e4cA [x.x.x] CASPASE-1                                                42   6e-06
3d5hA [x.x.x] HAEMENTHIN                                               39   5e-05
1bdgA [x.x.x] HEXOKINASE                                               37   3e-04
2crqA [x.x.x] MITOCHONDRIAL TRANSLATIONAL INITIATION FACTOR 3          36   3e-04

>2bteA [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 876

 Score =  507 bits (1307), Expect = e-146
 Identities = 366/853 (42%), Positives = 495/853 (58%), Gaps = 44/853 (5%)

Query: 3   DKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNY 62
           +KY P A+E   Q+ W+     K  +    P G+ K         PYPSG LHMGH++NY
Sbjct: 2   EKYNPHAIEAKWQRFWEEKGFMKAKDL---PGGRGKQYVLVMF--PYPSGDLHMGHLKNY 56

Query: 63  TINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMG 122
           T+ DV+AR+ RM G  VL PMGWDAFG+PAENAAL  GV P  WTY NI   K+ ++ MG
Sbjct: 57  TMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMG 116

Query: 123 LAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVID-GR 181
           +  DW REV TC PEYYRWNQW+FLKM EKG+AYR  G VNW P  QTVLANEQV++   
Sbjct: 117 ILYDWDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVEGRC 176

Query: 182 GWRSGAVVEKREIPMYYLRITDYAQELLGDLEGLGWPERVKIMQQNWIGRSEGVRFAFPH 241
                  VEKRE+  +YLRIT YA+ LL DLEGL WPE+VK MQ+ WIGRSEG    FP 
Sbjct: 177 WRHEDTPVEKRELEQWYLRITAYAERLLKDLEGLNWPEKVKAMQRAWIGRSEGAEILFPV 236

Query: 242 EIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPL--ATHAAESNPALAAFIEECK 299
           E          + ++ VFTTR DT+ G TF  +A EHPL     A E    + A++E  K
Sbjct: 237 E--------GKEVRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAAK 288

Query: 300 HGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGVPAHDERDF 359
             + +E      EK G+  G    +P TGE++ +W  +YVL  YG GA+M VPAHD+RD+
Sbjct: 289 RKTEIERQAEGREKTGVFLGAYALNPATGERIPIWTADYVLFGYGTGAIMAVPAHDQRDY 348

Query: 360 AFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYXXXXXXXXXXX 419
            FA K+ LPIK+VI+  G+       LE    +E G+ ++SG +DG              
Sbjct: 349 EFARKFGLPIKKVIERPGEPLPEP--LE-RAYEEPGIMVNSGPFDGTESEEGKRKVIAWL 405

Query: 420 XXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPE----DLV 475
                 + +VT+RLRDW ISRQRYWGTPIP++HC++CGVVPVPE++LPV+LP+    + +
Sbjct: 406 EEKGLGKGRVTYRLRDWLISRQRYWGTPIPMVHCEACGVVPVPEEELPVLLPDLKDVEDI 465

Query: 476 PDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCP-DAGTMVD-AR 533
                +PL   P F E TCP CG PA+R+TDTMDTF DS WYY+RYT P +     D  +
Sbjct: 466 RPKGKSPLEAHPEFYETTCPKCGGPAKRDTDTMDTFFDSSWYYLRYTDPHNDRLPFDPEK 525

Query: 534 NDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYRE 593
            + WMP+DQYIGG+EHA+LHLLY+RF+TK + D+G+VK +EPF  L TQGMVL  T +  
Sbjct: 526 ANAWMPVDQYIGGVEHAVLHLLYSRFFTKFLHDLGMVKVEEPFQGLFTQGMVLAWTDFGP 585

Query: 594 DASGKKTWYNPADVDVQTDERGRPAGATAKADGQP---------VVIGGIEKMSKSKNNG 644
                     P    ++ +                         + +     MSKSK NG
Sbjct: 586 VEVEGSVVRLPEPTRIRLEIPESALSLEDVRKMGAELRPHEDGTLHLWKPAVMSKSKGNG 645

Query: 645 IDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWNYGYANAQAIR-- 702
           +     + + GAD AR+ ++FAAPPE ++ W+  GV+GA RFL R++     + +A+   
Sbjct: 646 VMVGPFVKEQGADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLET 705

Query: 703 --XXXXXXXXXXXXXLRREIHTVLKQANYDYERIQYNTVVSATMKMLNALEDA--KTASP 758
                          L  ++H  LK+   D E +++NT ++A M+ LNAL +        
Sbjct: 706 SGVFQAEALEGKDRELYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYRKDRPVT 765

Query: 759 AGRREGFSVLLRVLYPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIELVL 818
              R      L++L+P  PH+A  LW           + +A WP++DE AL +  +E+ +
Sbjct: 766 PVYRTAIRYYLQMLFPFAPHLAEELWHWFWPD----SLFEAGWPELDEKALEKDVVEVAV 821

Query: 819 QVNGKVRGSLTVP 831
           QVNG+VRG++ +P
Sbjct: 822 QVNGRVRGTIHIP 834


>1abbA [c.87.1] GLYCOGEN PHOSPHORYLASE B
          Length = 823

 Score =  265 bits (678), Expect = 3e-73
 Identities = 54/629 (8%), Positives = 130/629 (20%), Gaps = 59/629 (9%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGK-LHMGHV 59
               +   A      + +      +           +++     S + YP GK L +   
Sbjct: 231 TMRLWSAKAPNDFNLKDFNVGGYIQAVL--------DRNLAENISRVLYPEGKELRLKQE 282

Query: 60  RN---YTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKK 116
                 T+ D++ R+          P+  +    P + A   N   P+    + +  +  
Sbjct: 283 YFVVAATLQDIIRRFKSS-KFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVD 341

Query: 117 Q-------MQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQ 169
                      + +                RW   L   +L + +         +     
Sbjct: 342 LERLDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVA 401

Query: 170 TVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGL-GWPERVKIMQQNW 228
                +     R         KR    +      +A   +  +          K   +  
Sbjct: 402 AAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELE 461

Query: 229 IGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESN 288
             + +                                 +G  + +   +        +  
Sbjct: 462 PHKFQNKTNGITPRR-------WLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDE 514

Query: 289 PALAAFIEECKHGSVMEADMATME--KKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDG 346
             +    +  +   +  A     E      P  L         +    + N + +     
Sbjct: 515 AFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYN 574

Query: 347 AVMGVPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGL 406
            +   P          +         +        T        D   G  +     +  
Sbjct: 575 RIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENY 634

Query: 407 GYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDL 466
                              EK +        IS      +    +     G + +   D 
Sbjct: 635 RV--------------SLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG 680

Query: 467 PVVLPEDLVPDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDA 526
             V   +   +                                  I      +       
Sbjct: 681 ANVEMAEEAGEENFFIFGMRV-----EDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGF 735

Query: 527 GTMVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEPFT-----NLLT 581
            +      D +  +   +   +   +   Y  +     R   L K    +T     N+ T
Sbjct: 736 FSPKQP--DLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIRNIAT 793

Query: 582 QGMVLNETFYREDASGKKTW-YNPADVDV 609
            G   ++    + A  ++ W   P+   +
Sbjct: 794 SGKFSSDRTIAQYA--REIWGVEPSRQRL 820


>1c8kA [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
          Length = 830

 Score =  238 bits (607), Expect = 5e-65
 Identities = 52/644 (8%), Positives = 121/644 (18%), Gaps = 82/644 (12%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
               +   A      + +      +           +++     S + YP+     G   
Sbjct: 228 TMRLWSAKAPNDFNLKDFNVGGYIQAVL--------DRNLAENISRVLYPNDNFFEGKEL 279

Query: 61  N---------YTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNI 111
                      T+ D++ R+          P+  +    P + A   N   P+    + +
Sbjct: 280 RLKQEYFVVAATLQDIIRRFKSSKF-GCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELM 338

Query: 112 AYMKK-------QMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNW 164
             +         +   + +                RW   L   +L + +         +
Sbjct: 339 RVLVDLERLDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRF 398

Query: 165 DPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEG-LGWPERVKI 223
                     +     R         KR    +      +A   +  +   +      K 
Sbjct: 399 LNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKD 458

Query: 224 MQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATH 283
             +    + +                                           +      
Sbjct: 459 FYELEPHKFQNKTNGITPR--------RWLVLCNPGLAEIIAERIGEEYISDLDQLRKLL 510

Query: 284 AAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTY 343
                       E              ++           H       DV V        
Sbjct: 511 -------SYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKR 563

Query: 344 GDGAVMGVPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKY 403
                + V     R      K+ +P    + + G+A       +          I     
Sbjct: 564 QLLNCLHVITLYNRIKKEPNKFVVPR--TVMIGGKAAPGYHMAKMIIKLIT--AIGDVVN 619

Query: 404 DGLGYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPE 463
                                 EK +        IS      +    +     G + +  
Sbjct: 620 HDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGT 679

Query: 464 KDLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRY-- 521
            D                   +                  + D +D    +   Y     
Sbjct: 680 MDG---------------ANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIP 724

Query: 522 TCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEPFTNLLT 581
                   + +        D +       I+++L      KV  D       +   + L 
Sbjct: 725 ELRQIIEQLSSGFFSPKQPDLF-----KDIVNMLMHHDRFKVFADYEEYVKCQERVSALY 779

Query: 582 QGMVLNETFYRED-------ASGKKT--------WYNPADVDVQ 610
           +           +       +S +             P+   + 
Sbjct: 780 KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLP 823


>2amvA [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
          Length = 829

 Score =  237 bits (605), Expect = 9e-65
 Identities = 42/617 (6%), Positives = 112/617 (18%), Gaps = 82/617 (13%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHV- 59
               +   A      + +      +           +++     S + YP+     G   
Sbjct: 228 TMRLWSAKAPNDFNLKDFNVGGYIQAVL--------DRNLAENISRVLYPNDNFFEGKEL 279

Query: 60  --------RNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNI 111
                      T+ D++ R+ + +      P+  +    P + A   N   P+    + +
Sbjct: 280 RLKQEYFVVAATLQDIIRRF-KSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELM 338

Query: 112 --------AYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVN 163
                       K  +       +            RW   L   +L + +         
Sbjct: 339 RVLVDLERLDWDKAWEVTVKTCAY-TNHTVLPEALERWPVHLLETLLPRHLQIIYEINQR 397

Query: 164 W-------DPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGLG 216
           +        P D   L    +++    +   +        + +         +       
Sbjct: 398 FLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFK 457

Query: 217 WPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAA 276
               ++  +          R             L N G   +   R           +  
Sbjct: 458 DFYELEPHKFQNKTNGITPRRWLV---------LCNPGLAEIIAERIGEEYISDLDQLRK 508

Query: 277 EHPLATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVG 336
                   A          E     +        +              +   +  +   
Sbjct: 509 LLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNC 568

Query: 337 NYVLMTYGDGAVMGVPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGL 396
            +V+  Y             R      K          +     +    +         L
Sbjct: 569 LHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRL 628

Query: 397 CIHSGKYDGLGYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSC 456
            +   +   +                   EK +        IS      +    +     
Sbjct: 629 RVIFLENYRVS----------------LAEKVIPAADLSEQISTAGTEASGTGNMKFMLN 672

Query: 457 GVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCW 516
           G + +   D                                G+            +D   
Sbjct: 673 GALTIGTMD----------------------GANVEMAEEAGEENFFIFGMRVEDVDRLD 710

Query: 517 YYMRYTCPDA-GTMVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEP 575
                            +    +    +          ++         +     +    
Sbjct: 711 QRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVK 770

Query: 576 FTNLLTQGMVLNETFYR 592
               ++        + R
Sbjct: 771 CQERVSALYKNPREWTR 787


>1axrA [x.x.x] GLYCOGEN PHOSPHORYLASE
          Length = 829

 Score =  218 bits (555), Expect = 5e-59
 Identities = 52/659 (7%), Positives = 133/659 (20%), Gaps = 89/659 (13%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDG-KEKSKFYACSMLPYPSGKLHMGHV 59
              +       +            K            +++     S + YP+     G  
Sbjct: 218 PGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKE 277

Query: 60  ---------RNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDN 110
                       T+ D++ R+ + +      P+  +    P + A   N   P+    + 
Sbjct: 278 LRLKQEYFVVAATLQDIIRRF-KSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPEL 336

Query: 111 IAYMKKQMQS-------MGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGT-- 161
           +  +    +        + +                RW   L   +L + +         
Sbjct: 337 MRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQR 396

Query: 162 -----VNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGL- 215
                    P D   L    +++    +   +        + +         +       
Sbjct: 397 FLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFK 456

Query: 216 GWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVA 275
            + E      QN        R+           ++I +     + +  D +  +      
Sbjct: 457 DFYELEPHKFQNKTNGITPRRWLVLCNPG--LAEIIAERIGEEYISDLDQLRKLLSYVDD 514

Query: 276 AEHPLATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWV 335
                     +    L       +   V     +                +   +  +  
Sbjct: 515 EAFIRDVAKVKQENKLKFAAYLEREYKVHINPNS--------LFDVQVKRIHEYKRQLLN 566

Query: 336 GNYVLMTYGDGAVMGVPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHG 395
             +V+  Y             R      K          +     +    +         
Sbjct: 567 CLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDR 626

Query: 396 LCIHSGKYDGLGYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDS 455
           L +   +   +                   EK +        IS      +    +    
Sbjct: 627 LRVIFLENYRVS----------------LAEKVIPAADLSEQISTAGTEASGTGNMKFML 670

Query: 456 CGVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSC 515
            G + +   D                   +                  + D +D    + 
Sbjct: 671 NGALTIGTMD---------------GANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNA 715

Query: 516 WYYMRY--TCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFD 573
             Y             + +        D +       I+++L      KV  D       
Sbjct: 716 QEYYDRIPELRQIIEQLSSGFFSPKQPDLF-----KDIVNMLMHHDRFKVFADYEEYVKC 770

Query: 574 EPFTNLLTQGMVLNETFYREDA--------------SGKKTW-YNPADVDVQTDERGRP 617
           +   + L +           +                 ++ W   P+   +   +   P
Sbjct: 771 QERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKIP 829


>3e3nF [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 812

 Score =  212 bits (539), Expect = 3e-57
 Identities = 44/594 (7%), Positives = 112/594 (18%), Gaps = 46/594 (7%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
                +P        ++         S                 ++    S  L+   +R
Sbjct: 212 QVVLAMPYDTPVPGYRNNVVNTMRLWSAK---APNGYIQAVLDRNLAENISRVLYGKELR 268

