RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABF07569.1 rmet0 ABF07569.1 GIB00349CH01 "Smr protein/MutS2"
         (224 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01713 Smr "Smr domain"                                               66   5e-14

>PF01713 Smr "Smr domain"
          Length = 83

 Score = 65.8 bits (160), Expect = 5e-14
 Identities = 40/84 (47%), Positives = 50/84 (59%), Gaps = 5/84 (5%)

Query: 139 VDLHGLRSDEAREALANFLRRSVRNGVRCVRVIHGKGIGSPDKLPVLKGKVRSWLVQK-- 196
           +DLHGL  +EA EAL  FL ++   G+RCV VIHGK  G+  K  VL+  VR WL +   
Sbjct: 1   LDLHGLTVEEALEALEEFLDQAELKGIRCVLVIHGK--GNHSKGGVLRKAVRKWLKEGYR 58

Query: 197 -EEVIAFVQARESQGGAGALMVLL 219
             EV+AF  A   +GG GA  V L
Sbjct: 59  FPEVLAFHDASPREGGPGATYVTL 82


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.319    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0520    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 18,029,343
Number of extensions: 1021081
Number of successful extensions: 133066
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2389
Number of HSP's successfully gapped: 225
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)