BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE38253.1 rpal2 ABE38253.1 GIB00345CH01 "monooxygenase,
FAD-binding"
         (540 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3fmwA [x.x.x] OXYGENASE                                                93   2e-21
3fmwC [x.x.x] OXYGENASE                                                90   1e-20
2qa1A [x.x.x] POLYKETIDE OXYGENASE PGAE                                88   5e-20
3fmwB [x.x.x] OXYGENASE                                                88   5e-20
2qa2A [x.x.x] POLYKETIDE OXYGENASE CABE                                86   3e-19
1pn0C [c.3.1 - d.16.1 - c.47.1] PHENOL 2-MONOOXYGENASE                 79   4e-17
1fohD [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE                     77   2e-16
1fohC [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE                     77   2e-16
1pn0A [c.3.1 - d.16.1 - c.47.1] PHENOL 2-MONOOXYGENASE                 76   2e-16
2dkiA [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE                            75   4e-16
1fohB [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE                     74   1e-15
1fohA [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE                     74   1e-15
2dkhA [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE                            72   4e-15
3ihgA [x.x.x] RDME                                                     71   8e-15
2r0gB [x.x.x] REBC                                                     70   1e-14
2r0gA [x.x.x] REBC                                                     70   1e-14
2r0cA [x.x.x] REBC                                                     69   4e-14
2r0pA [x.x.x] REBC                                                     68   7e-14
3eptB [x.x.x] REBC                                                     67   2e-13
3eptA [x.x.x] REBC                                                     67   2e-13
1cc4A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)         42   3e-06
1bgjA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            42   4e-06
1ykjB [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   1e-05
1ykjA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   1e-05
1pxcA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   1e-05
1pbfA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   1e-05
1dobA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   1e-05
1d7lA [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE                   40   1e-05
1pxbA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   2e-05
1phhA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   2e-05
1pbeA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   2e-05
1pbbA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   2e-05
1cj4A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)         40   2e-05
1cj3A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)         40   2e-05
1cj2A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)         40   2e-05
1bkwA [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)         40   2e-05
1bgnA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   2e-05
1bf3A [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE                            40   2e-05
1k0iA [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE                   39   4e-05
1cc6A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)         38   8e-05

>3fmwA [x.x.x] OXYGENASE
          Length = 482

 Score = 92.8 bits (229), Expect = 2e-21
 Identities = 73/255 (28%), Positives = 110/255 (43%), Gaps = 24/255 (9%)

Query: 112 LPETGHKMPAFINLQQYYAEAYLVERVQQLPQIDLRWRNKVTALAQHNDHAVLTIETPDG 171
           L +T H     +   Q   EA L E  ++    ++   ++VT L Q  +   +T+  P G
Sbjct: 84  LVDTRHPYTGLV--PQSRTEALLAEHAREAGA-EIPRGHEVTRLRQDAEAVEVTVAGPSG 140

Query: 172 SYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFPTERWFWFDPPFH 231
            Y + A Y V CDG RS +R +    F G     + LI  V         RW        
Sbjct: 141 PYPVRARYGVGCDGGRSTVRRLAADRFPGTEATVRALIGYVTTPEREVPRRW-------- 192

Query: 232 SGQSALLHRQPDNVWRIDLQIGADADAAVERLP---ENVRPRIERMLGNSDFSFE---WI 285
                   R PD +  +    G  + +     P   E++   + R+ G      E   W+
Sbjct: 193 -------ERTPDGILVLAFPPGWSSSSTGHSGPVTLEDLGAAVARVRGTPLTLTEPVSWL 245

Query: 286 SIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPA 345
           S +    R+ +R+   RV+ AGD+AH   P G +G N+GL+D  N+ WKLA  +RG    
Sbjct: 246 SRFGDASRQAKRYRSGRVLLAGDAAHVHFPIGGQGLNTGLQDAVNLGWKLAARVRGWGSE 305

Query: 346 SLLDSYEIERSQAAD 360
            LLD+Y  ER   A+
Sbjct: 306 ELLDTYHDERHPVAE 320


>3fmwC [x.x.x] OXYGENASE
          Length = 489

 Score = 90.1 bits (222), Expect = 1e-20
 Identities = 74/258 (28%), Positives = 108/258 (41%), Gaps = 28/258 (10%)

Query: 112 LPETGHKMPAFINLQQYYAEAYLVERVQQLPQIDLRWRNKVTALAQHNDHAVLTIETPDG 171
           L +T H     +   Q   EA L E  ++    ++   ++VT L Q  +   +T+  P G
Sbjct: 86  LVDTRHPYTGLV--PQSRTEALLAEHAREAGA-EIPRGHEVTRLRQDAEAVEVTVAGPSG 142

Query: 172 SYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFPTERW-------- 223
            Y + A Y V CDG RS +R +    F G     + LI  V         RW        
Sbjct: 143 PYPVRARYGVGCDGGRSTVRRLAADRFPGTEATVRALIGYVTTPEREVPRRWERTPDGIL 202

Query: 224 -FWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDFSF 282
              F P + S  +      P  +         D  AAV R+        E +        
Sbjct: 203 VLAFPPGWSSSSTGHSDEGPVTL--------EDLGAAVARVRGTPLTLTEPV-------- 246