Query: 61  N--------YTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIA 112
                     T+ D++ R+ + +      P+  +    P + A   N   P+    + + 
Sbjct: 269 LKQEYFVVAATLQDIIRRF-KSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMR 327

Query: 113 YMKKQMQSM-------GLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWD 165
            +    +          +                RW   L   +L + +         + 
Sbjct: 328 VLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFL 387

Query: 166 PVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGL-GWPERVKIM 224
                    +     R         KR    +      +A   +  +          K  
Sbjct: 388 NRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDF 447

Query: 225 QQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHA 284
            +    + +                                           +      +
Sbjct: 448 YELEPHKFQNKTNGITPRRW--------LVLCNPGLAEIIAERIGEEYISDLDQLRKLLS 499

Query: 285 AESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYG 344
              + A    + + K  + ++       +          H       DV V         
Sbjct: 500 YVDDEAFIRDVAKVKQENKLKFAAYLEREYK-------VHINPNSLFDVQVKRIHEYKRQ 552

Query: 345 DGAVMGVPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYD 404
               + V     R      K+ +P   +I       +   +       +    I      
Sbjct: 553 LLNCLHVITLYNRIKKEPNKFVVPRTVMI----GGKAAPGYHMAKMIIKLITAIGDVVNH 608

Query: 405 GLGYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEK 464
                                EK +        IS      +    +   +  +      
Sbjct: 609 DPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMD 668

Query: 465 DLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCP 524
              V + E+   +     +              G  A+   D +                
Sbjct: 669 GANVEMAEEAGEE--NFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFS 726

Query: 525 DAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEPFTN 578
                    + +   ++  +      +          +           E    
Sbjct: 727 P-----KQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRM 775


>3bjqF [x.x.x] PHAGE-RELATED PROTEIN
          Length = 290

 Score =  186 bits (473), Expect = 2e-49
 Identities = 26/355 (7%), Positives = 61/355 (17%), Gaps = 98/355 (27%)

Query: 54  LHMGHVRNYTINDVMARYLRM--NGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNI 111
              G+ ++  I   +     +   G  +L   G +AF +     A               
Sbjct: 12  HARGYRQSTLIGKKLFPVAPVAQYGGKIL-TFGKEAFRLYNTKRAPGANT---------- 60

Query: 112 AYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTV 171
               K++        +S   +    +                   R    V    +    
Sbjct: 61  ----KRIDFGYEGDPYSIVPSALEAKV--------------PRELRDASQVPGIDLGARS 102

Query: 172 LANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGLGWPERVKIMQQNWIGR 231
                                 +    L       ++  D       +    +  +    
Sbjct: 103 -------------------VNTVLRIALAHEHECAQIALDPA-KYNADHKVKLVGSARWT 142

Query: 232 SEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESNPAL 291
           S         E             +       + ++     +    HP          A 
Sbjct: 143 SPDSDPTKDVETA--------KEAIADSIGEPNRLLSRKALSACKYHPKLIEITIDLKA- 193

Query: 292 AAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGV 351
                               E + +  G                       +G    +G 
Sbjct: 194 ------------------LWEVEEIVVGTARVATD-----------SFGDVWGPDVWLGY 224

Query: 352 PAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGL 406
            + +         +    +       +    D          +      G  D  
Sbjct: 225 VSDNPDPSVEEPSFGYTYQIEGHPLVEVPYWD---------NNAKSWIYGVSDDN 270


>2d5bA [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 500

 Score =  179 bits (454), Expect = 3e-47
 Identities = 54/334 (16%), Positives = 107/334 (32%), Gaps = 16/334 (4%)

Query: 38  KSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAAL 97
           +  FY  + + Y + + H+GH     + D +AR+ R++G       G D  G     AA 
Sbjct: 2   EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQ 61

Query: 98  NNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYR 157
             G  P A+        K+    +G  I +   + T    + +  Q +  K+ E G  Y 
Sbjct: 62  AAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYY 119

Query: 158 KTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGL-- 215
                 +    +     +++++G     G  VE+R+   Y+ R+  Y   L   ++    
Sbjct: 120 GEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPD 179

Query: 216 -GWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAV 274
              PE  +      +    G       + +   G  +   + +V     D    +     
Sbjct: 180 LIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDENHVTFVWFD---ALLNYVS 236

Query: 275 AAEHPLATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTH-----PLTGE 329
           A ++P         P     I +             ++  G+P    +          G 
Sbjct: 237 ALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGR 296

Query: 330 QVDVWVGNYVLMTYGDGAVMGVPAHDERDFAFAL 363
           ++   +GN V        +        R +    
Sbjct: 297 KMSKTLGNVVDPFA---LLEKYGRDALRYYLLRE 327



 Score = 87.7 bits (216), Expect = 1e-19
 Identities = 51/345 (14%), Positives = 91/345 (26%), Gaps = 74/345 (21%)

Query: 491 ECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHA 550
           +   P        E      + D+   Y+                 + P   ++ G +  
Sbjct: 207 KSRVPWGIPLPWDENHVTFVWFDALLNYVSALDY----PEGEAYRTFWPHAWHLIGKDIL 262

Query: 551 ILHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQ 610
             H   A FW  +++  G       + +L   G +L                        
Sbjct: 263 KPH---AVFWPTMLKAAG----IPMYRHLNVGGFLLGP---------------------- 293

Query: 611 TDERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPE 670
                         DG+        KMSK+  N +DP AL+++YG D  R +++   P  
Sbjct: 294 --------------DGR--------KMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYG 331

Query: 671 QQLEWSGSGVEGASR--FLRRVWN-YGYANAQAIRXXXXXXXXXXXXXLRREIHTVLKQA 727
           Q    S   +           + N      A   R                E   +  + 
Sbjct: 332 QDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRL 391

Query: 728 NYDYERIQYNTVVSATMKMLNAL----------------EDAKTASPAGRREGFSVLLRV 771
                 ++++  +   M  + AL                 +   A      EG  +   +
Sbjct: 392 RPLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKEPEEARAVLYRVVEGLRIASIL 451

Query: 772 LYPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIEL 816
           L P +P     L + LG   E        W   +   +      L
Sbjct: 452 LTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIPEEAPVL 496


>3bjqI [x.x.x] PHAGE-RELATED PROTEIN
          Length = 287

 Score =  169 bits (430), Expect = 2e-44
 Identities = 31/334 (9%), Positives = 61/334 (18%), Gaps = 66/334 (19%)

Query: 73  RMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVA 132
                     +        A  A               I    K+   +        +  
Sbjct: 11  THARGYRQSTLIGKKLFPVAPVA----------QYGGKILTFGKEAFRLYNTKRT--KRI 58

Query: 133 TCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKR 192
               E   ++        +     R    V    +    +     I              
Sbjct: 59  DFGYEGDPYSIVPSALEAKVPRELRDASQVPGIDLGARSVNTVLRIALAHEHEC------ 112

Query: 193 EIPMYYLRITDYAQELLGDLEGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLIN 252
                 L    Y              +    +  +    S         E          
Sbjct: 113 --AQIALDPAKY------------NADHKVKLVGSARWTSPDSDPTKDVETA-------- 150

Query: 253 DGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESNPALAAFIEECKHGSVMEADMATME 312
              +       + ++     +    HP           L A  E  +             
Sbjct: 151 KEAIADSIGEPNRLLSRKALSACKYHPKLIERVSITIDLKALWEVEEIV----------- 199

Query: 313 KKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGVPAHDERDFAFALKYNLPIKQV 372
                     T  +     DVW  +        G V   P     + +F   Y +    +
Sbjct: 200 --------VGTARVATSFGDVWGPDV-----WLGYVSDNPDPSVEEPSFGYTYQIEGHPL 246

Query: 373 IDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGL 406
           ++V     +  +W+      +      SG    L
Sbjct: 247 VEVPYWDNNAKSWIYGV--SDDNTPALSGLAGYL 278


>2c1wC [x.x.x] ENDOU PROTEIN
          Length = 271

 Score =  169 bits (428), Expect = 4e-44
 Identities = 26/285 (9%), Positives = 57/285 (20%), Gaps = 46/285 (16%)

Query: 5   YLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTI 64
            L   + +   + W A                 K    +               V    +
Sbjct: 2   QLNHELSKLFNELWDADQNRMK---------SGKDYRISLQGKAGYVSFPLFQFVDEEKL 52

Query: 65  N--DVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMG 122
                 A ++ +   N  M  G      P E A  NN +     T          M+   
Sbjct: 53  KSRKTFATFISLLD-NYEMDTGVAEVVTPEEIAENNNFLDAILETK--------VMKMAH 103

Query: 123 LAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRG 182
             +    +      ++      ++ ++  +    R                 ++      
Sbjct: 104 DYLVRKNQAKPTRNDFKVQLYNIWFQLYSRAPGSRPDSCGFEHVFVGESKRGQE------ 157

Query: 183 WRSGAVVEKREIPMYYLRITDYAQELLGDLEGL------GWPERVKIMQQNWIGRSEGVR 236
                 +      + +                          ++V  +Q NW    + V 
Sbjct: 158 ------MMGLHNWVQFYLQEKRKNIDYKGYVARQNKSRPDEDDQVLNLQFNWKEMVKPVG 211

Query: 237 FAFPHEIKGADGKLI--------NDGKLYVFTTRADTIMGVTFCA 273
            +F       +  L               V       +  V    
Sbjct: 212 SSFIGVSPEFEFALYTIVFLASQEKMSREVVRLEEYELQIVVNRH 256


>2d54A [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 500

 Score =  168 bits (426), Expect = 5e-44
 Identities = 55/314 (17%), Positives = 107/314 (34%), Gaps = 13/314 (4%)

Query: 38  KSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAAL 97
           +  FY  + + Y + + H+GH     + D +AR+ R++G       G D  G     AA 
Sbjct: 2   EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQ 61

Query: 98  NNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYR 157
             G  P A+        K+    +G  I +   + T    + +  Q +  K+ E G  Y 
Sbjct: 62  AAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYY 119

Query: 158 KTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYA---QELLGDLEG 214
                 +    +     +++++G     G  VE+R+   Y+ R+  Y    QE + +   
Sbjct: 120 GEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPD 179

Query: 215 LGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAV 274
           L  PE  +      +    G       + +   G  +   + +V     D ++       
Sbjct: 180 LIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDENHVTAVWFDALLNYVS--- 236

Query: 275 AAEHPLATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVT-----HPLTGE 329
           A ++P         P     I +             ++  G+P    +          G 
Sbjct: 237 ALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGR 296

Query: 330 QVDVWVGNYVLMTY 343
           ++   +GN V    
Sbjct: 297 KMSKTLGNVVDPFA 310



 Score = 83.1 bits (204), Expect = 3e-18
 Identities = 49/349 (14%), Positives = 88/349 (25%), Gaps = 74/349 (21%)

Query: 487 PRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGG 546
               +   P        E      + D+   Y+                 + P   ++ G
Sbjct: 203 ISRPKSRVPWGIPLPWDENHVTAVWFDALLNYVSAL----DYPEGEAYRTFWPHAWHLIG 258

Query: 547 IEHAILHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPAD 606
            +    H   A FW  +++  G       + +L   G +L                    
Sbjct: 259 KDILKPH---AVFWPTMLKAAG----IPMYRHLNVGGFLLGPDG---------------- 295

Query: 607 VDVQTDERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFA 666
                                        KMSK+  N +DP AL+++YG D  R +++  
Sbjct: 296 ----------------------------RKMSKTLGNVVDPFALLEKYGRDALRYYLLRE 327

Query: 667 APPEQQLEWSGSGVEGASR--FLRRVWN-YGYANAQAIRXXXXXXXXXXXXXLRREIHTV 723
            P  Q    S   +           + N      A   R                E   +
Sbjct: 328 IPYGQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGL 387

Query: 724 LKQANYDYERIQYNTVVSATMKMLNAL----------------EDAKTASPAGRREGFSV 767
             +       ++++  +   M  + AL                 +   A      EG  +
Sbjct: 388 AGRLRPLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKEPEEARAVLYRVVEGLRI 447

Query: 768 LLRVLYPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIEL 816
              +L P +P     L + LG   E        W   +   +      L
Sbjct: 448 ASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIPEEAPVL 496


>2ajgA [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 186

 Score =  167 bits (425), Expect = 9e-44
 Identities = 89/174 (51%), Positives = 109/174 (62%), Gaps = 11/174 (6%)

Query: 233 EGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESNPALA 292
           EGV   F   +   D  L       V+TTR DT MG T+ AVAA HPLA  AAE+NP LA
Sbjct: 1   EGVEITFN--VNDYDNTLT------VYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELA 52

Query: 293 AFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGVP 352
           AFI+EC++  V EA+MATMEKKG+ TG K  HPLTGE++ VW  N+VLM YG GAVM VP
Sbjct: 53  AFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVP 112

Query: 353 AHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGL 406
            HD+RD+ FA KY L IK VI     +      L      E G+  +SG+++GL
Sbjct: 113 GHDQRDYEFASKYGLNIKPVILAADGSEPD---LSQQALTEKGVLFNSGEFNGL 163


>1a8hA [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 500

 Score =  161 bits (407), Expect = 8e-42
 Identities = 54/314 (17%), Positives = 106/314 (33%), Gaps = 13/314 (4%)

Query: 38  KSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAAL 97
           +  FY  + + Y + + H+GH     + D +AR+ R++G       G D  G     AA 
Sbjct: 2   EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQ 61

Query: 98  NNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYR 157
             G  P A+        K+    +G  I +   + T    + +  Q +  K+ E G  Y 
Sbjct: 62  AAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYY 119

Query: 158 KTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRIT---DYAQELLGDLEG 214
                 +    +     +++++G     G  VE+R+   Y+ R+     + QE + +   
Sbjct: 120 GEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPD 179

Query: 215 LGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAV 274
           L  PE  +      +    G       + +   G  +   + +V     D    +     
Sbjct: 180 LIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDENHVTYVWFD---ALLNYVS 236

Query: 275 AAEHPLATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHP-----LTGE 329
           A ++P         P     I +             ++  G+P    +          G 
Sbjct: 237 ALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGR 296

Query: 330 QVDVWVGNYVLMTY 343
           ++   +GN V    
Sbjct: 297 KMSKTLGNVVDPFA 310



 Score = 90.8 bits (224), Expect = 1e-20
 Identities = 46/345 (13%), Positives = 84/345 (24%), Gaps = 74/345 (21%)

