BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE38351.1 rpal2 ABE38351.1 GIB00345CH01 "glycoside hydrolase,
family 5"
         (440 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1vrxA [c.1.8 (1c0dA)] ENDOCELLULASE E1 FROM A. CELLULOLYTICUS         161   4e-42
1eceA [c.1.8] ENDOCELLULASE E1                                        160   7e-42
2jeqA [x.x.x] XYLOGLUCANASE                                            38   5e-05
2jepB [x.x.x] XYLOGLUCANASE                                            38   5e-05
2jepA [x.x.x] XYLOGLUCANASE                                            38   5e-05
2oykA [x.x.x] ENDOGLYCOCERAMIDASE II                                   37   8e-05
2oswA [x.x.x] ENDOGLYCOCERAMIDASE II                                   37   8e-05
2oymB [x.x.x] ENDOGLYCOCERAMIDASE II                                   37   1e-04
2oymA [x.x.x] ENDOGLYCOCERAMIDASE II                                   37   1e-04
2oykB [x.x.x] ENDOGLYCOCERAMIDASE II                                   37   1e-04
2osxA [x.x.x] ENDOGLYCOCERAMIDASE II                                   37   1e-04
2oswB [x.x.x] ENDOGLYCOCERAMIDASE II                                   37   1e-04
2osyB [x.x.x] ENDOGLYCOCERAMIDASE II                                   35   5e-04
2osyA [x.x.x] ENDOGLYCOCERAMIDASE II                                   34   7e-04

>1vrxA [c.1.8 (1c0dA)] ENDOCELLULASE E1 FROM A. CELLULOLYTICUS
          Length = 358

 Score =  161 bits (407), Expect = 4e-42
 Identities = 115/393 (29%), Positives = 177/393 (45%), Gaps = 69/393 (17%)

Query: 35  GYLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKTVLDSIVAAGFNAVR 94
           GY  TSG +I+DA+  PVRIA I W G E        G+W   Y+++LD I + G+N +R
Sbjct: 4   GYWHTSGREILDANNVPVRIAGINWFGFE-TCNYVVHGLWSRDYRSMLDQIKSLGYNTIR 62

Query: 95  IPWTDIGLNAPLNGYSDRLGWINITLNPELLASST-PNSQGRYQY------VTTLVAFQR 147
           +P++D                       ++L   T PNS   YQ       +T+L    +
Sbjct: 63  LPYSD-----------------------DILKPGTMPNSINFYQMNQDLQGLTSLQVMDK 99

Query: 148 IVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLL 207
           IV YA +IGL++I + H     +GQ  + LW+                V+  T+  +   
Sbjct: 100 IVAYAGQIGLRIILDRH-RPDCSGQ--SALWYT-------------SSVSEATWISDLQA 143

Query: 208 VARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPT-DIKAMCEDVGSAIQDVSPGVLIIC 266
           +A+ +  NPTV+G+DLHNEP+       WG G P+ D +   E  G+A+  V+P +LI  
Sbjct: 144 LAQRYKGNPTVVGFDLHNEPHDPA---CWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFV 200

Query: 267 EGPETYKPPPASSGMDPRHXXXXXXXXXXXXXXVKLKIANKLVYSIHEYPDEISDTKRWG 326
           EG ++Y       G + +               V L + N+LVYS H+Y   +     + 
Sbjct: 201 EGVQSYNGDSYWWGGNLQ---------GAGQYPVVLNVPNRLVYSAHDYATSVGPQTWFS 251

Query: 327 LPEVGKGFIDRMNFTWGYLVRDNIAPVWIGEMGASLRTPETREWARNLIDYMNGKYGQEG 386
            P          N  WGYL   NIAPVW+GE G +L++   + W + L+ Y+        
Sbjct: 252 DPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKTLVQYLR------- 304

Query: 387 GPTFSGDQQPVSGSWWLIGPSNDPPFG-LQTEW 418
            PT          ++W   P +    G L+ +W
Sbjct: 305 -PTAQYGADSFQWTFWSWNPDSGDTGGILKDDW 336


>1eceA [c.1.8] ENDOCELLULASE E1
          Length = 358

 Score =  160 bits (405), Expect = 7e-42
 Identities = 115/393 (29%), Positives = 177/393 (45%), Gaps = 69/393 (17%)

Query: 35  GYLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKTVLDSIVAAGFNAVR 94
           GY  TSG +I+DA+  PVRIA I W G E        G+W   Y+++LD I + G+N +R
Sbjct: 4   GYWHTSGREILDANNVPVRIAGINWFGFE-TCNYVVHGLWSRDYRSMLDQIKSLGYNTIR 62