Query: 283 EWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGD 342
            W+S +    R+ +R+   RV+ AGD+AH   P G +G N+GL+D  N+ WKLA  +RG 
Sbjct: 247 SWLSRFGDASRQAKRYRSGRVLLAGDAAHVHFPIGGQGLNTGLQDAVNLGWKLAARVRGW 306

Query: 343 APASLLDSYEIERSQAAD 360
               LLD+Y  ER   A+
Sbjct: 307 GSEELLDTYHDERHPVAE 324


>2qa1A [x.x.x] POLYKETIDE OXYGENASE PGAE
          Length = 488

 Score = 88.2 bits (217), Expect = 5e-20
 Identities = 79/297 (26%), Positives = 124/297 (41%), Gaps = 26/297 (8%)

Query: 65  SRAICFSKRALEVWDRLGVGARM--VEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMPAF 122
           SR + F+ R +EV+D+ G+  R   VE       G +         F +L        A 
Sbjct: 43  SRGLGFTARTMEVFDQRGILPRFGEVETSTQGHFGGL------PIDFGVLEGAWQ---AA 93

Query: 123 INLQQYYAEAYLVERVQQLPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVA 182
             + Q   E +L +    L   D+R  ++V +L        + +  P+G + L A Y+V 
Sbjct: 94  KTVPQSVTETHLEQWATGLGA-DIRRGHEVLSLTDDGAGVTVEVRGPEGKHTLRAAYLVG 152

Query: 183 CDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQP 242
           CDG RS++R   G +F G     +  +AD++   E           P   G++       
Sbjct: 153 CDGGRSSVRKAAGFDFPGTAATMEMYLADIK-GVELQ---------PRMIGETXXXXXXX 202

Query: 243 DNVWRIDLQIGADADAAVERLPE--NVRPRIERMLGNSDFSFE--WISIYKFQCRRMQRF 298
                  +      +      P    V    +R+ G+     E  W+S +    R++  +
Sbjct: 203 XXXXXXXITRIIVCERGTPPPPSWHEVADAWKRLTGDDIAHAEPVWVSAFGNATRQVTEY 262

Query: 299 LHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIER 355
              RVI AGDSAH   P G +G N+ ++D  N+ WKL  V+ G A   LLDSY  ER
Sbjct: 263 RRGRVILAGDSAHIHLPAGGQGMNTSIQDAVNLGWKLGAVVNGTATEELLDSYHSER 319


>3fmwB [x.x.x] OXYGENASE
          Length = 479

 Score = 88.2 bits (217), Expect = 5e-20
 Identities = 73/249 (29%), Positives = 109/249 (43%), Gaps = 17/249 (6%)

Query: 112 LPETGHKMPAFINLQQYYAEAYLVERVQQLPQIDLRWRNKVTALAQHNDHAVLTIETPDG 171
           L +T H     +   Q   EA L E  ++    ++   ++VT L Q  +   +T+  P G
Sbjct: 86  LVDTRHPYTGLV--PQSRTEALLAEHAREAGA-EIPRGHEVTRLRQDAEAVEVTVAGPSG 142

Query: 172 SYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFPTERWFWFDPPFH 231
            Y + A Y V CDG RS +R +    F G     + LI  V    E P     W   P  
Sbjct: 143 PYPVRARYGVGCDGGRSTVRRLAADRFPGTEATVRALIGYVT-TPEVPRR---WERTP-- 196

Query: 232 SGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDFSFEWISIYKFQ 291
                +L   P+  W       +D         E++   + R+ G       W+S +   
Sbjct: 197 -DGILVLAFPPEGGWSSSSTGHSDEGPVTL---EDLGAAVARVRG----PVSWLSRFGDA 248

Query: 292 CRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDSY 351
            R+ +R+   RV+ AGD+AH   P G +G N+GL+D  N+ WKLA  +RG     LLD+Y
Sbjct: 249 SRQAKRYRSGRVLLAGDAAHVHFPIGGQGLNTGLQDAVNLGWKLAARVRGWGSEELLDTY 308

Query: 352 EIERSQAAD 360
             ER   A+
Sbjct: 309 HDERHPVAE 317


>2qa2A [x.x.x] POLYKETIDE OXYGENASE CABE
          Length = 489

 Score = 85.5 bits (210), Expect = 3e-19
 Identities = 89/334 (26%), Positives = 134/334 (40%), Gaps = 43/334 (12%)

Query: 39  LSLAIDLAQRGENVVLLDDADRIGEGSRAICFSKRALEVWDRLGV--------------- 83
           L LA +L   G +V++L+   +    SR + F+ R +EV+D+ G+               
Sbjct: 15  LMLAGELRLGGVDVMVLEQLPQRTGESRGLGFTARTMEVFDQRGILPAFGPVETSTQGHF 74

Query: 84  GARMVEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQLPQ 143
           G R V+ GV+         +   Y    +P++           +   E + + R  +L +
Sbjct: 75  GGRPVDFGVL---------EGAHYGVKAVPQS---------TTESVLEEWALGRGAELLR 116