Query: 491 ECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHA 550
           +   P        E      + D+   Y+                 + P   ++ G +  
Sbjct: 207 KSRVPWGIPLPWDENHVTYVWFDALLNYVSALDY----PEGEAYRTFWPHAWHLIGKDIL 262

Query: 551 ILHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQ 610
             H ++     K             + +L   G +L                        
Sbjct: 263 KPHAVFWPTMLKAA-------GIPMYRHLNVGGFLLGPDG-------------------- 295

Query: 611 TDERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPE 670
                                    KMSK+  N +DP AL+++YG D  R +++   P  
Sbjct: 296 ------------------------RKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYG 331

Query: 671 QQLEWSGSGVEGASR--FLRRVWN-YGYANAQAIRXXXXXXXXXXXXXLRREIHTVLKQA 727
           Q    S   +           + N      A   R                E   +  + 
Sbjct: 332 QDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRL 391

Query: 728 NYDYERIQYNTVVSATMKMLNAL----------------EDAKTASPAGRREGFSVLLRV 771
                 ++++  +   M  + AL                 +   A      EG  +   +
Sbjct: 392 RPLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKEPEEARAVLYRVVEGLRIASIL 451

Query: 772 LYPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIEL 816
           L P +P     L + LG   E        W   +   +      L
Sbjct: 452 LTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIPEEAPVL 496


>2c1wB [x.x.x] ENDOU PROTEIN
          Length = 276

 Score =  157 bits (398), Expect = 1e-40
 Identities = 29/299 (9%), Positives = 63/299 (21%), Gaps = 46/299 (15%)

Query: 6   LPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTIN 65
           L   + +   + W A      S           S       +P  S  L          +
Sbjct: 3   LNHELSKLFNELWDADQNRMKSGKDY-----RISLQGKAGYVPSASFPLFQFVDEEKLKS 57

Query: 66  DVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAI 125
                       N  M  G      P E A  NN +     T          M+     +
Sbjct: 58  RKTFATFISLLDNYEMDTGVAEVVTPEEIAENNNFLDAILETK--------VMKMAHDYL 109

Query: 126 DWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGWRS 185
               +      ++      ++ ++  +    R                 ++++    W  
Sbjct: 110 VRKNQAKPTRNDFKVQLYNIWFQLYSRAPGSRPDSCGFEHVFVGESKRGQEMMGLHNW-- 167

Query: 186 GAVVEKREIPMYYLRITDYAQELL------GDLEGLGWPERVKIMQQNWIGRSEGVRFAF 239
                     + +                  +       ++V  +Q NW    + V  +F
Sbjct: 168 ----------VQFYLQEKRKNIDYKGYVARQNKSRPDEDDQVLNLQFNWKEMVKPVGSSF 217

Query: 240 PHEIKGADGKLI----------NDGKLYVFTTRADTIMGVTFC---AVAAEHPLATHAA 285
                  + +                  V       +  V       +   +P+     
Sbjct: 218 I--GVSPEFEFALYTIVFLASQEKMSREVVRLEEYELQIVVNRHGRYIGTAYPVLLSTN 274


>1bs2A [d.67.2 - c.26.1 - a.27.1] PROTEIN (ARGINYL-TRNA SYNTHETASE)
          Length = 603

 Score =  156 bits (393), Expect = 3e-40
 Identities = 30/290 (10%), Positives = 61/290 (21%), Gaps = 16/290 (5%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
           +Q  + P  + +              S         E  K       P  +   H GH+R
Sbjct: 106 IQFFFNPQFLAKLVIPDILTRKEDYGSC-----KLVENKKVIIEFSSPNIAKPFHAGHLR 160

Query: 61  NYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAA--LNNGVAPAAWTYDNIAYMKKQM 118
           +  I   +A      G  V+       +G      A          A   D I ++    
Sbjct: 161 STIIGGFLANLYEKLGWEVIRMNYLGDWGKQFGLLAVGFERYGNEEALVKDPIHHLFDVY 220

Query: 119 QSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQV- 177
             +   I+   +            +  F +M +      K      +   +  +      
Sbjct: 221 VRINKDIEEEGDSIPLEQSTNGKAREYFKRMEDGDEEALKIWKRFREFSIEKYIDTYARL 280

Query: 178 -IDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGLGWPERVKIMQQNWIGRSEGVR 236
            I    +   + V K  +        +           L    +        I       
Sbjct: 281 NIKYDVYSGESQVSKESMLKAIDLFKEKGLTHEDKGAVLIDLTKFNKKLGKAI------- 333

Query: 237 FAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAE 286
                       + +            D ++ V                +
Sbjct: 334 VQKSDGTTLYLTRDVGAAMDRYEKYHFDKMIYVIASQQDLHAAQFFEILK 383


>3dpgA [x.x.x] SGRAIR RESTRICTION ENZYME
          Length = 338

 Score =  153 bits (386), Expect = 2e-39
 Identities = 31/269 (11%), Positives = 62/269 (23%), Gaps = 20/269 (7%)

Query: 34  DGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAE 93
           +   +    A         +L   ++  YT  +V+  +    G N +     D  G P E
Sbjct: 16  ERCIQDIRNAPVRNRSTQFQLAQQNMLAYTFGEVIPGFASA-GINGMDYR--DVIGRPVE 72

Query: 94  NAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKG 153
           N A+  G       +   +  K ++      I  S  +  C+  +      +  +     
Sbjct: 73  N-AVTEGTHFFRDDFRVDSNAKAKVAGDIFEIVSSAVMWNCAARWN---SLMVGEGWRSQ 128

Query: 154 IAYRKTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLE 213
             Y +                  +     W S  V E +E+   +          L    
Sbjct: 129 PRYSRPTLSPSPRRQVA---VLNLPRSFDWVSLLVPESQEVIEEFRAGLRKDGLGLPTST 185

Query: 214 GLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVT--- 270
                  +    QN     E +               I     Y           ++   
Sbjct: 186 PDLAVVVLPEEFQNDEMWREEIAGLTRPN-------QILLSGAYQRLQGRVQPGEISLAV 238

Query: 271 FCAVAAEHPLATHAAESNPALAAFIEECK 299
               +               +   +E   
Sbjct: 239 AFKRSLRSDRLYQPLYEANVMQLLLEGKL 267


>2ajhB [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 175

 Score =  150 bits (380), Expect = 1e-38
 Identities = 84/174 (48%), Positives = 102/174 (58%), Gaps = 21/174 (12%)

Query: 233 EGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESNPALA 292
           EGV   F   +   D  L       V+TTR DT MG T+ AVAA HPLA  AAE+NP LA
Sbjct: 1   EGVEITFN--VNDYDNTLT------VYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELA 52

Query: 293 AFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGVP 352
           AFI+EC+          TMEKKG+ TG K  HPLTGE++ VW  N+VLM YG GAVM VP
Sbjct: 53  AFIDECR----------TMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVP 102

Query: 353 AHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGL 406
            HD+RD+ FA KY L IK VI         D   +     E G+  +SG+++GL
Sbjct: 103 GHDQRDYEFASKYGLNIKPVILAAD-GSEPDLSQQAL--TEKGVLFNSGEFNGL 153


>2ajgB [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 174

 Score =  149 bits (377), Expect = 3e-38
 Identities = 82/174 (47%), Positives = 101/174 (58%), Gaps = 22/174 (12%)

Query: 233 EGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESNPALA 292
           EGV   F   +   D  L       V+TTR DT MG T+ AVAA HPLA  AAE+NP LA
Sbjct: 1   EGVEITFN--VNDYDNTLT------VYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELA 52

Query: 293 AFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGVP 352
           AFI+EC++           EKKG+ TG K  HPLTGE++ VW  N+VLM YG GAVM VP
Sbjct: 53  AFIDECRN-----------EKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVP 101

Query: 353 AHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGL 406
            HD+RD+ FA KY L IK VI         D   +     E G+  +SG+++GL
Sbjct: 102 GHDQRDYEFASKYGLNIKPVILAAD-GSEPDLSQQAL--TEKGVLFNSGEFNGL 152


>2bvtA [x.x.x] BETA-1,4-MANNANASE
          Length = 451

 Score =  148 bits (375), Expect = 4e-38
 Identities = 28/421 (6%), Positives = 66/421 (15%), Gaps = 98/421 (23%)

Query: 323 THPLTGEQVD--VWVGNYVLMTYGDGAVMGVPAHDERDFAFALKYNLPIKQVIDVKGQAY 380
              +  +       + +Y+    G+G +          F             +      +
Sbjct: 2   IAIVDADATAETRSLLSYLDGVRGEGIL--FGHQHTTSFGLTTGPTDGTTSDVKNVTGDF 59

Query: 381 STDAWLEWY--GDKEHGLCIHSGKYDGLGYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGI 438
                 +       E      + + + +                         +    G 
Sbjct: 60  PAVFGWDTLIIEGNERPGLAENTRDENI-----------------ALFADYIRKADAIGG 102

Query: 439 SRQRYWGTPIPLIHCDSCGVVPVPEKDLPV-----------------VLPEDLVPDGTGN 481
                      +             + +                   +       DGT  
Sbjct: 103 VNTVSAHVENFVTGGSFYDTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLI 162

Query: 482 PLAKDPRFLECTCPSCGKPA-------------RRETDTMDTFIDSCWYYMRYTCPDAGT 528
           P+   P             A               E       + +  Y   +       
Sbjct: 163 PIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYA--WGPGGGFG 220

Query: 529 MVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDE-PFTNLLTQGMVLN 587
                     P D ++  +         +  +   +     +  +       +       
Sbjct: 221 GNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKV------- 273

Query: 588 ETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDP 647
                                    E G   G                K+  +       
Sbjct: 274 ---------------------SAFTEFGVSGGVGTNGSS---PAQWFTKVLAAIKADPVA 309

Query: 648 QALI---DQYGADTARLFVM---FAAPPEQQLEWSGSGVEGASRFLRRVWNYGYANAQAI 701
                       D  + FV     A   + Q   +         F   V    +    A 
Sbjct: 310 SRNAYMETWANFDAGQHFVPVPGDALLEDFQAYAADPFT----LFASEVTGA-FDRTVAA 364

Query: 702 R 702
            
Sbjct: 365 A 365


>3c8zB [x.x.x] CYSTEINYL-TRNA SYNTHETASE
          Length = 401

 Score =  144 bits (363), Expect = 1e-36
 Identities = 29/225 (12%), Positives = 52/225 (23%), Gaps = 4/225 (1%)

Query: 4   KYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYT 63
           +   +           A+  +  ++  V P                P    H+GH   Y 
Sbjct: 4   QSWSAPAIPVVPGRGPALRLFDSADRQVRPVTPGP-TATMYVCGITPYDATHLGHAATYL 62

Query: 64  INDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGL 123
             D++ R     G  V           P    A  +G+             ++ M ++ +
Sbjct: 63  TFDLVHRLWLDAGHTVQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRV 122

Query: 124 AIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGW 183
                   AT   +       +  K+L  G AY        D   +     +   +    
Sbjct: 123 LPPHDYVAAT---DAIAEVVEMVEKLLASGAAYIVEDAEYPDVYFRADATAQFGYESGYD 179

Query: 184 RSGAVVEKREIPMYYLRITDYAQELLGDLEGLGWPERVKIMQQNW 228
           R   +    E      R     Q            E         
Sbjct: 180 RDTMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEPSWPSPFGR 224



 Score = 47.3 bits (111), Expect = 2e-07
 Identities = 21/266 (7%), Positives = 47/266 (17%), Gaps = 71/266 (26%)

Query: 492 CTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAI 551
                      R     +    S +   R       + +         +D   GG +   
Sbjct: 198 GKSDQLDALLWRAERPGEPSWPSPFGRGRPGWHVECSAIA-LTRIGTGLDIQGGGSDLIF 256

Query: 552 LHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQT 611
            H  Y+    + +        +  F        ++                         
Sbjct: 257 PHHEYSAAHAESVTG------ERRFARHYVHTGMIGVLVS-------------------- 290

Query: 612 DERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQ 671
                                   ++                      RL +       +
Sbjct: 291 ------------------------QLRAQG------------VDPSAIRLGLFS-GHYRE 313

Query: 672 QLEWSGSGVEGASRFLRRVWN-----YGYANAQAI-RXXXXXXXXXXXXXLRREIHTVLK 725
              WS   ++ A+  L R  +             I R                 +     
Sbjct: 314 DRFWSNEVLDEANARLARWRSATALPEAPDATDVIARVRQYLADDLDTPKALAALDGWCT 373

Query: 726 QANYDYERIQYNTVV-SATMKMLNAL 750
            A         +  + + T+  L  +
Sbjct: 374 DALSYGGHDTESPRLVATTVDALLGV 399


>3c8zA [x.x.x] CYSTEINYL-TRNA SYNTHETASE
          Length = 399

 Score =  140 bits (352), Expect = 2e-35
 Identities = 26/195 (13%), Positives = 49/195 (25%), Gaps = 4/195 (2%)

Query: 4   KYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYT 63
           +   +           A+  +  ++  V P                P    H+GH   Y 
Sbjct: 2   QSWSAPAIPVVPGRGPALRLFDSADRQVRPVTPGP-TATMYVCGITPYDATHLGHAATYL 60

Query: 64  INDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGL 123
             D++ R     G  V           P    A  +G+             ++ M ++ +
Sbjct: 61  TFDLVHRLWLDAGHTVQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRV 120

Query: 124 AIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGW 183
                   AT   +       +  K+L  G AY        D   +     +   +    
Sbjct: 121 LPPHDYVAAT---DAIAEVVEMVEKLLASGAAYIVEDAEYPDVYFRADATAQFGYESGYD 177

Query: 184 RSGAVVEKREIPMYY 198
           R   +    E     
Sbjct: 178 RDTMLTLFAERGGDP 192



 Score = 52.0 bits (123), Expect = 6e-09
 Identities = 19/255 (7%), Positives = 43/255 (16%), Gaps = 70/255 (27%)

Query: 492 CTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAI 551
                      R     +    S +   R       + +         +D   GG +   
Sbjct: 196 GKSDQLDALLWRAERPGEPSWPSPFGRGRPGWHVECSAIA-LTRIGTGLDIQGGGSDLIF 254

Query: 552 LHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQT 611
            H  Y+    + +        +  F        ++                         
Sbjct: 255 PHHEYSAAHAESVTG------ERRFARHYVHTGMIGVLV--------------------- 287