Query: 95  IPWTDIGLNAPLNGYSDRLGWINITLNPELLASST-PNSQGRYQY------VTTLVAFQR 147
           +P++D                       ++L   T PNS   YQ       +T+L    +
Sbjct: 63  LPYSD-----------------------DILKPGTMPNSINFYQMNQDLQGLTSLQVMDK 99

Query: 148 IVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLL 207
           IV YA +IGL++I + H     +GQ  + LW+                V+  T+  +   
Sbjct: 100 IVAYAGQIGLRIILDRH-RPDCSGQ--SALWYT-------------SSVSEATWISDLQA 143

Query: 208 VARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPT-DIKAMCEDVGSAIQDVSPGVLIIC 266
           +A+ +  NPTV+G+DLHNEP+       WG G P+ D +   E  G+A+  V+P +LI  
Sbjct: 144 LAQRYKGNPTVVGFDLHNEPHDPA---CWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFV 200

Query: 267 EGPETYKPPPASSGMDPRHXXXXXXXXXXXXXXVKLKIANKLVYSIHEYPDEISDTKRWG 326
           EG ++Y       G + +               V L + N+LVYS H+Y   +     + 
Sbjct: 201 EGVQSYNGDSYWWGGNLQ---------GAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFS 251

Query: 327 LPEVGKGFIDRMNFTWGYLVRDNIAPVWIGEMGASLRTPETREWARNLIDYMNGKYGQEG 386
            P          N  WGYL   NIAPVW+GE G +L++   + W + L+ Y+        
Sbjct: 252 DPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKTLVQYLR------- 304

Query: 387 GPTFSGDQQPVSGSWWLIGPSNDPPFG-LQTEW 418
            PT          ++W   P +    G L+ +W
Sbjct: 305 -PTAQYGADSFQWTFWSWNPDSGDTGGILKDDW 336


>2jeqA [x.x.x] XYLOGLUCANASE
          Length = 359

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 38/142 (26%), Positives = 54/142 (38%), Gaps = 28/142 (19%)

Query: 102 LNAPLNGYSDRLGWINITLNPELLAS-------------STPNSQGRYQYVTTLVAF--- 145
           L A +NG  +   W N T+ PEL+               S  N+ G     T   A+   
Sbjct: 16  LEAAVNGTPNETAWGNPTVTPELIKKVKAAGFKSIRIPVSYLNNIGSAPNYTINAAWLNR 75

Query: 146 -QRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQN 204
            Q++VDYA   GL VI N H   G       G W  +  G              E +K+ 
Sbjct: 76  IQQVVDYAYNEGLYVIINIH---GDGYNSVQGGWLLVNGGNQT--------AIKEKYKKV 124

Query: 205 WLLVARTFANNPTVIGYDLHNE 226
           W  +A  F+N    + ++  NE
Sbjct: 125 WQQIATKFSNYNDRLIFESMNE 146


>2jepB [x.x.x] XYLOGLUCANASE
          Length = 362

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 38/142 (26%), Positives = 54/142 (38%), Gaps = 28/142 (19%)

Query: 102 LNAPLNGYSDRLGWINITLNPELLAS-------------STPNSQGRYQYVTTLVAF--- 145
           L A +NG  +   W N T+ PEL+               S  N+ G     T   A+   
Sbjct: 19  LEAAVNGTPNETAWGNPTVTPELIKKVKAAGFKSIRIPVSYLNNIGSAPNYTINAAWLNR 78

Query: 146 -QRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQN 204
            Q++VDYA   GL VI N H   G       G W  +  G              E +K+ 
Sbjct: 79  IQQVVDYAYNEGLYVIINIH---GDGYNSVQGGWLLVNGGNQT--------AIKEKYKKV 127

Query: 205 WLLVARTFANNPTVIGYDLHNE 226
           W  +A  F+N    + ++  NE
Sbjct: 128 WQQIATKFSNYNDRLIFESMNE 149


>2jepA [x.x.x] XYLOGLUCANASE
          Length = 363

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 38/142 (26%), Positives = 54/142 (38%), Gaps = 28/142 (19%)

Query: 102 LNAPLNGYSDRLGWINITLNPELLAS-------------STPNSQGRYQYVTTLVAF--- 145
           L A +NG  +   W N T+ PEL+               S  N+ G     T   A+   
Sbjct: 20  LEAAVNGTPNETAWGNPTVTPELIKKVKAAGFKSIRIPVSYLNNIGSAPNYTINAAWLNR 79

Query: 146 -QRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQN 204
            Q++VDYA   GL VI N H   G       G W  +  G              E +K+ 
Sbjct: 80  IQQVVDYAYNEGLYVIINIH---GDGYNSVQGGWLLVNGGNQT--------AIKEKYKKV 128