Query: 144 IDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVF 203
                 + V AL                   L   YVV CDG RS +R   G +F G   
Sbjct: 117 -----GHTVRALTXXXXXXXXXXXXXXXXRSLTTRYVVGCDGGRSTVRKAAGFDFPGTSA 171

Query: 204 EDQFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERL 263
             +  +AD+R   E  T R      P     SA L    D +   +              
Sbjct: 172 SREMFLADIR-GCEI-TPRPIGETVPLGMVMSAPLGDGVDRIIVCEXXXXXXXXXXXXXY 229

Query: 264 PENVRPRIERMLGNSDFSFE--WISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGA 321
            E V    +R+ G      E  W+S +    R++  +   RV+ AGDSAH   P G +G 
Sbjct: 230 QE-VAAAWQRLTGQDISHGEPVWVSAFGDPARQVSAYRRGRVLLAGDSAHVHLPAGGQGM 288

Query: 322 NSGLEDGENIAWKLAMVLRGDAPASLLDSYEIER 355
           N  ++D  N+ WKLA V+ G APA LLD+Y  ER
Sbjct: 289 NVSVQDSVNLGWKLAAVVSGRAPAGLLDTYHEER 322


>1pn0C [c.3.1 - d.16.1 - c.47.1] PHENOL 2-MONOOXYGENASE
          Length = 656

 Score = 78.6 bits (192), Expect = 4e-17
 Identities = 63/211 (29%), Positives = 94/211 (44%), Gaps = 18/211 (8%)

Query: 165 TIETPDGSYRLA------------ADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADV 212
           T E  D +YRL               YV+ CDG  S +R  +G E  GE  +  + + D 
Sbjct: 194 TQEEEDANYRLPEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVLDA 253

Query: 213 RMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIE 272
              + FP  R         SG   ++ R+ +N+ R  +Q+ A  D   +  PE V    +
Sbjct: 254 VPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQLQARVDRT-KFTPEVVIANAK 311

Query: 273 RMLGNSDFS---FEWISIYKFQCRRMQRFLH-ERVIFAGDSAHQVSPFGARGANSGLEDG 328
           ++     F     +W + Y    R  ++F   ERV  AGD+ H  SP   +G N+ + D 
Sbjct: 312 KIFHPYTFDVQQLDWFTAYHIGQRVTEKFSKDERVFIAGDACHTHSPKAGQGMNTSMMDT 371

Query: 329 ENIAWKLAMVLRGDAPASLLDSYEIERSQAA 359
            N+ WKL +VL G A   +L +YE ER   A
Sbjct: 372 YNLGWKLGLVLTGRAKRDILKTYEEERQPFA 402


>1fohD [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE
          Length = 654

 Score = 76.6 bits (187), Expect = 2e-16
 Identities = 61/207 (29%), Positives = 92/207 (44%), Gaps = 20/207 (9%)

Query: 165 TIETPDGSYRLA------------ADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADV 212
           T E  D +YRL               YV+ CDG  S +R  +G E  GE  +  + + D 
Sbjct: 194 TQEEEDANYRLPEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVLDA 253

Query: 213 RMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIE 272
              + FP  R         SG   ++ R+ +N+ R  +Q+  D     +  PE V    +
Sbjct: 254 VPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQLQVDR---TKFTPEVVIANAK 309

Query: 273 RMLGNSDFS---FEWISIYKFQCRRMQRFLH-ERVIFAGDSAHQVSPFGARGANSGLEDG 328
           ++     F     +W + Y    R  ++F   ERV  AGD+ H  SP   +G N+ + D 
Sbjct: 310 KIFHPYTFDVQQLDWFTAYHIGQRVTEKFSKDERVFIAGDACHTHSPKAGQGMNTSMMDT 369

Query: 329 ENIAWKLAMVLRGDAPASLLDSYEIER 355
            N+ WKL +VL G A   +L +YE ER
Sbjct: 370 YNLGWKLGLVLTGRAKRDILKTYEEER 396


>1fohC [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE
          Length = 656

 Score = 76.6 bits (187), Expect = 2e-16
 Identities = 61/207 (29%), Positives = 92/207 (44%), Gaps = 20/207 (9%)

Query: 165 TIETPDGSYRLA------------ADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADV 212
           T E  D +YRL               YV+ CDG  S +R  +G E  GE  +  + + D 
Sbjct: 194 TQEEEDANYRLPEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVLDA 253

Query: 213 RMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIE 272
              + FP  R         SG   ++ R+ +N+ R  +Q+  D     +  PE V    +
Sbjct: 254 VPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQLRVDR---TKFTPEVVIANAK 309

Query: 273 RMLGNSDFS---FEWISIYKFQCRRMQRFLH-ERVIFAGDSAHQVSPFGARGANSGLEDG 328
           ++     F     +W + Y    R  ++F   ERV  AGD+ H  SP   +G N+ + D 
Sbjct: 310 KIFHPYTFDVQQLDWFTAYHIGQRVTEKFSKDERVFIAGDACHTHSPKAGQGMNTSMMDT 369

Query: 329 ENIAWKLAMVLRGDAPASLLDSYEIER 355
            N+ WKL +VL G A   +L +YE ER
Sbjct: 370 YNLGWKLGLVLTGRAKRDILKTYEEER 396