Query: 612 DERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQ 671
                                   ++                      RL +  +    +
Sbjct: 288 -----------------------SQLRAQG------------VDPSAIRLGLF-SGHYRE 311

Query: 672 QLEWSGSGVEGASRFLRRVWN-----YGYANAQAI-RXXXXXXXXXXXXXLRREIHTVLK 725
              WS   ++ A+  L R  +             I R                 +     
Sbjct: 312 DRFWSNEVLDEANARLARWRSATALPEAPDATDVIARVRQYLADDLDTPKALAALDGWCT 371

Query: 726 QANYDYERIQYNTVV 740
            A         +  +
Sbjct: 372 DALSYGGHDTESPRL 386


>2ag6A [x.x.x] TYROSYL-TRNA SYNTHETASE
          Length = 307

 Score =  139 bits (350), Expect = 3e-35
 Identities = 38/308 (12%), Positives = 78/308 (25%), Gaps = 29/308 (9%)

Query: 7   PSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTIND 66
              + +        I   ++ E       ++ +          PSGK+H+GH        
Sbjct: 3   EFEMIKRNTSEI--ISEEELREVLK--KDEKSALIG-----FEPSGKIHLGH-------- 45

Query: 67  VMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAID 126
               YL++     L   G+D   + A+  A  N             Y KK  ++MGL   
Sbjct: 46  ----YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYNKKVFEAMGLKAK 101

Query: 127 WSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANE----QVIDGRG 182
           +    +    + Y  N +          A R    +  +  +  V        QV     
Sbjct: 102 YVYGSSFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNPLHY 161

Query: 183 WRSGAVVEKREIPMYYLRITDYAQELLGDL--EGLGWPERVKIMQQNWIGRSEGVRFAFP 240
                 V   E    ++   +   + +  +    L   +    M  +             
Sbjct: 162 EGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEE 221

Query: 241 HEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESNPALAAFIEECKH 300
              K           +       +         +  + P       +  +        K+
Sbjct: 222 IRAKIKKAYCPAG--VVEGNPIMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKN 279

Query: 301 GSVMEADM 308
             +   D+
Sbjct: 280 KELHPMDL 287



 Score = 42.3 bits (98), Expect = 6e-06
 Identities = 9/58 (15%), Positives = 17/58 (29%)

Query: 636 KMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWNY 693
           KMS SK N I      ++  A   + +          +             ++R   +
Sbjct: 204 KMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRPEKF 261


>1b80A [a.93.1] PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8)
          Length = 348

 Score =  138 bits (348), Expect = 7e-35
 Identities = 17/221 (7%), Positives = 36/221 (16%), Gaps = 43/221 (19%)

Query: 431 WRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPE----DLVPDGTGNPLAKD 486
                       + G           G+VP P   +  ++          +     +   
Sbjct: 122 LSNCPGAPQMNFFTGRAPA-TQPAPDGLVPEPFHTVDQIINRVNDAGEFDELE-LVMLSA 179

Query: 487 PRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYT-CPDAGTMVDA-------RNDYWM 538
                               T   F    +   +       G+  +          +  +
Sbjct: 180 HSVAAVNDVDPTVQGLPFDSTPGIFDSQFFVETQLRGTAFPGSGGNQGEVESPLPGEIRI 239

Query: 539 PMDQ--YIGGIEHAILHL------LYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETF 590
             D                          +  +   +           L      +    
Sbjct: 240 QSDHTIARDSRTACEWQSFVNNQSKLVDDFQFIFLALT---------QLGQDPNAM---- 286

Query: 591 YREDASGKKTWYNPADVDVQT--DERGRPAGATAKADGQPV 629
                    +   P    +         PAG T K   Q  
Sbjct: 287 ------TDCSDVIPQSKPIPGNLPFSFFPAGKTIKDVEQAC 321


>2csxA [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 464

 Score =  134 bits (337), Expect = 1e-33
 Identities = 34/209 (16%), Positives = 71/209 (33%), Gaps = 5/209 (2%)

Query: 34  DGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAE 93
              +K  FY  + + Y +   H+GH       D +ARY R+   +V    G D  G+  +
Sbjct: 2   TLMKK--FYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQ 59

Query: 94  NAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKG 153
             A   G++P      N    KK  + +   I++++ + T  P + ++ Q +F +  ++G
Sbjct: 60  KKAEELGISPKELVDRNAERFKKLWEFLK--IEYTKFIRTTDPYHVKFVQKVFEECYKRG 117

Query: 154 IAYRKTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDL- 212
             Y             +   ++ +            + R   +            +    
Sbjct: 118 DIYLGEYKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPR 177

Query: 213 EGLGWPERVKIMQQNWIGRSEGVRFAFPH 241
             + W   V    ++ I       F +  
Sbjct: 178 SRVKWGIPVPFDPEHTIYVWFDALFNYIS 206



 Score =  105 bits (263), Expect = 4e-25
 Identities = 46/501 (9%), Positives = 110/501 (21%), Gaps = 81/501 (16%)

Query: 343 YGDGAVMGVPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGK 402
           Y +       A+         +Y       +            ++   ++          
Sbjct: 15  YVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVD 74

Query: 403 YDGLGYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVP 462
            +   +                       +            G      + +      + 
Sbjct: 75  RNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYKEPSYFFRLS 134

Query: 463 EKDLPVVLPEDLVPDGTGNPLAKDPRFL----ECTCPSCGKPARRETDTMDTFIDSCWYY 518
           +    ++   +  P+       ++             S  +P  R    +    D     
Sbjct: 135 KYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVKWGIPVPFDPEHTI 194

Query: 519 MRYTCPDAGTMVDARNDYWM--PMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEPF 576
             +       +    +   +  P D ++ G +    H +Y   +   +            
Sbjct: 195 YVWFDALFNYISALEDKVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGYE--------L 246

Query: 577 TNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVVIGGIEK 636
              +           +                                            
Sbjct: 247 PKKVFAHGWWTVEGKK-------------------------------------------- 262

Query: 637 MSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGA--SRFLRRVWNYG 694
           MSK+  N +DP  ++ +YG D  R F++   P  Q  ++S   +           + N  
Sbjct: 263 MSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGNLY 322

Query: 695 YANAQAIR-XXXXXXXXXXXXXLRREIHTVLKQANYDYERIQYNTVVSATMKMLNAL--- 750
                                   +     +K      E++ +   +   +K  + L   
Sbjct: 323 SRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKY 382

Query: 751 --------------EDAKTASPAGRREGFSVLLRVLYPVVPHIAHGLWQELGYAAETVDI 796
                         ++          +G  VL  +LYP+ P+      Q LG   E   +
Sbjct: 383 VDEKQPWALNKERKKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQMLG---EKEFL 439

Query: 797 LDAAWPQVDEAALVRSEIELV 817
            +      +   L   +I   
Sbjct: 440 KELKPYSKNTYKLGERKILFP 460


>2c1fA [x.x.x] BIFUNCTIONAL ENDO-1,4-BETA-XYLANASE A
          Length = 219

 Score =  133 bits (336), Expect = 2e-33
 Identities = 21/221 (9%), Positives = 49/221 (22%), Gaps = 24/221 (10%)

Query: 42  YACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLM-PMGWDAFGMPAENAALNNG 100
                            +                G   +    G              N 
Sbjct: 6   GNGQNQHKGVNDGFSYEIWLD----------NTGGNGSMTLGSGATFKAEWNAAVNRGNF 55

Query: 101 VAPAAWTYDNIAYMKKQMQ-SMGLAIDWSREVATCSP---EYYRWNQWLFLKMLEKGIAY 156
           +A     + +           +  A  + +  +         Y W Q   L  +     Y
Sbjct: 56  LARRGLDFGSQKKATDYDYIGLDYAATYKQTASASGNSRLCVYGWFQNRGLNGVPLVEYY 115

Query: 157 RKTGTVNWDPVDQ--TVLANEQVI-DGRGWRSGAVVEKREI---PMYYLRITDYAQELLG 210
                V+W P  Q   V  +       +   +G  +          + +R        + 
Sbjct: 116 IIEDWVDWVPDAQGKMVTIDGAQYKIFQMDHTGPTINGGSETFKQYFSVRQQKRTSGHIT 175

Query: 211 DLEGL-GWPERVKIMQQNW--IGRSEGVRFAFPHEIKGADG 248
             +    W ++   +   +     +EG + +   ++   D 
Sbjct: 176 VSDHFKEWAKQGWGIGNLYEVALNAEGWQSSGVADVTLLDV 216


>3bicB [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
          Length = 715

 Score =  130 bits (328), Expect = 1e-32
 Identities = 20/458 (4%), Positives = 62/458 (13%), Gaps = 131/458 (28%)

Query: 382 TDAW---LEWYGDKEHGLCIHSGKYDGLGYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGI 438
              W    +     ++   +     +G+                     K   R     +
Sbjct: 3   HPEWAALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTM 62

Query: 439 SRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSCG 498
              R W                  + ++                  +    +     +  
Sbjct: 63  YTFRPWTIRQYAGFSTVEESNKFYKDNIK-----------------QQGLSVAFDLATHR 105

Query: 499 KPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYAR 558
                          +                                    +   +   
Sbjct: 106 GYDSDNPRVRGDVGMAGVAIDTV------------------------EDTKILFDGIPLE 141

Query: 559 FWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPA 618
             +  M        +     +L   +V                                 
Sbjct: 142 KMSVSMTM------NGAVIPVLANFIV--------------------------------- 162

Query: 619 GATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGS 678
                                 +  G+  + L      D  + F++         E S  
Sbjct: 163 --------------------TGEEQGVPKEKLTGTIQNDILKEFMVRNTYIF-PPEPSMK 201

Query: 679 GVEGASRFLRRVWN-YGYANAQAIRXXXXXXXXXXXXXLRREIHTVLKQANYDYE--RIQ 735
            +     +  +    +   +                            + +       + 
Sbjct: 202 IIADIFEYTAKHMPKFNSISISGYH---MQEAGADAILELAYTLADGLEYSRTGLQAGLT 258

Query: 736 YNTVVSATMKMLNAL------------------EDAKTASPAGRREGFSVLLRVLYPVVP 777
            +                                  +        +   +          
Sbjct: 259 IDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWS 318

Query: 778 HIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIE 815
                 +  +     T     AA     ++    S  E
Sbjct: 319 LTEQDPYNNIV---RTAIEAMAAVFGGTQSLHTNSFDE 353


>3bicA [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
          Length = 715

 Score =  130 bits (327), Expect = 1e-32
 Identities = 21/478 (4%), Positives = 62/478 (12%), Gaps = 140/478 (29%)

Query: 386 LEWYGDKEHGLCIHSGKYDGLGYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWG 445
            +     ++   +     +G+                     K   R     +   R W 
Sbjct: 21  AKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWT 80

Query: 446 TPIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSCGKPARRET 505
                            + ++                       +     +         
Sbjct: 81  IRQYAGFSTVEESNKFYKDNIKQQGLS-----------------VAFDLATHRGYDSDNP 123

Query: 506 DTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMR 565
                   +                         ++      +   L  +          
Sbjct: 124 RVRGDVGMAGV-------------------AIDTVEDTKILFDGIPLEKMSVSMTMN--- 161

Query: 566 DMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKAD 625
                        +L   +V                                        
Sbjct: 162 --------GAVIPVLANFIV---------------------------------------- 173

Query: 626 GQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASR 685
                          +  G+  + L      D  + F++         E S   +     
Sbjct: 174 -------------TGEEQGVPKEKLTGTIQNDILKEFMVRNTYIF-PPEPSMKIIADIFE 219

Query: 686 FLRRVWN-YGYANAQAIRXXXXXXXXXXXXXLRREIHTVLKQ--ANYDYERIQYNTVVSA 742
           +  +    +   +                            +         +  +     
Sbjct: 220 YTAKHMPKFNSISISGYH---MQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPR 276

Query: 743 TMKMLNALEDAKTASPAGR------------------------------REGFSVLLRVL 772
                    +        R                                         
Sbjct: 277 LSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTEQDPY 336

Query: 773 YPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIELVLQVNGKVRGSLTV 830
             +V      +    G    T  +   ++ +      V+S              S   
Sbjct: 337 NNIVRTAIEAMAAVFG---GTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIP 391


>3cglD [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
          Length = 219

 Score =  127 bits (319), Expect = 2e-31
 Identities = 8/231 (3%), Positives = 36/231 (15%), Gaps = 54/231 (23%)

Query: 463 EKDLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYT 522
           ++++ + L  +   +G    +    +       +       +   +              
Sbjct: 3   KEEMLIDLHLEGTFNGHYFEIKGKGKGQPNEGTNTVTLEVTKGGPLPFGWHILCPQFNKA 62

Query: 523 CPDAGT-MVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEPFTNLLT 581
                  + D     +     +   +      L        +         +  + ++  
Sbjct: 63  FVHHPDNIHDYLKLSFPEGYTWERSMHFEDGGLCCITNDISLT-------GNCFYYDIKF 115

Query: 582 QGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVVIGGIEKMSKSK 641
            G+                                        +G          + K  
Sbjct: 116 TGLNFPP------------------------------------NGP--------VVQKKT 131

Query: 642 NNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWN 692
                    +                            ++   R  +    
Sbjct: 132 TGWEPSTERLYPRDGVLIGDIHHALTVEGGGHYA--CDIKTVYRAKKAALK 180


>2dlcX [x.x.x] TYROSYL-TRNA SYNTHETASE, CYTOPLASMIC
          Length = 339

 Score =  126 bits (317), Expect = 2e-31
 Identities = 29/375 (7%), Positives = 72/375 (19%), Gaps = 64/375 (17%)

Query: 4   KYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYT 63
                 + +  Q+         V         + + +         P+G+ H G+     
Sbjct: 3   NEAFGLITKNLQEVLNPQIIKDVL--------EVQKRHLKLYWGTAPTGRPHCGY----F 50

Query: 64  INDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGL 123
           +           G  V + +      +    A                  +K  ++S+ +
Sbjct: 51  VPMTKLADFLKAGCEVTVLLADLHAFLDNMKA---PLEVVNYRAKYYELTIKAILRSINV 107

Query: 124 AIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGW 183
            I+  + V   S +          ++                                  
Sbjct: 108 PIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVA------------- 154

Query: 184 RSGAVVEKREIPMYYLRITDYAQELLGDLEGL--GWPERVKIMQQNWIGRSEGVRFAFPH 241
                     +      +     E   D++    G  +R   +       S G       
Sbjct: 155 -------NPLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLG------- 200

