BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE38782.1 rpal2 ABE38782.1 GIB00345CH01 "cyclohex-1-ene
1-carbonyl-CoA hydratase"
         (258 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3h81A [x.x.x] ENOYL-COA HYDRATASE ECHA8                               201   3e-54
3h81B [x.x.x] ENOYL-COA HYDRATASE ECHA8                               199   1e-53
2hw5A [x.x.x] ENOYL-COA HYDRATASE                                     185   1e-49
1ey3A [c.14.1] ENOYL-COA HYDRATASE                                    178   1e-47
1dubB [c.14.1] 2-ENOYL-COA HYDRATASE                                  178   1e-47
1dubA [c.14.1] 2-ENOYL-COA HYDRATASE                                  178   1e-47
2dubD [c.14.1] 2-ENOYL-COA HYDRATASE                                  174   2e-46
1mj3A [c.14.1] ENOYL-COA HYDRATASE, MITOCHONDRIAL                     173   4e-46
2dubE [c.14.1] 2-ENOYL-COA HYDRATASE                                  173   6e-46
2dubA [c.14.1] 2-ENOYL-COA HYDRATASE                                  173   6e-46
2qq3I [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I                           147   3e-38
2qq3C [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I                           147   3e-38
2pbpA [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I                           147   3e-38
2vx2F [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3         108   1e-26
2vx2E [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3         108   1e-26
2vx2A [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3         108   1e-26
2vx2I [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3         107   5e-26
2vx2H [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3         107   5e-26
2vx2G [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3         107   5e-26
2vx2B [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3         107   5e-26
2zqqF [x.x.x] METHYLGLUTACONYL-COA HYDRATASE                          101   3e-24
1hzdB [c.14.1] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE                 101   3e-24
1hzdA [c.14.1] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE                 101   3e-24
2iexB [x.x.x] DIHYDROXYNAPTHOIC ACID SYNTHETASE                        96   1e-22
2iexA [x.x.x] DIHYDROXYNAPTHOIC ACID SYNTHETASE                        96   1e-22
2ppyE [x.x.x] ENOYL-COA HYDRATASE                                      94   4e-22
2ppyC [x.x.x] ENOYL-COA HYDRATASE                                      94   4e-22
2ppyB [x.x.x] ENOYL-COA HYDRATASE                                      94   4e-22
2ppyA [x.x.x] ENOYL-COA HYDRATASE                                      94   4e-22
3gowF [x.x.x] PROBABLE ENOYL-COA HYDRATASE                             94   6e-22
3hrxF [x.x.x] PROBABLE ENOYL-COA HYDRATASE                             93   1e-21
3gowA [x.x.x] PROBABLE ENOYL-COA HYDRATASE                             93   1e-21
1ef9A [c.14.1] METHYLMALONYL COA DECARBOXYLASE                         88   2e-20
1ef8C [c.14.1] METHYLMALONYL COA DECARBOXYLASE                         88   2e-20
1ef8B [c.14.1] METHYLMALONYL COA DECARBOXYLASE                         88   2e-20
1ef8A [c.14.1] METHYLMALONYL COA DECARBOXYLASE                         88   2e-20
2vreA [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE              84   5e-19
2vreC [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE              83   8e-19
2vreB [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE              83   8e-19
2uzfB [x.x.x] NAPHTHOATE SYNTHASE                                      81   3e-18
2uzfA [x.x.x] NAPHTHOATE SYNTHASE                                      81   3e-18
3hinA [x.x.x] PUTATIVE 3-HYDROXYBUTYRYL-COA DEHYDRATASE                77   6e-17
3hinB [x.x.x] PUTATIVE 3-HYDROXYBUTYRYL-COA DEHYDRATASE                77   7e-17
2vssE [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   72   2e-15
2vsuE [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2vssF [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2vssC [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2vssA [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2j5iI [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2j5iG [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2j5iF [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2j5iE [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2j5iD [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2j5iC [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2j5iB [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2j5iA [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   3e-15
2vsuF [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   4e-15
2vsuD [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   4e-15
2vsuC [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   4e-15
2vsuB [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   4e-15
2vsuA [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE                   71   4e-15
3h0uC [x.x.x] PUTATIVE ENOYL-COA HYDRATASE                             70   9e-15