>1pn0A [c.3.1 - d.16.1 - c.47.1] PHENOL 2-MONOOXYGENASE
          Length = 652

 Score = 76.3 bits (186), Expect = 2e-16
 Identities = 62/211 (29%), Positives = 93/211 (44%), Gaps = 22/211 (10%)

Query: 165 TIETPDGSYRLA------------ADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADV 212
           T E  D +YRL               YV+ CDG  S +R  +G E  GE  +  + + D 
Sbjct: 194 TQEEEDANYRLPEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVLDA 253

Query: 213 RMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIE 272
              + FP  R         SG   ++ R+ +N+ R  +Q+      A +  PE V    +
Sbjct: 254 VPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQL-----QATKFTPEVVIANAK 307

Query: 273 RMLGNSDFS---FEWISIYKFQCRRMQRFLH-ERVIFAGDSAHQVSPFGARGANSGLEDG 328
           ++     F     +W + Y    R  ++F   ERV  AGD+ H  SP   +G N+ + D 
Sbjct: 308 KIFHPYTFDVQQLDWFTAYHIGQRVTEKFSKDERVFIAGDACHTHSPKAGQGMNTSMMDT 367

Query: 329 ENIAWKLAMVLRGDAPASLLDSYEIERSQAA 359
            N+ WKL +VL G A   +L +YE ER   A
Sbjct: 368 YNLGWKLGLVLTGRAKRDILKTYEEERQPFA 398


>2dkiA [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
          Length = 615

 Score = 75.1 bits (183), Expect = 4e-16
 Identities = 74/291 (25%), Positives = 120/291 (41%), Gaps = 31/291 (10%)

Query: 95  QVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQLP-QIDLRWRNKVT 153
           Q G+I R   +    D L E  H     + L Q     + +ER++  P +++  +  +V 
Sbjct: 113 QPGRIARHGRVQDTEDGLSEFPH-----VILNQARVHDHYLERMRNSPSRLEPHYARRVL 167

Query: 154 ALAQHNDHA----VLTIETPDGSYR-----LAADYVVACDGARSALRGMVGAEFAGEVFE 204
            +   +  A     +T+E  D ++      + A YVV CDGARS +R  +G +  G+   
Sbjct: 168 DVKVDHGAADYPVTVTLERCDAAHAGQIETVQARYVVGCDGARSNVRRAIGRQLVGDSAN 227

Query: 205 DQFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLP 264
             + + DV    +FP  R   +     S Q  +L    +    +   +  D +  VE+L 
Sbjct: 228 QAWGVMDVLAVTDFPDVR---YKVAIQSEQGNVLIIPREGGHLVRFYVEMDRNITVEQLI 284

Query: 265 ENVRPRIERMLGNSDFSFEWISIYKFQCRRMQRFLH------------ERVIFAGDSAHQ 312
              + R+         +  W S+Y+   R   ++               RV  AGD+ H 
Sbjct: 285 ATAQ-RVLHPYKLEVKNVPWWSVYEIGQRICAKYDDVVDAVATPDSPLPRVFIAGDACHT 343

Query: 313 VSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAADDNI 363
            SP   +G N  ++D  N+ WKLA VLR      LL +Y  ER   A   I
Sbjct: 344 HSPKAGQGMNFSMQDSFNLGWKLAAVLRKQCAPELLHTYSSERQVVAQQLI 394


>1fohB [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE
          Length = 651

 Score = 73.9 bits (180), Expect = 1e-15
 Identities = 60/207 (28%), Positives = 91/207 (43%), Gaps = 25/207 (12%)

Query: 165 TIETPDGSYRLA------------ADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADV 212
           T E  D +YRL               YV+ CDG  S +R  +G E  GE  +  + + D 
Sbjct: 194 TQEEEDANYRLPEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVLDA 253

Query: 213 RMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIE 272
              + FP  R         SG   ++ R+ +N+ R  +Q+        +  PE V    +
Sbjct: 254 VPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQL--------QFTPEVVIANAK 304

Query: 273 RMLGNSDFS---FEWISIYKFQCRRMQRFLH-ERVIFAGDSAHQVSPFGARGANSGLEDG 328
           ++     F     +W + Y    R  ++F   ERV  AGD+ H  SP   +G N+ + D 
Sbjct: 305 KIFHPYTFDVQQLDWFTAYHIGQRVTEKFSKDERVFIAGDACHTHSPKAGQGMNTSMMDT 364

Query: 329 ENIAWKLAMVLRGDAPASLLDSYEIER 355
            N+ WKL +VL G A   +L +YE ER
Sbjct: 365 YNLGWKLGLVLTGRAKRDILKTYEEER 391


>1fohA [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE
          Length = 649

 Score = 73.9 bits (180), Expect = 1e-15
 Identities = 60/207 (28%), Positives = 91/207 (43%), Gaps = 25/207 (12%)

Query: 165 TIETPDGSYRLA------------ADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADV 212
           T E  D +YRL               YV+ CDG  S +R  +G E  GE  +  + + D 
Sbjct: 194 TQEEEDANYRLPEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVLDA 253

Query: 213 RMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIE 272
              + FP  R         SG   ++ R+ +N+ R  +Q+        +  PE V    +
Sbjct: 254 VPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQL--------QFTPEVVIANAK 304