Query: 242 EIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESNPALAAFIEECKH- 300
                        K           +  +   +  E         S       +EE    
Sbjct: 201 -----------YKKRAHLMNPMVPGLANSKIDLLEEPKQVKKKINSAFCSPGNVEENGLL 249

Query: 301 --------GSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGVP 352
                               +  +    K   P+T +  +     +         +    
Sbjct: 250 SFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKIGV 309

Query: 353 AHDERDFAFALKYNL 367
           A    +    ++   
Sbjct: 310 ADAINELLEPIRQEF 324


>2ct8A [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 465

 Score =  126 bits (316), Expect = 3e-31
 Identities = 54/502 (10%), Positives = 118/502 (23%), Gaps = 82/502 (16%)

Query: 343 YGDGAVMGVPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGK 402
           Y +       A+         +Y       +            ++   ++          
Sbjct: 15  YVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVD 74

Query: 403 YDGLG----YXXXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGV 458
            +       +                   K   ++ +    R   +             +
Sbjct: 75  RNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYEKEPSYFFRL 134

Query: 459 VPVPEKDLPVVLPEDLVP-DGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWY 517
               +K L +                            S  +P  R    +    D    
Sbjct: 135 SKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVKWGIPVPFDPEHT 194

Query: 518 YMRYTCPDAGTM--VDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEP 575
              +       +  ++ + + + P D ++ G +    H +Y   +   +         E 
Sbjct: 195 IYVWFDALFNYISALEDKVEIYWPADLHLVGKDILRFHTVYWPAFLMSL-------GYEL 247

Query: 576 FTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVVIGGIE 635
              +   G    E                                              +
Sbjct: 248 PKKVFAHGWWTVEG---------------------------------------------K 262

Query: 636 KMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGA--SRFLRRVWN- 692
           KMSK+  N +DP  ++ +YG D  R F++   P  Q  ++S   +           + N 
Sbjct: 263 KMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGNL 322

Query: 693 YGYANAQAIRXXXXXXXXXXXXXLRREIHTVLKQANYDYERIQYNTVVSATMKMLNAL-- 750
           Y      A +               +     +K      E++ +   +   +K  + L  
Sbjct: 323 YSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNK 382

Query: 751 ---------------EDAKTASPAGRREGFSVLLRVLYPVVPHIAHGLWQELGYAAETVD 795
                          ++          +G  VL  +LYP+ P+      Q LG   E   
Sbjct: 383 YVDEKQPWALNKERKKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQMLG---EKEF 439

Query: 796 ILDAAWPQVDEAALVRSEIELV 817
           + +      +   L   +I   
Sbjct: 440 LKELKPYSKNTYKLGERKILFP 461



 Score =  120 bits (302), Expect = 1e-29
 Identities = 30/194 (15%), Positives = 65/194 (33%), Gaps = 3/194 (1%)

Query: 37  EKSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAA 96
              KFY  + + Y +   H+GH       D +ARY R+   +V    G D  G+  +  A
Sbjct: 3   LMKKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKA 62

Query: 97  LNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAY 156
              G++P      N    KK  + +   I++++ + T  P + ++ Q +F +  ++G  Y
Sbjct: 63  EELGISPKELVDRNAERFKKLWEFLK--IEYTKFIRTTDPYHVKFVQKVFEECYKRGDIY 120

Query: 157 RKTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGL- 215
                       +     +++++        +            +    ++L        
Sbjct: 121 LGEYEKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSR 180

Query: 216 GWPERVKIMQQNWI 229
                         
Sbjct: 181 VKWGIPVPFDPEHT 194


>1d2rA [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
          Length = 326

 Score =  125 bits (313), Expect = 6e-31
 Identities = 28/286 (9%), Positives = 58/286 (20%), Gaps = 47/286 (16%)

Query: 48  PYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWT 107
             PSG + +G+        V  +              ++ +    +  A+     P    
Sbjct: 8   IQPSGVITIGNYIGALRQFVELQ------------HEYNCYFCIVDQHAITVWQDP-HEL 54

Query: 108 YDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPV 167
             NI  +     ++G+                 + Q       +     +    +     
Sbjct: 55  RQNIRRLAALYLAVGIDPTQ----------ATLFIQSEVPAHAQAAWMLQCIVYIGELER 104

Query: 168 DQTV----------------LANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGD 211
                                      D   + +  V    +   +     D A+     
Sbjct: 105 MTQFKEKSAGAAAAAAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKR 164

Query: 212 L-EGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVT 270
             E    PE         I                                 A TI    
Sbjct: 165 YGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPK-------AYITLLDDAKTIEKKI 217

Query: 271 FCAVAAEHPLATHAAESNPALAAFIEECKHGSVMEADMATMEKKGM 316
             AV        +  E+ P ++  +      S    +    + +G 
Sbjct: 218 KSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGK 263


>3egbB [x.x.x] PROTEIN PELLINO HOMOLOG 2
          Length = 223

 Score =  119 bits (298), Expect = 4e-29
 Identities = 22/208 (10%), Positives = 44/208 (21%), Gaps = 20/208 (9%)

Query: 7   PSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKL-HMGHVRNYTIN 65
           PS V   +    +   +Y +S +                        +  +G      I+
Sbjct: 28  PSTVHVISTCKGQHSISYTLSRNQTVVV----------EYTHDKDTDMFQVGRSTESPID 77

Query: 66  DVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAI 125
            V+          +                A     A    +  NI   +K  +      
Sbjct: 78  FVVTDTQITQST-ISRFACRIVCDRNEPYTAR--IFAAGFDSSKNIFLGEKAAKWKNPDG 134

Query: 126 DWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQV----IDGR 181
                        +     ++ ++   G  Y            +  L   +         
Sbjct: 135 HMDGLTTNGVLVMHPRQPGVWREISVCGDVYTL--RETRSAQQRGKLVESETNVLQDGSL 192

Query: 182 GWRSGAVVEKREIPMYYLRITDYAQELL 209
               GA +  R     +   T    E L
Sbjct: 193 IDLCGATLLWRTADGLFHTPTQKHIEAL 220


>3e3nB [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 814

 Score =  112 bits (280), Expect = 6e-27
 Identities = 27/158 (17%), Positives = 49/158 (31%), Gaps = 24/158 (15%)

Query: 45  SMLPYPSGKLHMGH---VRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGV 101
           S + YP  +L +     V   T+ D++ R+ + +      P+  +    P + A   N  
Sbjct: 260 SRVLYPGKELRLKQEYFVVAATLQDIIRRF-KSSKFGCRDPVRTNFDAFPDKVAIQLNDT 318

Query: 102 APAAWTYDNIAYMKKQMQSMGLAID--WSREVATCSPE--------YYRWNQWLFLKMLE 151
            P+         M+  +    L  D  W   V TC+            RW   L   +L 
Sbjct: 319 HPSLAI---PELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLP 375

Query: 152 KGI-------AYRKTGTVNWDPVDQTVLANEQVIDGRG 182
           + +                  P D   L    +++   
Sbjct: 376 RHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGA 413


>3cglC [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
          Length = 220

 Score =  111 bits (279), Expect = 7e-27
 Identities = 11/235 (4%), Positives = 40/235 (17%), Gaps = 58/235 (24%)

Query: 461 VPEKDLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFID---SCWY 517
           V ++++ + L  +   +G    +    +       +       +   +          + 
Sbjct: 2   VIKEEMLIDLHLEGTFNGHYFEIKGKGKGQPNEGTNTVTLEVTKGGPLPFGWHILCPQFN 61

Query: 518 YMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEPFT 577
                 PD   + D     +     +   +      L        +         +  + 
Sbjct: 62  KAFVHHPD--NIHDYLKLSFPEGYTWERSMHFEDGGLCCITNDISLT-------GNCFYY 112

Query: 578 NLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVVIGGIEKM 637
           ++   G+                                        +G          +
Sbjct: 113 DIKFTGLNFP------------------------------------PNG--------PVV 128

Query: 638 SKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWN 692
            K           +                            ++   R  +    
Sbjct: 129 QKKTTGWEPSTERLYPRDGVLIGDIHHALTVEGGGHYA--CDIKTVYRAKKAALK 181


>2aelB [x.x.x] TRICHODIENE SYNTHASE
          Length = 353

 Score =  111 bits (278), Expect = 9e-27
 Identities = 12/152 (7%), Positives = 32/152 (21%), Gaps = 13/152 (8%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
             ++ L   +  A  Q    +               E+ +             + +    
Sbjct: 200 FNERSLFLEITSAIAQMENWMVWVNDLMSFYKEFDDERDQISLVKNYVVSDE-ISLHEAL 258

Query: 61  NYTINDVMARYLRM----NGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYD------- 109
                D +    +M    + ++  +    + F        L +     +  Y+       
Sbjct: 259 EKLTQDTLHSSKQMVAVFSDKDPQVMDTIECFMHGYVTWHLCDRKYRLSEIYEKVKEEKT 318

Query: 110 -NIAYMKKQMQSMGLAIDWSREVATCSPEYYR 140
            +     K  +        S       P    
Sbjct: 319 EDAQKFCKFYEQAANVGAVSPSEWAYPPVAQL 350


>1cjyB [b.7.1 - c.19.1] PROTEIN (CYTOSOLIC PHOSPHOLIPASE A2)
          Length = 614

 Score =  109 bits (273), Expect = 2e-26
 Identities = 23/320 (7%), Positives = 52/320 (16%), Gaps = 54/320 (16%)

Query: 436 WGISRQRYWGTPIPLIHCDSCGVVP--VPEKDLPVVLPEDLVPDGTGNPLAKDPRFLECT 493
             +S  +               +       + +     E    +                
Sbjct: 296 TTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMAPDLFG 355

Query: 494 CPSCGKPARRETDTMDT-FIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAIL 552
                    ++ +     F+   W        +               +     I   I 
Sbjct: 356 SKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLG---STMEEELENITTKHIVSWIH 412

Query: 553 HLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTD 612
            ++ A      + +                  +L     +                    
Sbjct: 413 RMIMALVSDSALFNT------REGRAGKVHNFMLGLNDVKSKKIH--------------- 451

Query: 613 ERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQ 672
                                    S    N   P  L  Q G D    F   A P    
Sbjct: 452 ----------------------VVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPS--- 486

Query: 673 LEWSGSGVEGASRFLRRVWNYGYANAQAIRXXXXXXXXXXXXXLRREIHTVLKQANYDYE 732
              S    +      +          +                 + +  T++     +  
Sbjct: 487 --DSSPPFKELLLAEKWAKMNKLPFPKIDPYVFDREGLKECYVFKPDCPTIIHFVLANIN 544

Query: 733 RIQYNTVVSATMKMLNALED 752
             +Y   V    +    + D
Sbjct: 545 FRKYAPGVPRETEEEKEIAD 564


>2aelA [x.x.x] TRICHODIENE SYNTHASE
          Length = 352

 Score =  108 bits (270), Expect = 8e-26
 Identities = 10/152 (6%), Positives = 31/152 (20%), Gaps = 19/152 (12%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
             +     A  +        + ++                  +       S ++ +    
Sbjct: 205 FLEITSAIAQMENWMVWVNDLMSFYKEFDDERD-------QISLVKNYVVSDEISLHEAL 257

Query: 61  NYTINDVMARYLRM----NGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYD------- 109
                D +    +M    + ++  +    + F        L +     +  Y+       
Sbjct: 258 EKLTQDTLHSSKQMVAVFSDKDPQVMDTIECFMHGYVTWHLCDRKYRLSEIYEKVKEEKT 317

Query: 110 -NIAYMKKQMQSMGLAIDWSREVATCSPEYYR 140
            +     K  +        S       P    
Sbjct: 318 EDAQKFCKFYEQAANVGAVSPSEWAYPPVAQL 349


>3dl5B [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
          Length = 508

 Score =  107 bits (267), Expect = 2e-25
 Identities = 11/171 (6%), Positives = 28/171 (16%), Gaps = 13/171 (7%)

Query: 38  KSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAAL 97
             + +          +     +  +   D    +L      +    G   +         
Sbjct: 261 MRESFPLLTTKKVFIRSIFEELIWFIKGDTNGNHLIEKKVYIWSGNGSKEYLERIGLGHR 320

Query: 98  NNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYR 157
                              Q +      ++       +         L   +       R
Sbjct: 321 EENDLG--------PIYGFQWRHYN--GEYKTMHDDYTGVGVDQLAKLIETLKNNPKDRR 370

Query: 158 KTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQEL 208
                 W+P    +            +     +       Y R  D     
Sbjct: 371 HI-LTAWNPSA--LSQMALPPCHVLSQYYVTNDNCLSCNLYQRSCDLGLGS 418


>1bt1A [a.86.1] PROTEIN (CATECHOL OXIDASE)
          Length = 336

 Score =  106 bits (266), Expect = 2e-25
 Identities = 23/186 (12%), Positives = 37/186 (19%), Gaps = 30/186 (16%)

Query: 447 PIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTGNPLAKD-PRFLECTCPSCGKPARRET 505
           PI       C V P         LP   V D    P+A +   +            R   
Sbjct: 2   PIQAPEISKCVVPPAD-------LPPGAVVDNCCPPVASNIVDYK--LPAVTTMKVRPAA 52

Query: 506 DTMDTFIDSCWYYMRYTCPDAGT--------------MVDARNDYWMPMDQYIGGIEH-- 549
            TMD       +        A                       Y            H  
Sbjct: 53  HTMDKD-AIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNS 111

Query: 550 ---AILHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPAD 606
                 H  Y  F+ +++  +                  +    +  D++      N   
Sbjct: 112 WLFFPFHRWYLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDSTSSLYDSNRNQ 171

Query: 607 VDVQTD 612
             +   
Sbjct: 172 SHLPPV 177


>3d6uA [x.x.x] TYROSYL-TRNA SYNTHETASE
          Length = 306

 Score =  106 bits (266), Expect = 2e-25
 Identities = 39/278 (14%), Positives = 77/278 (27%), Gaps = 21/278 (7%)

Query: 37  EKSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAA 96
           +K +  A      PSGK+H+GH            YL++     L   G+D   + A+  A
Sbjct: 24  KKDEKSAIIGF-EPSGKIHLGH------------YLQIKKMIDLQNAGFDIIILLADLFA 70

Query: 97  LNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAY 156
             N             Y KK  ++MGL   +    +    + Y  N +          A 
Sbjct: 71  YLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSSFMLDKDYTLNVYRLALKTTLKRAR 130