Query: 205 WLLVARTFANNPTVIGYDLHNE 226
           W  +A  F+N    + ++  NE
Sbjct: 129 WQQIATKFSNYNDRLIFESMNE 150


>2oykA [x.x.x] ENDOGLYCOCERAMIDASE II
          Length = 434

 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 60/248 (24%), Positives = 88/248 (35%), Gaps = 44/248 (17%)

Query: 187 NTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKA 246
           NT G  P  V  E + + W  VA  FA+N  V+ YDL NEP G          GP  + A
Sbjct: 145 NTTGKHPELV--EHYAKAWRAVADRFADNDAVVAYDLMNEPFGGSLQGPAFEAGP--LAA 200

Query: 247 MCEDVGSAIQDVSPGVLIICEGPETY-----KPPPASSGMDPRHXXXXXXXXXXXXXXVK 301
           M +    AI+ V      +C  P+        P   +   DPR                 
Sbjct: 201 MYQRTTDAIRQVDQDTW-VCVAPQAIGVNQGLPSGLTKIDDPRAG--------------- 244

Query: 302 LKIANKLVYSIHEYPDEISDTKRWGLPEVGKGFIDRMNFTWGYLVRD-NIAPVWIGEMGA 360
                ++ Y  H YP  + +     L +V    ID       +  R     P+ +GE G 
Sbjct: 245 ---QQRIAYCPHLYPLPLHEGLARTLTDV---TIDAWRANTAHTARVLGDVPIILGEFGL 298

Query: 361 SLRTPETREWARNLIDYMNGKYGQEGGPTFSGDQQP-----VSGSWWLIGPSNDPPF--- 412
               P  R++   +  Y   +    G   +S D  P       G+  L+  + + P+   
Sbjct: 299 DTTLPGARDYIERV--YGTAREMGAGVSYWSSDPGPWGPYLPDGTQTLLVDTLNKPYPRA 356

Query: 413 --GLQTEW 418
             G  TEW
Sbjct: 357 VAGTPTEW 364


>2oswA [x.x.x] ENDOGLYCOCERAMIDASE II
          Length = 433

 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 60/248 (24%), Positives = 88/248 (35%), Gaps = 44/248 (17%)

Query: 187 NTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKA 246
           NT G  P  V  E + + W  VA  FA+N  V+ YDL NEP G          GP  + A
Sbjct: 144 NTTGKHPELV--EHYAKAWRAVADRFADNDAVVAYDLMNEPFGGSLQGPAFEAGP--LAA 199

Query: 247 MCEDVGSAIQDVSPGVLIICEGPETY-----KPPPASSGMDPRHXXXXXXXXXXXXXXVK 301
           M +    AI+ V      +C  P+        P   +   DPR                 
Sbjct: 200 MYQRTTDAIRQVDQDTW-VCVAPQAIGVNQGLPSGLTKIDDPRAG--------------- 243

Query: 302 LKIANKLVYSIHEYPDEISDTKRWGLPEVGKGFIDRMNFTWGYLVRD-NIAPVWIGEMGA 360
                ++ Y  H YP  + +     L +V    ID       +  R     P+ +GE G 
Sbjct: 244 ---QQRIAYCPHLYPLPLHEGLARTLTDV---TIDAWRANTAHTARVLGDVPIILGEFGL 297

Query: 361 SLRTPETREWARNLIDYMNGKYGQEGGPTFSGDQQP-----VSGSWWLIGPSNDPPF--- 412
               P  R++   +  Y   +    G   +S D  P       G+  L+  + + P+   
Sbjct: 298 DTTLPGARDYIERV--YGTAREMGAGVSYWSSDPGPWGPYLPDGTQTLLVDTLNKPYPRA 355

Query: 413 --GLQTEW 418
             G  TEW
Sbjct: 356 VAGTPTEW 363


>2oymB [x.x.x] ENDOGLYCOCERAMIDASE II
          Length = 434

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 29/84 (34%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 187 NTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKA 246
           NT G  P  V  E + + W  VA  FA+N  V+ YDL NEP G          GP  + A
Sbjct: 144 NTTGKHPELV--EHYAKAWRAVADRFADNDAVVAYDLMNEPFGGSLQGPAFEAGP--LAA 199

Query: 247 MCEDVGSAIQDVSPGVLIICEGPE 270
           M +    AI+ V      +C  P+
Sbjct: 200 MYQRTTDAIRQVDQDTW-VCVAPQ 222


>2oymA [x.x.x] ENDOGLYCOCERAMIDASE II
          Length = 434

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 29/84 (34%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 187 NTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKA 246
           NT G  P  V  E + + W  VA  FA+N  V+ YDL NEP G          GP  + A
Sbjct: 144 NTTGKHPELV--EHYAKAWRAVADRFADNDAVVAYDLMNEPFGGSLQGPAFEAGP--LAA 199