Query: 273 RMLGNSDFS---FEWISIYKFQCRRMQRFLH-ERVIFAGDSAHQVSPFGARGANSGLEDG 328
           ++     F     +W + Y    R  ++F   ERV  AGD+ H  SP   +G N+ + D 
Sbjct: 305 KIFHPYTFDVQQLDWFTAYHIGQRVTEKFSKDERVFIAGDACHTHSPKAGQGMNTSMMDT 364

Query: 329 ENIAWKLAMVLRGDAPASLLDSYEIER 355
            N+ WKL +VL G A   +L +YE ER
Sbjct: 365 YNLGWKLGLVLTGRAKRDILKTYEEER 391


>2dkhA [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
          Length = 614

 Score = 72.0 bits (175), Expect = 4e-15
 Identities = 73/291 (25%), Positives = 123/291 (42%), Gaps = 32/291 (10%)

Query: 95  QVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQLP-QIDLRWRNKVT 153
           Q G+I R   +    D L E  H     + L Q     + +ER++  P +++  +  +V 
Sbjct: 113 QPGRIARHGRVQDTEDGLSEFPH-----VILNQARVHDHYLERMRNSPSRLEPHYARRVL 167

Query: 154 ALAQHNDHA----VLTIETPDGSYR-----LAADYVVACDGARSALRGMVGAEFAGEVFE 204
            +   +  A     +T+E  D ++      + A YVV CDGARS +R  +G +  G+   
Sbjct: 168 DVKVDHGAADYPVTVTLERCDAAHAGQIETVQARYVVGCDGARSNVRRAIGRQLVGDSAN 227

Query: 205 DQFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLP 264
             + + DV    +FP  R +        G   ++ R+  ++ R  +++    +  VE+L 
Sbjct: 228 QAWGVMDVLAVTDFPDVR-YKVAIQSEQGNVLIIPREGGHLVRFYVEMD---NITVEQLI 283

Query: 265 ENVRPRIERMLGNSDFSFEWISIYKFQCRRMQRFLH------------ERVIFAGDSAHQ 312
              + R+         +  W S+Y+   R   ++               RV  AGD+ H 
Sbjct: 284 ATAQ-RVLHPYKLEVKNVPWWSVYEIGQRICAKYDDVVDAVATPDSPLPRVFIAGDACHT 342

Query: 313 VSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAADDNI 363
            SP   +G N  ++D  N+ WKLA VLR      LL +Y  ER   A   I
Sbjct: 343 HSPKAGQGMNFSMQDSFNLGWKLAAVLRKQCAPELLHTYSSERQVVAQQLI 393


>3ihgA [x.x.x] RDME
          Length = 535

 Score = 70.9 bits (172), Expect = 8e-15
 Identities = 104/403 (25%), Positives = 145/403 (35%), Gaps = 56/403 (13%)

Query: 146 LRWRNKVTALAQHNDHA----VLTIETPDGSYRLAADYVVACDGARSALRGMVG------ 195
           +R+  ++ +  QH+D A       +  PDG Y L A Y+V  DG RS +R  +G      
Sbjct: 137 IRFGTRLLSFRQHDDDAGAGVTARLAGPDGEYDLRAGYLVGADGNRSLVRESLGIGRYGH 196

Query: 196 ---AEFAGEVFEDQFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQI 252
                  G +F+     AD+    E  T  W++   P   G      R PD   R  L +
Sbjct: 197 GTLTHMVGVIFD-----ADLSGIMEPGTTGWYYLHHPEFKGTFGPTDR-PD---RHTLFV 247

Query: 253 GADADAAVERLPENVRPR-----IERMLGNSDFSFEWISI--YKFQCRRMQRFLHERVIF 305
             D D   ER PE+  P+     I   L   +   E + I  ++   R  +R+   RV  
Sbjct: 248 EYDPDEG-ER-PEDFTPQRCVELIGLALDAPEVKPELVDIQGWEMAARIAERWREGRVFL 305

Query: 306 AGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAADDNIRH 365
           AGD+A    P G    N+ + DG ++AWK              D+YE ER          
Sbjct: 306 AGDAAKVTPPTGGMSGNAAVADGFDLAWKXXXXXXXXXXXXXXDTYEDERKXXXXXXXXX 365

Query: 366 STR-STDFIAPHSKQEXXXXXXXXXXXXXXEFAKRMVNAGRLSTPTAYDTPLSTPDADAW 424
                   +APH  +                +    V A     P   + PL TP     
Sbjct: 366 XXXIYAQRMAPHMAEVWDKSVGYPETLLGFRYRSSAVLATD-DDPARVENPL-TPSGRPG 423

Query: 425 SAGPKXXXXXXXXXXXXXXXXPVFLTDAFKAAGCGFVLLEIANGA---------AAPAPQ 475
             GP                  +   D F   G G+ LL    GA               
Sbjct: 424 FRGPHVLVSRHGER--------LSTVDLF---GDGWTLLAGELGADWXXXXXXXXXXLGV 472