Query: 157 RKTGTVNWDPVDQTV-LANEQVIDGRGWRS-GAVVEKREIPM-YYLRIT-DYAQELLGDL 212
           R    +  +  +  V      ++        G  V    +       +  +   + +  +
Sbjct: 131 RSMELIAREDENPKVAEVIYPIMQVNPLHYEGVDVAVGGMEQRKIHMLARELLPKKVVCI 190

Query: 213 --EGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVT 270
               L   +    M  +            P EI+    K      +       +      
Sbjct: 191 HNPVLTGLDGEGKMSSSKGNFIAV--DDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFL 248

Query: 271 FCAVAAEHPLATHAAESNPALAAFIEECKHGSVMEADM 308
              +  + P       +  +        K+  +   D+
Sbjct: 249 EYPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDL 286


>2bcvA [x.x.x] DNA POLYMERASE LAMBDA
          Length = 323

 Score =  102 bits (254), Expect = 5e-24
 Identities = 17/168 (10%), Positives = 45/168 (26%), Gaps = 23/168 (13%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHV- 59
             D  +     ++ +  +  +            +G       +          L +  + 
Sbjct: 175 DVDVLITHPDGRSHRGIFSRLLDSLR------QEGFLTDDLVSQEENGQQQKYLGVCRLP 228

Query: 60  ---RNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKK 116
              R +   D++          +L   G   F       A   G++ +         + +
Sbjct: 229 GPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHA--LSTAVVR 286

Query: 117 QMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNW 164
                   +   R + T +       + +F  +   G+ YR+    +W
Sbjct: 287 NTHGCK--VGPGRVLPTPTE------KDVFRLL---GLPYREPAERDW 323


>2aekA [x.x.x] TRICHODIENE SYNTHASE
          Length = 354

 Score =  101 bits (253), Expect = 6e-24
 Identities = 15/178 (8%), Positives = 36/178 (20%), Gaps = 35/178 (19%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
             +     A  +        + ++            ++    +       S ++ +    
Sbjct: 207 FLEITSAIAQMENWMVWVNDLMSFYKEFD-------DERDQISLVKNYVVSDEISLHEAL 259

Query: 61  NYTINDVMARYLRMNG----RNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKK 116
                D +    +M      ++  +    + F        L +                 
Sbjct: 260 EKLTQDTLHSSKQMVAVFSDKDPQVMDTIECFMHGYVTWHLCDR---------------- 303

Query: 117 QMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLAN 174
                        E+     E    +   F K  E+           W       LAN
Sbjct: 304 --------KYRLSEIYEKVKEEKTEDAQKFCKFYEQAANVGAVSPSEWAYPPVAQLAN 353


>1ei5A [e.3.1 - b.61.3 - b.61.3] D-AMINOPEPTIDASE
          Length = 518

 Score = 99.5 bits (246), Expect = 3e-23
 Identities = 21/426 (4%), Positives = 64/426 (15%), Gaps = 15/426 (3%)

Query: 319 GLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGVPAHDERDFAFALKYNLPIKQVIDVKGQ 378
             +           +   +   +     A   +       F     Y+        +   
Sbjct: 103 NNQSGLRDYWALSVLCGADPEGVFLPAQAQSLLRRLKTTHFEPGSHYSYCNGNFRILADL 162

Query: 379 AYSTDAWLEWYGDKEHGLCIHSGKYDGLGYXXXXXXXXXXXXXXXXXEKKVTWRL-RDWG 437
             +         D                                   +       R   
Sbjct: 163 IEAHTG--RTLVDILSERIFAPAGMKRAELISDTALFDECTGYEGDTVRGFLPATNRIQW 220

Query: 438 ISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSC 497
           +       +   +I  +        ++               G                 
Sbjct: 221 MGDAGICASLNDMIAWEQFIDATRDDESGLYRRLSGPQTFKDGVAAPYGFGLNLHETGGK 280

Query: 498 GKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYA 557
                             W+                    +        +  +   +   
Sbjct: 281 RLTGHGGALRGWRCQ--RWHCADERLSTIAMFNFEGGASEVAFKLMNIALGVSSSEVSRV 338

Query: 558 RFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRP 617
              +         +     +        +   F         +      V          
Sbjct: 339 EADSAWFGSWLDDETGLVLSLEDAGHGRMKARFGT-------SPEMMDVVSANEARSAVT 391

Query: 618 AGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSG 677
                    + V      ++S  +  G     +I +Y +D     ++  +          
Sbjct: 392 TIRRDGETIELVRASENLRLSMKRVKGEAKHDIIGRYHSDELDADLLLVSEGGAIYGAFE 451

Query: 678 SGVEGASRFLRRVWNYGYANAQAIRXXXXXXXXXXXXXLRREIHTVLKQ---ANYDYERI 734
             +  +  +               R              RR+    +       +    +
Sbjct: 452 GFLGKSDMYPLYSVGSDVWLLPVQRSMDAPSPGEWKLVFRRDDKGEITGLSVGCWLARGV 511

Query: 735 QYNTVV 740
           +Y  V 
Sbjct: 512 EYRRVQ 517


>3e3nD [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 814

 Score = 98.9 bits (246), Expect = 5e-23
 Identities = 22/137 (16%), Positives = 39/137 (28%), Gaps = 21/137 (15%)

Query: 63  TINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMG 122
           T+ D++ R+          P+  +    P + A   N   P+         M+  +    
Sbjct: 280 TLQDIIRRFKSS-KFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLER 335

Query: 123 LAID--WSREVATCS--------PEYYRWNQWLFLKMLEKGI-------AYRKTGTVNWD 165
           L  D  W   V TC+            RW   L   +L + +                  
Sbjct: 336 LDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAF 395

Query: 166 PVDQTVLANEQVIDGRG 182
           P D   L    +++   
Sbjct: 396 PGDVDRLRRMSLVEEGA 412


>3e3nH [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 813

 Score = 98.9 bits (246), Expect = 5e-23
 Identities = 22/137 (16%), Positives = 41/137 (29%), Gaps = 21/137 (15%)

Query: 63  TINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMG 122
           T+ D++ R+ + +      P+  +    P + A   N   P+         M+  +    
Sbjct: 281 TLQDIIRRF-KSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLER 336

Query: 123 LAID--WSREVATCS--------PEYYRWNQWLFLKMLEKGI-------AYRKTGTVNWD 165
           L  D  W   V TC+            RW   L   +L + +                  
Sbjct: 337 LDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAF 396

Query: 166 PVDQTVLANEQVIDGRG 182
           P D   L    +++   
Sbjct: 397 PGDVDRLRRMSLVEEGA 413


>3d6vA [x.x.x] TYROSYL-TRNA SYNTHETASE
          Length = 308

 Score = 98.4 bits (244), Expect = 7e-23
 Identities = 42/283 (14%), Positives = 76/283 (26%), Gaps = 33/283 (11%)

Query: 37  EKSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAA 96
           +K +  A      PSGK+H+GH            YL++     L   G+D   + A+  A
Sbjct: 24  KKDEKSAIIGF-EPSGKIHLGH------------YLQIKKMIDLQNAGFDIIILLADLFA 70

Query: 97  LNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAY 156
             N             Y KK  ++MGL   +    +    + Y  N +          A 
Sbjct: 71  YLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSSFMLDKDYTLNVYRLALKTTLKRAR 130

Query: 157 RKTGTVNWDPVDQTVLANE----QVIDGRGWRSGAVVEKREIPMYYLRITDYAQE----- 207
           R    +  +  +  V        QV           V   E    ++   +   +     
Sbjct: 131 RSMELIAREDENPKVAEVIYPIMQVNPLHYEGVDVAVGGMEQRKIHMLARELLPKKVVCI 190

Query: 208 ---LLGDLEGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRAD 264
              +L  L+  G  +                    P EI+    K      +       +
Sbjct: 191 HNPVLTGLD--GEGKMSSSKGNFIA------VDDSPEEIRAKIKKAYCPAGVVEGNPIME 242

Query: 265 TIMGVTFCAVAAEHPLATHAAESNPALAAFIEECKHGSVMEAD 307
                    +  + P       +  +        K+  +   D
Sbjct: 243 IAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMD 285



 Score = 38.3 bits (88), Expect = 9e-05
 Identities = 16/180 (8%), Positives = 34/180 (18%), Gaps = 29/180 (16%)

Query: 506 DTMDTFIDSCWYYMRYTCPDAGTMVD--ARNDYWMPMDQYIGGIEHAILHLLYARFWTKV 563
                 ++                        ++  +D  +GG+E   +H+L      K 
Sbjct: 127 KRARRSMELIAREDENPKVAEVIYPIMQVNPLHYEGVDVAVGGMEQRKIHMLARELLPK- 185

Query: 564 MRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAK 623
                          +    +   +   +  +S               D          K
Sbjct: 186 -----------KVVCIHNPVLTGLDGEGKMSSSKGNFIA-------VDDSPEEIRAKIKK 227

Query: 624 ADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGA 683
           A                 N  ++      +Y     R             E   S  +  
Sbjct: 228 AYCPA--------GVVEGNPIMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNK 279


>2azxA [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
          Length = 377

 Score = 95.9 bits (237), Expect = 4e-22
 Identities = 22/275 (8%), Positives = 59/275 (21%), Gaps = 31/275 (11%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
            +              H+     +         D  E  K +       PS + H+GH+ 
Sbjct: 33  KELINRIERATGQRPHHFLRRGIFFSHRDNQVLDAYENKKPFYLYTGRGPSSEAHVGHLI 92

Query: 61  NYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQS 120
            +     +              +      +  ++             Y +     K +  
Sbjct: 93  PFIFTKWLQD------------VFNVPLVIQTDDEKYLWKDLTLDQAYGDAVENAKDII- 139

Query: 121 MGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDG 180
                D ++       +Y     +  +      +  +K  T N          ++ +   
Sbjct: 140 -ACGFDINKTFIFSDLDYGSSGFYKNV------VKIQKHVTFNQVKGIFGFTDSDCI--- 189

Query: 181 RGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGLG-WPERVKIMQQNWIGRSEGVRFAF 239
            G  S   ++      +        ++       +    ++    +   +    G     
Sbjct: 190 -GKISFPAIQAAPS--FSNSFPQIFRDRTDIQCLIPCAIDQDPYFRTRDVAPRIGYPKPA 246

Query: 240 PHE---IKGADGKLINDGKLYVFTTR-ADTIMGVT 270
                      G           +    DT   + 
Sbjct: 247 LLHSTFFPALQGAQTKSASDPNSSIFLTDTAKQIK 281


>3e3nA [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 813

 Score = 94.7 bits (235), Expect = 9e-22
 Identities = 22/137 (16%), Positives = 39/137 (28%), Gaps = 21/137 (15%)

Query: 63  TINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMG 122
           T+ D++ R+          P+  +    P + A   N   P+         M+  +    
Sbjct: 280 TLQDIIRRFKSS-KFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLER 335

Query: 123 LAID--WSREVATCS--------PEYYRWNQWLFLKMLEKGI-------AYRKTGTVNWD 165
           L  D  W   V TC+            RW   L   +L + +                  
Sbjct: 336 LDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAF 395

Query: 166 PVDQTVLANEQVIDGRG 182
           P D   L    +++   
Sbjct: 396 PGDVDRLRRMSLVEEGA 412


>1a1xA [x.x.x] HMTCP-1
          Length = 106

 Score = 93.2 bits (232), Expect = 2e-21
 Identities = 8/102 (7%), Positives = 33/102 (32%), Gaps = 14/102 (13%)

Query: 86  DAFGMPAENAAL--------NNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPE 137
           +  G P ++  +               A   +  ++++ ++Q + + +  +   +     
Sbjct: 3   EDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLT- 61

Query: 138 YYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLAN-EQVI 178
               +Q   +  L     Y    +  W      ++   ++++
Sbjct: 62  ----SQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELL 99


>2cybB [x.x.x] TYROSYL-TRNA SYNTHETASE
          Length = 317

 Score = 92.1 bits (227), Expect = 6e-21
 Identities = 46/321 (14%), Positives = 84/321 (26%), Gaps = 31/321 (9%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
           M        + + A++     +  ++ E         K K  A      PSG++H+GH  
Sbjct: 1   MDITEKLRLITRNAEEVVTEEELRQLIE--------TKEKPRAYVGYE-PSGEIHLGH-- 49

Query: 61  NYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQS 120
                      + +     L   G++   + A+  A  N         +   Y KK   +
Sbjct: 50  ----------MMTVQKLMDLQEAGFEIIVLLADIHAYLNEKGTFEEIAEVADYNKKVFIA 99

Query: 121 MGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTV-------NWDPVDQTVLA 173
           +GL    ++ V     +  R      LKM       R   ++           V Q +  
Sbjct: 100 LGLDESRAKFVLGSEYQLSRDYVLDVLKMARITTLNRARRSMDEVSRRKEDPMVSQMIYP 159

Query: 174 NEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDL-EGLGWPERVKIMQQNWIGRS 232
             Q +D         V   +    ++   +    L       L  P  V +  Q      
Sbjct: 160 LMQALDIAHLGVDLAVGGIDQRKIHMLARENLPRLGYSSPVCLHTPILVGLDGQKMSSSK 219

Query: 233 EGVRFAF--PHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESNPA 290
                    P E++    K      +       D                         +
Sbjct: 220 GNYISVRDPPEEVERKIRKAYCPAGVVEENPILDIAKYHILPRFGKIVVERDAGDVEYAS 279

Query: 291 LAAFIEECKHGSVMEADMATM 311
                E+ K G +   D+   
Sbjct: 280 FEELAEDFKSGQLHPLDLKIA 300



 Score = 37.8 bits (86), Expect = 1e-04
 Identities = 21/186 (11%), Positives = 40/186 (21%), Gaps = 53/186 (28%)

Query: 486 DPRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIG 545
             R          +              S              ++ A +   + +D  +G
Sbjct: 117 LSRDYVLDVLKMARITTLNRARRSMDEVSRRKEDPMVSQMIYPLMQALDIAHLGVDLAVG 176

Query: 546 GIEHAILHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPA 605
           GI+   +H+L      +                 L   +++                   
Sbjct: 177 GIDQRKIHMLARENLPR---------LGYSSPVCLHTPILVGL----------------- 210

Query: 606 DVDVQTDERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMF 665
                              DGQ        KMS SK N I  +   ++      + +   
Sbjct: 211 -------------------DGQ--------KMSSSKGNYISVRDPPEEVERKIRKAYCPA 243