Query: 247 MCEDVGSAIQDVSPGVLIICEGPE 270
           M +    AI+ V      +C  P+
Sbjct: 200 MYQRTTDAIRQVDQDTW-VCVAPQ 222


>2oykB [x.x.x] ENDOGLYCOCERAMIDASE II
          Length = 445

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 29/84 (34%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 187 NTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKA 246
           NT G  P  V  E + + W  VA  FA+N  V+ YDL NEP G          GP  + A
Sbjct: 154 NTTGKHPELV--EHYAKAWRAVADRFADNDAVVAYDLMNEPFGGSLQGPAFEAGP--LAA 209

Query: 247 MCEDVGSAIQDVSPGVLIICEGPE 270
           M +    AI+ V      +C  P+
Sbjct: 210 MYQRTTDAIRQVDQDTW-VCVAPQ 232


>2osxA [x.x.x] ENDOGLYCOCERAMIDASE II
          Length = 449

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 29/84 (34%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 187 NTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKA 246
           NT G  P  V  E + + W  VA  FA+N  V+ YDL NEP G          GP  + A
Sbjct: 155 NTTGKHPELV--EHYAKAWRAVADRFADNDAVVAYDLMNEPFGGSLQGPAFEAGP--LAA 210

Query: 247 MCEDVGSAIQDVSPGVLIICEGPE 270
           M +    AI+ V      +C  P+
Sbjct: 211 MYQRTTDAIRQVDQDTW-VCVAPQ 233


>2oswB [x.x.x] ENDOGLYCOCERAMIDASE II
          Length = 438

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 29/84 (34%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 187 NTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKA 246
           NT G  P  V  E + + W  VA  FA+N  V+ YDL NEP G          GP  + A
Sbjct: 148 NTTGKHPELV--EHYAKAWRAVADRFADNDAVVAYDLMNEPFGGSLQGPAFEAGP--LAA 203

Query: 247 MCEDVGSAIQDVSPGVLIICEGPE 270
           M +    AI+ V      +C  P+
Sbjct: 204 MYQRTTDAIRQVDQDTW-VCVAPQ 226


>2osyB [x.x.x] ENDOGLYCOCERAMIDASE II
          Length = 435

 Score = 34.7 bits (78), Expect = 5e-04
 Identities = 61/256 (23%), Positives = 87/256 (33%), Gaps = 63/256 (24%)

Query: 187 NTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKA 246
           NT G  P  V  E + + W  VA  FA+N  V+ YDL N P G          GP  + A
Sbjct: 149 NTTGKHPELV--EHYAKAWRAVADRFADNDAVVAYDLMNAPFGGSLQGPAFEAGP--LAA 204

Query: 247 MCEDVGSAIQDVSPGVLIICEGPETY-----KPPPASSGMDPRHXXXXXXXXXXXXXXVK 301
           M +    AI+ V      +C  P+        P   +   DPR                 
Sbjct: 205 MYQRTTDAIRQVDQDTW-VCVAPQAIGVNQGLPSGLTKIDDPRAG--------------- 248

Query: 302 LKIANKLVYSIHEYPDEISDTKRWGLPEVGKGFIDRMNFTWGYLVRDNIA---------P 352
                ++ Y  H YP          LP + +   D     W    R N A         P
Sbjct: 249 ---QQRIAYCPHLYP----------LPGLARTLTDVTIDAW----RANTAHTARVLGDVP 291

Query: 353 VWIGEMGASLRTPETREWARNLIDYMNGKYGQEGGPTFSGDQQP-----VSGSWWLIGPS 407
           + +GE G     P  R++   +  Y   +    G   +S D  P       G+  L+  +
Sbjct: 292 IILGEFGLDTTLPGARDYIERV--YGTAREMGAGVSYWSSDPGPWGPYLPDGTQTLLVDT 349

Query: 408 NDPPF-----GLQTEW 418
            + P+     G  TEW
Sbjct: 350 LNKPYPRAVAGTPTEW 365


>2osyA [x.x.x] ENDOGLYCOCERAMIDASE II
          Length = 432

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 28/84 (33%), Positives = 37/84 (44%), Gaps = 5/84 (5%)

Query: 187 NTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKA 246
           NT G  P  V  E + + W  VA  FA+N  V+ YDL N P G          GP  + A
Sbjct: 148 NTTGKHPELV--EHYAKAWRAVADRFADNDAVVAYDLMNAPFGGSLQGPAFEAGP--LAA 203

Query: 247 MCEDVGSAIQDVSPGVLIICEGPE 270
           M +    AI+ V      +C  P+
Sbjct: 204 MYQRTTDAIRQVDQDTW-VCVAPQ 226


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 922,620,905
Number of extensions: 36739164
Number of successful extensions: 89379
Number of sequences better than 1.0e-03: 2442
Number of HSP's gapped: 86638
Number of HSP's successfully gapped: 3595
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)