Query: 476 GVRSLRIGKDAPLRDEEGLFTKRYDATPGAAYLLRPDGYVAAR 518
            VR+ R+G  A L D E   ++RY      A L+RPDG VA R
Sbjct: 473 PVRAYRVG--AGLTDPESAVSERYGIGKAGASLVRPDGIVAWR 513


>2r0gB [x.x.x] REBC
          Length = 518

 Score = 70.5 bits (171), Expect = 1e-14
 Identities = 93/341 (27%), Positives = 141/341 (41%), Gaps = 37/341 (10%)

Query: 39  LSLAIDLAQRGENVVLLDDADRIGEGSRAICFSKRALEVWDRLGV----------GARMV 88
           ++LA+DLA R    ++++  D      R      R++E++ R GV          G   +
Sbjct: 17  MALALDLAHRQVGHLVVEQTDGTITHPRVGTIGPRSMELFRRWGVAKQIRTAGWPGDHPL 76

Query: 89  EKGVVWQVG--KIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQLPQIDL 146
           +   V +VG  +++R           PE   +  A     Q++    L E V +     L
Sbjct: 77  DAAWVTRVGGHEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGER----L 130

Query: 147 RWRNKVTALAQHNDHAVLTI-ETPDGSYRLA-ADYVVACDGARSALRGMVGAE----FAG 200
           R R+++ +  Q +DH   TI +   G+ R   A Y+VACDGA S  R  +G +       
Sbjct: 131 RTRSRLDSFEQRDDHVRATITDLRTGATRAVHARYLVACDGASSPTRKALGIDAPPRHRT 190

Query: 201 EVFED-QFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAA 259
           +VF +  F   ++R       ER                 R  D      L +G D   +
Sbjct: 191 QVFRNILFRAPELR---SLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVDTMDS 247

Query: 260 VERLPENVRPRIE-RMLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGA 318
            E +   V    E  +L +S    EW   +    R    F   RV   GD+AH +SP G 
Sbjct: 248 FELVRRAVAFDTEIEVLSDS----EWHLTH----RVADSFSAGRVFLTGDAAHTLSPSGG 299

Query: 319 RGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAA 359
            G N+G+    ++ WKLA  LRG A   LL +YE ER   A
Sbjct: 300 FGMNTGIGSAADLGWKLAATLRGWAGPGLLATYEEERRPVA 340


>2r0gA [x.x.x] REBC
          Length = 522

 Score = 70.5 bits (171), Expect = 1e-14
 Identities = 93/341 (27%), Positives = 141/341 (41%), Gaps = 37/341 (10%)

Query: 39  LSLAIDLAQRGENVVLLDDADRIGEGSRAICFSKRALEVWDRLGV----------GARMV 88
           ++LA+DLA R    ++++  D      R      R++E++ R GV          G   +
Sbjct: 17  MALALDLAHRQVGHLVVEQTDGTITHPRVGTIGPRSMELFRRWGVAKQIRTAGWPGDHPL 76

Query: 89  EKGVVWQVG--KIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQLPQIDL 146
           +   V +VG  +++R           PE   +  A     Q++    L E V +     L
Sbjct: 77  DAAWVTRVGGHEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGER----L 130

Query: 147 RWRNKVTALAQHNDHAVLTI-ETPDGSYRLA-ADYVVACDGARSALRGMVGAE----FAG 200
           R R+++ +  Q +DH   TI +   G+ R   A Y+VACDGA S  R  +G +       
Sbjct: 131 RTRSRLDSFEQRDDHVRATITDLRTGATRAVHARYLVACDGASSPTRKALGIDAPPRHRT 190

Query: 201 EVFED-QFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAA 259
           +VF +  F   ++R       ER                 R  D      L +G D   +
Sbjct: 191 QVFRNILFRAPELR---SLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVDTMDS 247

Query: 260 VERLPENVRPRIE-RMLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGA 318
            E +   V    E  +L +S    EW   +    R    F   RV   GD+AH +SP G 
Sbjct: 248 FELVRRAVAFDTEIEVLSDS----EWHLTH----RVADSFSAGRVFLTGDAAHTLSPSGG 299

Query: 319 RGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAA 359
            G N+G+    ++ WKLA  LRG A   LL +YE ER   A
Sbjct: 300 FGMNTGIGSAADLGWKLAATLRGWAGPGLLATYEEERRPVA 340


>2r0cA [x.x.x] REBC
          Length = 509

 Score = 68.6 bits (166), Expect = 4e-14
 Identities = 92/342 (26%), Positives = 141/342 (41%), Gaps = 34/342 (9%)

Query: 39  LSLAIDLAQRGENVVLLDDADRIGEGSRAICFSKRALEVWDRLGV----------GARMV 88
           ++LA+DLA R    ++++  D      R      R++E++ R GV          G   +
Sbjct: 18  MALALDLAHRQVGHLVVEQTDGTITHPRVGTIGPRSMELFRRWGVAKQIRTAGWPGDHPL 77

Query: 89  EKGVVWQVG--KIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQLPQIDL 146
           +   V +VG  +++R           PE   +  A     Q++    L E V +     L
Sbjct: 78  DAAWVTRVGGHEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGER----L 131