Query: 666 AAPPEQ 671
               E 
Sbjct: 244 GVVEEN 249


>2bcrA [x.x.x] DNA POLYMERASE LAMBDA
          Length = 325

 Score = 89.6 bits (221), Expect = 3e-20
 Identities = 18/164 (10%), Positives = 43/164 (26%), Gaps = 15/164 (9%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
             D  +     ++ +  +  +      E  +  D   +          Y       G  R
Sbjct: 177 DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQ--EENGQQQKYLGVCRLPGPGR 234

Query: 61  NYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQS 120
            +   D++          +L   G   F       A   G++ +         + +    
Sbjct: 235 RHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHA--LSTAVVRNTHG 292

Query: 121 MGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNW 164
             +         T +       + +F  +   G+ YR+    +W
Sbjct: 293 CKVGPGRVLP--TPTE------KDVFRLL---GLPYREPAERDW 325


>3c5fA [x.x.x] DNA POLYMERASE LAMBDA
          Length = 326

 Score = 89.2 bits (220), Expect = 4e-20
 Identities = 16/135 (11%), Positives = 38/135 (28%), Gaps = 19/135 (14%)

Query: 36  KEKSKFYACSMLPYPSGKLHMGHVR------NYTINDVMARYLRMNGRNVLMPMGWDAFG 89
           +        S       + ++G  R       +   D++          +L   G   F 
Sbjct: 205 EGFLTDDLVSQEENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLYFTGSAHFN 264

Query: 90  MPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKM 149
                 A   G++     +     + +        +   R + T +       + +F  +
Sbjct: 265 RSMAALAKTKGMSL--SEHALSTAVVRNTHGCK--VGPGRVLPTPTE------KDVFRLL 314

Query: 150 LEKGIAYRKTGTVNW 164
              G+ YR+    +W
Sbjct: 315 ---GLPYREPAERDW 326


>2bcqA [x.x.x] DNA POLYMERASE LAMBDA
          Length = 324

 Score = 88.9 bits (219), Expect = 5e-20
 Identities = 17/164 (10%), Positives = 40/164 (24%), Gaps = 15/164 (9%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
             D  +     ++ +  +  +      E          S+        Y       G  R
Sbjct: 176 DVDVLITHPDGRSHRGIFSRLLDSLRQEGF--LTDDLVSQEENGQQQKYLGVCRLPGPGR 233

Query: 61  NYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQS 120
            +   D++          +L   G   F       A   G++ +         + +    
Sbjct: 234 RHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHA--LSTAVVRNTHG 291

Query: 121 MGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNW 164
             +                   + +F  +   G+ YR+    +W
Sbjct: 292 CKVGPGRVLP--------TPTEKDVFRLL---GLPYREPAERDW 324


>2a6tA [x.x.x] SPAC19A8.12
          Length = 230

 Score = 88.2 bits (217), Expect = 8e-20
 Identities = 32/227 (14%), Positives = 60/227 (26%), Gaps = 15/227 (6%)

Query: 71  YLRMNGRNVLMPMGWDA-FGMPAENAALN----NGVAPAAWTY-DNIAYMKKQMQSMGLA 124
           +       VL  +       +PAE  +        +  A W Y D I     Q+ S+GL 
Sbjct: 3   FTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLR 62

Query: 125 IDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGWR 184
           +  ++  A C   +    +     +  K     +   +    + Q VL            
Sbjct: 63  VFSAKLFAHCPLLWKWHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGF 122

Query: 185 SGAVVEKRE-----IPMYYLRITDYAQELLGDLEGLGWPERVKIMQQNWIGRSEGVRFAF 239
               ++K E             T +      +              + +I     +   F
Sbjct: 123 PKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRF 182

Query: 240 PHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAE 286
                    +  N   L  F  +    M + F A   +     + A 
Sbjct: 183 EIS----KIEWHNLMDLPTFKMKNKFYMVIPFLAPLKKWIKKRNIAN 225


>2e50B [x.x.x] PROTEIN SET
          Length = 167

 Score = 88.2 bits (218), Expect = 8e-20
 Identities = 14/185 (7%), Positives = 30/185 (16%), Gaps = 34/185 (18%)

Query: 292 AAFIEEC-KHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVG-NYVLMTYGDGAVM 349
              I+E       +    +    K      K+  P   ++ ++        +T       
Sbjct: 9   IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQ 68

Query: 350 GVPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYX 409
                 E D               +                            Y    Y 
Sbjct: 69  VSALLGEEDEEAMHYLTRVEVTEFEDIK-----------------------SGYRIDFYF 105

Query: 410 XXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVV 469
                               +  ++          G  +            + E     +
Sbjct: 106 DENPYFENKVLSKEFHMSSKSTEIKWK-------SGKDMFFTWFTGAD--ELGEVIKDDI 156

Query: 470 LPEDL 474
            P  L
Sbjct: 157 WPNPL 161


>3c98A [e.25.1 (1dn1A)] SYNTAXIN-BINDING PROTEIN 1
          Length = 556

 Score = 86.2 bits (212), Expect = 3e-19
 Identities = 20/210 (9%), Positives = 48/210 (22%), Gaps = 28/210 (13%)

Query: 634 IEKMSKSKNNGIDP-QALIDQYGADTARLFVMFAAPPEQQLEW--SGSGVEGASRFLRRV 690
           +  ++ S+ +         D   A      V F       L      S      + L  +
Sbjct: 71  VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEI 130

Query: 691 WNYGYANAQAIRXXXXXXXXXXXXX---------------LRREIHTVLKQANYDYERIQ 735
                     +                              +        +         
Sbjct: 131 NIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRG 190

Query: 736 YNTVVSATMKMLNALEDA-------KTASPAGRREGFSVLLRVLYPVVPHIAHGLWQELG 788
                +   +++    DA           P   R    +L R   P  P +    +Q + 
Sbjct: 191 EYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMS 250

Query: 789 YAAETVDILDAAWPQVDEAALVRSEIELVL 818
           Y    +  ++    + + + +  + ++ VL
Sbjct: 251 Y---DLLPIENDVYKYETSGIGEARVKEVL 277


>2c1sA [x.x.x] BIOTIN BINDING PROTEIN A
          Length = 123

 Score = 77.0 bits (189), Expect = 2e-16
 Identities = 7/124 (5%), Positives = 29/124 (23%), Gaps = 10/124 (8%)

Query: 10  VEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMA 69
           ++   +    +             D          + +   + ++ +  ++         
Sbjct: 5   LQGLWRNELGSNMTISA------LDVAGTFSGSYQTAVTATNKQILVSPLKGAQQPPGTK 58

Query: 70  RYLRMNGRNVLMPM---GWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAID 126
                 G  V            G    +      +  A    + +   K   ++  +  +
Sbjct: 59  GQQPTFGFTVQWQFADSTTVFVGQCFVDRRGKEMLEMAWLLREEVPSRKDTWKATRVGTN 118

Query: 127 -WSR 129
            ++R
Sbjct: 119 VFTR 122


>3cfiJ [x.x.x] TYPE II SECRETORY PATHWAY, PSEUDOPILIN EPSI
          Length = 81

 Score = 74.2 bits (182), Expect = 1e-15
 Identities = 4/81 (4%), Positives = 18/81 (22%), Gaps = 14/81 (17%)

Query: 69  ARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVA-----------PAAWTYDNIAYMKKQ 117
                +  +         A    A        +               W    +A  +  
Sbjct: 2   NTVGYLEQKMFA---AMVADNQMAMVMLNPKNLKASNGEEELAGQTWYWKVAPVATTQPL 58

Query: 118 MQSMGLAIDWSREVATCSPEY 138
           +++  +++   ++ +      
Sbjct: 59  LKAFDVSVAAEKQASPIITVR 79


>2ab5B [x.x.x] MRNA MATURASE
          Length = 246

 Score = 74.0 bits (181), Expect = 2e-15
 Identities = 10/134 (7%), Positives = 27/134 (20%), Gaps = 16/134 (11%)

Query: 632 GGIEKMSKSKNNGIDPQALIDQYGADTARLFVMF------------AAPPEQQLEWSGSG 679
           G I  +SK     +    +                                ++ +++   
Sbjct: 21  GWI-TISKKGKYLLYELGIEHIRDIQLLYKIKNILGIGKVTIKKLKKDGTIKECKFNVRN 79

Query: 680 VEGASRFLRRVWNY---GYANAQAIRXXXXXXXXXXXXXLRREIHTVLKQANYDYERIQY 736
                  +  ++N       +   +                      +K  N   + +  
Sbjct: 80  KNHLKNIIIPIFNKYPLTNKHYDYLYFKDNLLKDIKYYNDLSYYLRPIKPFNTTEDILNK 139

Query: 737 NTVVSATMKMLNAL 750
           N   S  +    A 
Sbjct: 140 NYFSSWLIGFFEAK 153


>2arlA [x.x.x] GFP-LIKE NON-FLUORESCENT CHROMOPROTEIN
          Length = 218

 Score = 73.2 bits (179), Expect = 3e-15
 Identities = 19/221 (8%), Positives = 33/221 (14%), Gaps = 65/221 (29%)

Query: 477 DGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDY 536
           DG G P   +         + G P     D +               P+           
Sbjct: 28  DGKGKPYEGEQTVKLT--VTKGGPLPFAWDILSPQ----CSIPFTKYPEDIP---DYVKQ 78

Query: 537 WMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDE--PFTNLLTQGMVLNETFYRED 594
             P              + +      V                ++   G+          
Sbjct: 79  SFPEGFTWER------IMNF--EDGAVCTVSNDSSIQGNCFTYHVKFSGLNFPP------ 124

Query: 595 ASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQY 654
                                         +G          M K           +   
Sbjct: 125 ------------------------------NGP--------VMQKKTQGWEPSSERLFAR 146

Query: 655 GADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWNYGY 695
           G        M                +   +  + V   GY
Sbjct: 147 GGMLIGNNFMALKLEGGGHYL--CEFKTTYKAKKPVKMPGY 185


>3ecjA [x.x.x] PROTEIN (HOMOPROTOCATECHUATE 2,3-DIOXYGENASE)
          Length = 360

 Score = 73.2 bits (177), Expect = 3e-15
 Identities = 19/225 (8%), Positives = 43/225 (19%), Gaps = 19/225 (8%)

Query: 294 FIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGVPA 353
                +    +      +E  G      +                 +         G   
Sbjct: 151 LDHFNQVTPDVPRGRKYLEDLGFRVTEDIQDDEGTTYAAWMHRKGTVHDTALTGGNGPRL 210

Query: 354 HDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYXXXXX 413
           H            + I   +     +   +     +G       + +  Y  +       
Sbjct: 211 HHVAFSTHEKHNIIQICDKMGALRISDRIERGPGRHG-------VSNAFYLYILDPDNHR 263

Query: 414 XXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPED 473
                           T         R+ +WG P+          V   + ++  ++   
Sbjct: 264 IEIYTQDYYTGDPDNPTITWNVHDNQRRDWWGNPVVPSWYTEASKVLDLDGNVQEIILRT 323

Query: 474 LVPDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWYY 518
                           LE T  + G    R  D   ++       
Sbjct: 324 DDS------------ELEVTIGADGFSFTRAGDEDGSYHGQASKG 356


>3bjqH [x.x.x] PHAGE-RELATED PROTEIN
          Length = 286

 Score = 72.2 bits (176), Expect = 6e-15
 Identities = 23/212 (10%), Positives = 49/212 (23%), Gaps = 37/212 (17%)

Query: 164 WDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGLGWPERVKI 223
              V + +    QV       + +V     I + +                    +    
Sbjct: 75  EAKVPRELRDASQVPG-IDLGARSVNTVLRIALAHEHECAQIALDPAKY----NADHKVK 129

Query: 224 MQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATH 283
           +  +    S         +++ A   +             + ++     +    HP    
Sbjct: 130 LVGSARWTSPDSDPTK--DVETAKEAI------ADSIGEPNRLLSRKALSACKYHPKLIE 181

Query: 284 AAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTY 343
                 AL                    E + +  G            DVW  +  L   
Sbjct: 182 ITIDLKALW-------------------EVEEIVVGTARVATGNDSFGDVWGPDVWL--- 219

Query: 344 GDGAVMGVPAHDERDFAFALKYNLPIKQVIDV 375
             G V   P     + +F   Y +    +++V
Sbjct: 220 --GYVSDNPDPSVEEPSFGYTYQIEGHPLVEV 249


>2cycA [x.x.x] TYROSYL-TRNA SYNTHETASE
          Length = 371

 Score = 72.1 bits (175), Expect = 6e-15
 Identities = 15/164 (9%), Positives = 39/164 (23%), Gaps = 12/164 (7%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
           M  +   + V +   +    ++  +           E        +    SG +H+G   
Sbjct: 1   MDIEERINLVLKKPTEEVLTVENLRH--------LFEIGAPLQHYIGFEISGYIHLGT-- 50

Query: 61  NYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQS 120
              +        +  G    + +         +    +  V            M+K ++ 
Sbjct: 51  -GLMAGAKIADFQKAGIKTRVFLADW-HSWINDKLGGDLEVIQEVALKYFKVGMEKSIEV 108

Query: 121 MGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNW 164
           MG        V               + + +     R   ++  
Sbjct: 109 MGGDPKKVEFVLASEILEKGDYWQTVIDISKNVTLSRVMRSITI 152


>3bjqE [x.x.x] PHAGE-RELATED PROTEIN
          Length = 299

 Score = 69.6 bits (169), Expect = 3e-14
 Identities = 20/236 (8%), Positives = 46/236 (19%), Gaps = 26/236 (11%)

Query: 151 EKGIAYRKTGTVNWDPVD---QTVLANEQVIDG-----RGWRSGAVVEKREIPMYYLRIT 202
           E    Y        +              ++                +   I +    + 
Sbjct: 45  EAFRLYNTKRAPGANTKRIDFGYEGDPYSIVPSALEAKVPRELRDASQVPGIDLGARSVN 104

Query: 203 DYAQELLGDLEGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKL-INDGKLYVFTT 261
              +  L                             +          +      +     
Sbjct: 105 TVLRIALAHEHECAQIALDPAKYNADHKVKLVGSARWTSPDSDPTKDVETAKEAIADSIG 164

Query: 262 RADTIMGVTFCAVAAEHPLATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLK 321
             + ++     +    HP      +            +  S+     A  E + +  G  
Sbjct: 165 EPNRLLSRKALSACKYHPKLIERVKYT----------RAESITIDLKALWEVEEIVVGTA 214

