RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABF07996.1 rmet0 ABF07996.1 GIB00349CH01 "Orn/DAP/Arg
decarboxylase 2"
         (397 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF02784 Orn_Arg_deC_N "Pyridoxal-dependent decarboxylase, pyrido...   129   9e-33
PF01116 F_bP_aldolase "Fructose-bisphosphate aldolase class-II"        34   4e-04

>PF02784 Orn_Arg_deC_N "Pyridoxal-dependent decarboxylase, pyridoxal
           binding domain"
          Length = 249

 Score =  129 bits (324), Expect = 9e-33
 Identities = 93/242 (38%), Positives = 131/242 (54%), Gaps = 18/242 (7%)

Query: 41  PEQCALYYAVKANSDAPVLRALLGVADGFEVASFGEIERVRGVDAEVP---IAFGGPGKT 97
           P    +YYAVKANS+  VLR L     G +VAS GE+ER   + A VP   I F GP K 
Sbjct: 16  PRDYQVYYAVKANSNPAVLRLLAEEGLGLDVASKGELERA--LAAGVPPERIIFSGPNKD 73

Query: 98  DAELEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRANPAYGLPGAT---LQMG 154
           D EL  AL  GV LI V+S  +L RL  +A   G  A V LR NP  G+   T   +  G
Sbjct: 74  DEELRLALEAGVVLIVVDSLDELERLAELAPELGVKARVGLRVNP--GVSAGTHEYISTG 131

Query: 155 GGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALAKRLR 214
           G  ++FG+     P+ L +++ +  + +VGLH H GS   D +  +  ++  + L   LR
Sbjct: 132 GEDSKFGLTLEEAPEALERAKEL-GLELVGLHFHIGSQITDPEPFVQALEEALRLFDELR 190

Query: 215 DLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETA---PSTRIVFECGRFI 271
           +L G+ L++L++GGG+GIDY   +  +D + +   + A L E     P  RI+ E GR I
Sbjct: 191 EL-GIPLKFLDLGGGLGIDY---DGDYDLEEYADAIVAALEELCEELPGPRIIIEPGRAI 246

Query: 272 SA 273
            A
Sbjct: 247 VA 248


>PF01116 F_bP_aldolase "Fructose-bisphosphate aldolase class-II"
          Length = 285

 Score = 34.0 bits (77), Expect = 4e-04
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 76  EIERVRGVDAEVPIAF---GGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAVAR 128
           + ER++ +   V +     GG G  D E+  A++ GV  I++++ LQL+  DAV +
Sbjct: 191 DFERLKEIQEAVGVPLVLHGGSGVPDEEIREAIKYGVRKINIDTDLQLAFTDAVRK 246


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.327    0.138    0.458 

Gapped
Lambda     K      H
   0.267   0.0504    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 21,638,473
Number of extensions: 1234314
Number of successful extensions: 156257
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2564
Number of HSP's successfully gapped: 180
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)