Query: 147 RWRNKVTALAQHNDHAVLTI-ETPDGSYRLA-ADYVVACDGARSALRGMVGAE----FAG 200
           R R+++ +  Q +DH   TI +   G+ R   A Y+VACDGA S  R  +G +       
Sbjct: 132 RTRSRLDSFEQRDDHVRATITDLRTGATRAVHARYLVACDGASSPTRKALGIDAPPRHRT 191

Query: 201 EVFED-QFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAA 259
           +VF +  F   ++R       ER                 R  D      L +G D DA+
Sbjct: 192 QVFRNILFRAPELR---SLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVD-DAS 247

Query: 260 VERLPENVRPRIERMLGNSDFSFEWISIYKFQC--RRMQRFLHERVIFAGDSAHQVSPFG 317
              +       + R     D   E +S  ++    R    F   RV   GD+AH +SP G
Sbjct: 248 KSTMDSF---ELVRRAVAFDTEIEVLSDSEWHLTHRVADSFSAGRVFLTGDAAHTLSPSG 304

Query: 318 ARGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAA 359
             G N+G+    ++ WKLA  LRG A   LL +YE ER   A
Sbjct: 305 GFGMNTGIGSAADLGWKLAATLRGWAGPGLLATYEEERRPVA 346


>2r0pA [x.x.x] REBC
          Length = 512

 Score = 67.8 bits (164), Expect = 7e-14
 Identities = 90/340 (26%), Positives = 137/340 (40%), Gaps = 38/340 (11%)

Query: 39  LSLAIDLAQRGENVVLLDDADRIGEGSRAICFSKRALEVWDRLGV----------GARMV 88
           ++LA+DLA R    ++++  D      R      R++E++ R GV          G   +
Sbjct: 19  MALALDLAHRQVGHLVVEQTDGTITHPRVGTIGPRSMELFRRWGVAKQIRTAGWPGDHPL 78

Query: 89  EKGVVWQVG--KIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQLPQIDL 146
           +   V +VG  +++R           PE   +  A     Q++    L E V +     L
Sbjct: 79  DAAWVTRVGGHEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGER----L 132

Query: 147 RWRNKVTALAQHNDHAVLTI-ETPDGSYRLA-ADYVVACDGARSALRGMVGAE----FAG 200
           R R+++ +  Q +DH   TI +   G+ R   A Y+VACDGA S  R  +G +       
Sbjct: 133 RTRSRLDSFEQRDDHVRATITDLRTGATRAVHARYLVACDGASSPTRKALGIDAPPRHRT 192

Query: 201 EVFEDQFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAV 260
           +VF +    A      E  +                      D      L +G D   + 
Sbjct: 193 QVFRNILFRAP-----ELRSLLGEXXXXXXXXXXXXXXXXXXDGRGLYRLTVGVDTMDSF 247

Query: 261 ERLPENVRPRIE-RMLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGAR 319
           E +   V    E  +L +S    EW   +    R    F   RV   GD+AH +SP G  
Sbjct: 248 ELVRRAVAFDTEIEVLSDS----EWHLTH----RVADSFSAGRVFLTGDAAHTLSPSGGF 299

Query: 320 GANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAA 359
           G N+G+    ++ WKLA  LRG A   LL +YE ER   A
Sbjct: 300 GMNTGIGSAADLGWKLAATLRGWAGPGLLATYEEERRPVA 339


>3eptB [x.x.x] REBC
          Length = 520

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 87/341 (25%), Positives = 138/341 (40%), Gaps = 36/341 (10%)

Query: 39  LSLAIDLAQRGENVVLLDDADRIGEGSRAICFSKRALEVWDRLGV----------GARMV 88
           ++LA+DLA R    ++++  D      R      R++E++ R GV          G   +
Sbjct: 18  MALALDLAHRQVGHLVVEQTDGTITHPRVGTIGPRSMELFRRWGVAKQIRTAGWPGDHPL 77

Query: 89  EKGVVWQVG--KIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQLPQIDL 146
           +   V +VG  +++R           PE   +  A     Q++    L E V +     L
Sbjct: 78  DAAWVTRVGGHEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGER----L 131

Query: 147 RWRNKVTALAQHNDHAVLTI-ETPDGSYRLA-ADYVVACDGARSALRGMVGAE----FAG 200
           R R+++ +  Q +DH   TI +   G+ R   A Y+VACDGA S  R  +G +       
Sbjct: 132 RTRSRLDSFEQRDDHVRATITDLRTGATRAVHARYLVACDGASSPTRKALGIDAPPRHRT 191

Query: 201 EVFEDQFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAV 260
           +VF +    A    +                     L       ++R+ + +    D+  
Sbjct: 192 QVFRNILFRAPELRSLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVDDTMDSF- 250

Query: 261 ERLPENVRPRIERMLGNSDFSFEWISIYKFQC--RRMQRFLHERVIFAGDSAHQVSPFGA 318
               E VR  +       D   E +S  ++    R    F   RV   GD+AH +SP G 
Sbjct: 251 ----ELVRRAVA-----FDTEIEVLSDSEWHLTHRVADSFSAGRVFLTGDAAHTLSPSGG 301

Query: 319 RGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAA 359
            G N+G+    ++ WKLA  LRG A   LL +YE ER   A
Sbjct: 302 FGMNTGIGSAADLGWKLAATLRGWAGPGLLATYEEERRPVA 342