Query: 322 VTHPLTGEQVDVWVGNYVLMTYGDGAVMGVPAHDERDFAFALKYNLPIKQVIDVKG 377
                T    DVW  +  L       V   P     + +F   Y +    +++V  
Sbjct: 215 RVA--TDSFGDVWGPDVWLG-----YVSDNPDPSVEEPSFGYTYQIEGHPLVEVPY 263


>3ci0I [x.x.x] PSEUDOPILIN GSPI
          Length = 81

 Score = 69.5 bits (170), Expect = 4e-14
 Identities = 7/81 (8%), Positives = 20/81 (24%), Gaps = 17/81 (20%)

Query: 73  RMNGRNV------------LMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQS 120
            +  + V             +  G  A     E+ A         +           +Q+
Sbjct: 3   VLEEKTVAGWVAENQTALLYLTRGQRAVRQQGESDA-----GSRWYWRTTPLSTGNALQA 57

Query: 121 MGLAIDWSREVATCSPEYYRW 141
           + + +    + ++       W
Sbjct: 58  VDIEVSLHEDFSSVIQSRRAW 78


>2cfoB [x.x.x] GLUTAMYL-TRNA SYNTHETASE
          Length = 487

 Score = 66.7 bits (161), Expect = 2e-13
 Identities = 23/119 (19%), Positives = 40/119 (33%), Gaps = 21/119 (17%)

Query: 46  MLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAA 105
           + P P+G LH+G  R    N + AR+    G+ +L     D                   
Sbjct: 6   LAPSPTGNLHIGTARTAVFNWLYARH--RGGKFILRIEDTD----------------RER 47

Query: 106 WTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNW 164
              +    + + +Q +GL  D          +     +     +L+KG+AY    T   
Sbjct: 48  SRPEYTENILEGLQWLGLTWDE---GPYFQSDRLDLYRQAIQTLLDKGLAYYCYCTPEE 103



 Score = 48.6 bits (114), Expect = 7e-08
 Identities = 34/343 (9%), Positives = 73/343 (21%), Gaps = 33/343 (9%)

Query: 492 CTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAI 551
           C C      A R                R+  P+     +A     +   +     +   
Sbjct: 97  CYCTPEELEALRAEQKAKGQAPRYDNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEW 156

Query: 552 LHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQT 611
             L+  R   +     G +              + N     +D +   T     +  +  
Sbjct: 157 QDLVRGRVSWQGADLGGDMVIARAAPRGEIGYPLYNLVVVVDDIAMGITDVIRGEDHIGN 216

Query: 612 DERGRPAGATAKADGQPVVIGGI------EKMSKSKNNGIDPQALIDQYGADTARLFVMF 665
             +         A         +      +K+SK              Y A     ++  
Sbjct: 217 TPKQILLYEALGATPPNFAHTPLILNSTGQKLSKRDGVTSISDFRAMGYLAPALANYMTL 276

Query: 666 AAPPEQQLEWSGSGVEGASRF--LRRVWNYGYANAQAI--RXXXXXXXXXXXXXLRREIH 721
                 +       ++ A++     R+   G                          E+ 
Sbjct: 277 LGWSPPEGVGELFTLDLAAKHFSFERINKAGARFDWDKLNWLNRQYIQQLEPEEFLAELI 336

Query: 722 TVLKQANYDYERIQYNTVVSATMKMLNAL-----------------------EDAKTASP 758
            + + A Y ++  +    +    ++L                          E       
Sbjct: 337 PLWQGAGYAFDEERDRPWLFDLAQLLQPGLNTLREAIDQGAVFFIPSVTFDSEAMAQLGQ 396

Query: 759 AGRREGFSVLLRVLYPVVPHIAHGLWQELGYAAETVDILDAAW 801
                  + LL  L            Q +  AA+   +   A 
Sbjct: 397 PQSATILAYLLEHLPAEPALTVAMGQQLIQQAAKAAGVKKGAT 439


>2cfoA [x.x.x] GLUTAMYL-TRNA SYNTHETASE
          Length = 484

 Score = 66.7 bits (161), Expect = 2e-13
 Identities = 35/227 (15%), Positives = 65/227 (28%), Gaps = 25/227 (11%)

Query: 46  MLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAA 105
           + P P+G LH+G  R    N + AR+    G+ +L     D                   
Sbjct: 6   LAPSPTGNLHIGTARTAVFNWLYARH--RGGKFILRIEDTD----------------RER 47

Query: 106 WTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWD 165
              +    + + +Q +GL  D          +     +     +L+KG+AY    T    
Sbjct: 48  SRPEYTENILEGLQWLGLTWDEGP---YFQSDRLDLYRQAIQTLLDKGLAYYCYCTPEEL 104

Query: 166 PVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGLGWPERVKIMQ 225
              +     +        R   +  + +        T   +  + D   + W + V+   
Sbjct: 105 EALRAEQKAKGQAPRYDNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRV 164

Query: 226 QNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFC 272
                   G         +G  G         +     D  MG+T  
Sbjct: 165 SWQGADLGGDMVIARAAPRGEIG----YPLYNLVVVVDDIAMGITDV 207



 Score = 46.7 bits (109), Expect = 3e-07
 Identities = 24/345 (6%), Positives = 63/345 (18%), Gaps = 51/345 (14%)

Query: 489 FLECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIE 548
            L     + G+  R +        +    +               +      D   G + 
Sbjct: 106 ALRAEQKAKGQAPRYDNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRVS 165

Query: 549 HAILHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVD 608
                L       +      +                       +D +   T     +  
Sbjct: 166 WQGADLGGDMVIARAAPRGEIGYPLYNLV------------VVVDDIAMGITDVIRGEDH 213

Query: 609 VQTDERGRPAGATAKADGQPVVIGGI------EKMSKSKNNGIDPQALIDQYGADTARLF 662
           +    +         A         +      +K+SK              Y A     +
Sbjct: 214 IGNTPKQILLYEALGATPPNFAHTPLILNSTGQKLSKRDGVTSISDFRAMGYLAPALANY 273

Query: 663 VMFAAPPEQQLEWSGSGVEGASRF--LRRVWNYGYANAQAIRXXXXXXXXXXXXXLRREI 720
           +        +       ++ A++     R+   G                     L    
Sbjct: 274 MTLLGWSPPEGVGELFTLDLAAKHFSFERINKAGARFDWDK--------------LNWLN 319

Query: 721 HTVLKQANYDYERIQYNTVVSATMKMLNALEDAKTASPAGRREGFSVLLRVLYPVVPHIA 780
              ++Q   +    +   +        +   D                       +  + 
Sbjct: 320 RQYIQQLEPEEFLAELIPLWQGAGYAFDEERDRPWLFD-----------------LAQLL 362

Query: 781 HGLWQELGYAAETVDILDAAWPQVDEAALVRSEIELVLQVNGKVR 825
                 L  A +   +        D  A+ +        +   + 
Sbjct: 363 QPGLNTLREAIDQGAVFFIPSVTFDSEAMAQLGQPQSATILAYLL 407


>2an2A [x.x.x] P332G A333S DOUBLE MUTANT OF NITRIC OXIDE
          Length = 360

 Score = 66.3 bits (161), Expect = 3e-13
 Identities = 20/210 (9%), Positives = 45/210 (21%), Gaps = 19/210 (9%)

Query: 352 PAHDERDFAFA----LKYNLPIKQVIDVK----GQAYSTDAWLEWYGDKEHGLCIHSGKY 403
               +R  +      L  +    +             S       + +  + +     + 
Sbjct: 25  EEVADRLDSIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRT 84

Query: 404 DGLGYXXXXXXXXXXXXXXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPE 463
                                      +   + G  +   W   +          +  P 
Sbjct: 85  KEDVRDALFHHIETATNNGKIRPSITIFPPEEKGEKQVEIWNHQLIRYAGYEGEAIGDPA 144

Query: 464 KDLPVVLPEDLVPDGTGNPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYTC 523
                   E L   G        P           +P   E       I+    +     
Sbjct: 145 SCSLTAACEQLGWRGERTDFDLLPLIFRMK--GDEQPVWYELPR-SLVIEVPITHPDI-- 199

Query: 524 PDAGTMVDARNDYWMP----MDQYIGGIEH 549
            +A + ++ +  Y +P    M   +GGI +
Sbjct: 200 -EAFSDLELKW-YGVPIISDMKLEVGGIHY 227


>1b25A [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN
           OXIDOREDUCTASE)
          Length = 611

 Score = 63.0 bits (151), Expect = 3e-12
 Identities = 22/119 (18%), Positives = 38/119 (31%), Gaps = 14/119 (11%)

Query: 1   MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR 60
               Y    + +AA + +  I AY V E     D K              SG     H+ 
Sbjct: 505 TGVTYTWDDLYKAADRVYSLIRAYWVREFNGKWDRKMDYPPKRWFTEGLKSGPHKGEHLD 564

Query: 61  NYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQ 119
               +++++ Y R+         GWD  G+P +       +         I  ++K   
Sbjct: 565 EKKYDELLSEYYRI--------RGWDERGIPKKETLKELDLD------FVIPELEKVTN 609


>2cybA [x.x.x] TYROSYL-TRNA SYNTHETASE
          Length = 319

 Score = 59.9 bits (144), Expect = 3e-11
 Identities = 24/114 (21%), Positives = 40/114 (35%), Gaps = 13/114 (11%)

Query: 36  KEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENA 95
           + K K  A      PSG++H+GH             + +     L   G++   + A+  
Sbjct: 27  ETKEKPRAYVGYE-PSGEIHLGH------------MMTVQKLMDLQEAGFEIIVLLADIH 73

Query: 96  ALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKM 149
           A  N         +   Y KK   ++GL    ++ V     +  R      LKM
Sbjct: 74  AYLNEKGTFEEIAEVADYNKKVFIALGLDESRAKFVLGSEYQLSRDYVLDVLKM 127


>2c1qA [x.x.x] BIOTIN BINDING PROTEIN A
          Length = 123

 Score = 58.8 bits (142), Expect = 6e-11
 Identities = 5/86 (5%), Positives = 15/86 (17%), Gaps = 4/86 (4%)

Query: 46  MLPYPSGK-LHMGHVRNYTINDVMARYLRMNGRNVLMPM---GWDAFGMPAENAALNNGV 101
                +     +                   G  V            G    +      +
Sbjct: 33  YQTAVTATNKQILVSPLKGAQQPPKGQQPTFGFTVQWQFADSTTVFVGQCFVDRRGKEML 92

Query: 102 APAAWTYDNIAYMKKQMQSMGLAIDW 127
             A    + +   K   ++  +  + 
Sbjct: 93  EMAWLLREEVPSRKDTWKATRVGTNV 118


>3e4cB [x.x.x] CASPASE-1
          Length = 269

 Score = 53.3 bits (127), Expect = 3e-09
 Identities = 11/133 (8%), Positives = 22/133 (16%), Gaps = 14/133 (10%)

Query: 33  PDGKEKSKFYACSMLPYPSGKLHMGHVRNYTI-NDVMARYLRMNGRN--VLMPMGWDAFG 89
                           +      +       +    M   L+  G +  V   +      
Sbjct: 30  DKSSRTRLALIICNEEFD----SIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMT 85

Query: 90  MPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKM 149
              E  A       +  T+        +    G                      +F  +
Sbjct: 86  TELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQL-------NAIFNML 138

Query: 150 LEKGIAYRKTGTV 162
             K     K    
Sbjct: 139 NTKNCPSLKDKPK 151


>3e4cA [x.x.x] CASPASE-1
          Length = 271

 Score = 42.1 bits (98), Expect = 6e-06
 Identities = 12/109 (11%), Positives = 23/109 (21%), Gaps = 10/109 (9%)

Query: 55  HMGHVRNYTI-NDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAY 113
            +       +    M   L+  G +V +    +                P   T D+   
Sbjct: 50  SIPRRTGAEVDITGMTMLLQNLGYSVDVKK--NLTASDMTTELEAFAHRPEHKTSDSTFL 107

Query: 114 MKKQMQSMG--LAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTG 160
           +               S +V             +F  +  K     K  
Sbjct: 108 VFMSHGIREGICGKKHSEQVPDILQ-----LNAIFNMLNTKNCPSLKDK 151


>3d5hA [x.x.x] HAEMENTHIN
          Length = 272

 Score = 39.1 bits (90), Expect = 5e-05
 Identities = 11/67 (16%), Positives = 18/67 (26%), Gaps = 4/67 (5%)

Query: 81  MPMGWDAFGMPAENAALNNGVAPAA-WTYDNIAYMKKQMQSMGLAIDWS--REVATCSPE 137
                   G PA   A  +G  P     +      KK  +  G+ + W    +  +    
Sbjct: 207 ARTKKVFLGFPAHPDAAGSGYMPPEKVKFHVFPAAKKSYKFGGIML-WDSYWDTVSNFSS 265

Query: 138 YYRWNQW 144
                 W
Sbjct: 266 KILGEGW 272


>1bdgA [x.x.x] HEXOKINASE
          Length = 444

 Score = 36.6 bits (83), Expect = 3e-04
 Identities = 5/73 (6%), Positives = 16/73 (21%)

Query: 106 WTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWD 165
                  + K              E            + + + ++E+ I +R        
Sbjct: 256 LDCWRTQFDKSMDIDSLHPGKQLYEKMVSGMYLGELVRHIIVYLVEQKILFRGDLPERLK 315

Query: 166 PVDQTVLANEQVI 178
             +  +      +
Sbjct: 316 VRNSLLTRYLTDV 328


>2crqA [x.x.x] MITOCHONDRIAL TRANSLATIONAL INITIATION FACTOR 3
          Length = 112

 Score = 36.4 bits (84), Expect = 3e-04
 Identities = 4/99 (4%), Positives = 10/99 (10%), Gaps = 25/99 (25%)

Query: 352 PAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYXXX 411
               + D     K                           ++      + K         
Sbjct: 22  SNIGQHDLDTKSKQIQQW---------------------IEKKYHVQVTIKRRKDAEQSE 60

Query: 412 XXXXXXXXXXXXXXEKK--VTWRLRDWGISRQRYWGTPI 448
                               + R +              
Sbjct: 61  EETEEIFNQILQTMPDIATFSSRPKAIRGGTA--SMCVF 97


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0464    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 26,891,981
Number of extensions: 1707441
Number of successful extensions: 18702
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8109
Number of HSP's successfully gapped: 485
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)