>3eptA [x.x.x] REBC
          Length = 516

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 87/341 (25%), Positives = 138/341 (40%), Gaps = 36/341 (10%)

Query: 39  LSLAIDLAQRGENVVLLDDADRIGEGSRAICFSKRALEVWDRLGV----------GARMV 88
           ++LA+DLA R    ++++  D      R      R++E++ R GV          G   +
Sbjct: 17  MALALDLAHRQVGHLVVEQTDGTITHPRVGTIGPRSMELFRRWGVAKQIRTAGWPGDHPL 76

Query: 89  EKGVVWQVG--KIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQLPQIDL 146
           +   V +VG  +++R           PE   +  A     Q++    L E V +     L
Sbjct: 77  DAAWVTRVGGHEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGER----L 130

Query: 147 RWRNKVTALAQHNDHAVLTI-ETPDGSYRLA-ADYVVACDGARSALRGMVGAE----FAG 200
           R R+++ +  Q +DH   TI +   G+ R   A Y+VACDGA S  R  +G +       
Sbjct: 131 RTRSRLDSFEQRDDHVRATITDLRTGATRAVHARYLVACDGASSPTRKALGIDAPPRHRT 190

Query: 201 EVFEDQFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAV 260
           +VF +    A    +                     L       ++R+ + +    D+  
Sbjct: 191 QVFRNILFRAPELRSLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVDDTMDSF- 249

Query: 261 ERLPENVRPRIERMLGNSDFSFEWISIYKFQC--RRMQRFLHERVIFAGDSAHQVSPFGA 318
               E VR  +       D   E +S  ++    R    F   RV   GD+AH +SP G 
Sbjct: 250 ----ELVRRAVA-----FDTEIEVLSDSEWHLTHRVADSFSAGRVFLTGDAAHTLSPSGG 300

Query: 319 RGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAA 359
            G N+G+    ++ WKLA  LRG A   LL +YE ER   A
Sbjct: 301 FGMNTGIGSAADLGWKLAATLRGWAGPGLLATYEEERRPVA 341


>1cc4A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
          Length = 391

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 49/198 (24%), Positives = 81/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDGA    R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGAHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1bgjA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 391

 Score = 42.0 bits (97), Expect = 4e-06
 Identities = 49/198 (24%), Positives = 81/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG R   R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFRGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1ykjB [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 392

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 137 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 195

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 196 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFWTELKARLPSEVAEK 252

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 253 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 308

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 309 RLLLKAYREGRGELLERY 326


>1ykjA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 394

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFWTELKARLPSEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1pxcA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 394

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFWTELKARLPSEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1pbfA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 391

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYAVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1dobA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 394

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYFVQVPLSEKVEDWSDERFWTELKARLPSEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1d7lA [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 394

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFWTELKARLPSEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1pxbA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 394

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 50/199 (25%), Positives = 79/199 (39%), Gaps = 20/199 (10%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFPT--- 220
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P    
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 221 ERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----E 272
           E  F      H    AL  ++     R  +Q+       D + ER    ++ R+     E
Sbjct: 198 ELIF----ANHPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFWTELKARLPSEVAE 253

Query: 273 RMLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIA 332
           +++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + 
Sbjct: 254 KLVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL- 309

Query: 333 WKLAMVLRGDAPASLLDSY 351
           ++L +    +    LL+ Y
Sbjct: 310 YRLLLKAYREGRGELLERY 328


>1phhA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 394

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1pbeA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 391

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1pbbA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 391

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1cj4A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
          Length = 392

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1cj3A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
          Length = 392

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1cj2A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
          Length = 391

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1bkwA [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
          Length = 391

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1bgnA [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 391

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLTSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1bf3A [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 391

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1k0iA [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
          Length = 394

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 47/198 (23%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG     R  + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     +  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSQYYVQVPLSEKVEDWSDERFWTELKARLPSEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


>1cc6A [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
          Length = 391

 Score = 37.7 bits (86), Expect = 8e-05
 Identities = 47/198 (23%), Positives = 79/198 (39%), Gaps = 18/198 (9%)

Query: 164 LTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFP--TE 221
           +T E      RL  DY+  CDG        + AE   +VFE  +    + + A+ P  + 
Sbjct: 139 VTFERDGERLRLDCDYIAGCDGFHGISSQSIPAERL-KVFERVYPFGWLGLLADTPPVSH 197

Query: 222 RWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADA---DAAVERLPENVRPRI-----ER 273
              + +   H    AL  ++     R  +Q+       D + ER    ++ R+     E+
Sbjct: 198 ELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEK 254

Query: 274 MLGNSDFSFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAW 333
           ++           +  F    MQ   H R+  AGD+AH V P GA+G N    D   + +
Sbjct: 255 LVTGPSLEKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-Y 310

Query: 334 KLAMVLRGDAPASLLDSY 351
           +L +    +    LL+ Y
Sbjct: 311 RLLLKAYREGRGELLERY 328


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.140    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 991,766,904
Number of extensions: 39163291
Number of successful extensions: 96919
Number of sequences better than 1.0e-03: 1941
Number of HSP's gapped: 94162
Number of HSP's successfully gapped: 2388
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)