3h0uB [x.x.x] PUTATIVE ENOYL-COA HYDRATASE                             70   9e-15
3h0uA [x.x.x] PUTATIVE ENOYL-COA HYDRATASE                             70   9e-15
2pg8C [x.x.x] DPGC                                                     69   2e-14
2pg8A [x.x.x] DPGC                                                     69   2e-14
2np9C [x.x.x] DPGC                                                     69   2e-14
2np9B [x.x.x] DPGC                                                     69   2e-14
2np9A [x.x.x] DPGC                                                     69   2e-14
2fw2F [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2                 68   3e-14
2fw2E [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2                 68   3e-14
2fw2A [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2                 68   3e-14
2fw2D [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2                 67   4e-14
2fw2C [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2                 67   4e-14
3h02E [x.x.x] NAPHTHOATE SYNTHASE                                      67   6e-14
3h02D [x.x.x] NAPHTHOATE SYNTHASE                                      67   6e-14
3h02C [x.x.x] NAPHTHOATE SYNTHASE                                      67   6e-14
3h02B [x.x.x] NAPHTHOATE SYNTHASE                                      67   6e-14
3h02A [x.x.x] NAPHTHOATE SYNTHASE                                      67   6e-14
2fw2B [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2                 67   8e-14
2ej5A [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II                           67   8e-14
1rjnB [c.14.1] MENB                                                    66   1e-13
1wdmB [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPL...    66   1e-13
1wdmA [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPL...    66   1e-13
1wdlB [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPL...    66   1e-13
1wdlA [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPL...    66   1e-13
1wdkB [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPL...    66   1e-13
1wdkA [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPL...    66   1e-13
2ej5B [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II                           66   1e-13
1q51A [c.14.1] MENB                                                    65   2e-13
2gtrB [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN                              65   2e-13
1q52K [c.14.1] MENB                                                    65   3e-13
1q52B [c.14.1] MENB                                                    65   3e-13
1q52A [c.14.1] MENB                                                    65   3e-13
1q51B [c.14.1] MENB                                                    65   3e-13
2gtrA [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN                              64   4e-13
2fbmB [x.x.x] Y CHROMOSOME CHROMODOMAIN PROTEIN 1, TELOMERIC           63   8e-13
2fbmA [x.x.x] Y CHROMOSOME CHROMODOMAIN PROTEIN 1, TELOMERIC           63   8e-13
2a7kC [x.x.x] CARB                                                     62   1e-12
2gtrC [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN                              62   2e-12
1dciA [c.14.1] DIENOYL-COA ISOMERASE                                   62   2e-12
2a81A [x.x.x] CARB                                                     61   3e-12
2a7kI [x.x.x] CARB                                                     61   3e-12
2a7kH [x.x.x] CARB                                                     61   3e-12
2a7kG [x.x.x] CARB                                                     61   3e-12
2a7kF [x.x.x] CARB                                                     61   3e-12
2a7kE [x.x.x] CARB                                                     61   3e-12
2a7kD [x.x.x] CARB                                                     61   3e-12
2a7kB [x.x.x] CARB                                                     61   3e-12
2a7kA [x.x.x] CARB                                                     61   3e-12
3gkbC [x.x.x] PUTATIVE ENOYL-COA HYDRATASE                             61   4e-12
3gkbB [x.x.x] PUTATIVE ENOYL-COA HYDRATASE                             61   4e-12
3gkbA [x.x.x] PUTATIVE ENOYL-COA HYDRATASE                             61   4e-12
3he2C [x.x.x] ENOYL-COA HYDRATASE ECHA6                                60   7e-12
3he2A [x.x.x] ENOYL-COA HYDRATASE ECHA6                                60   7e-12
3h02F [x.x.x] NAPHTHOATE SYNTHASE                                      57   8e-11
1nzyC [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE                 56   1e-10
1nzyB [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE                 56   1e-10
1nzyA [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE                 56   1e-10
1jxzC [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE                 56   1e-10
1jxzB [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE                 56   1e-10
1jxzA [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE                 56   1e-10
3i47A [x.x.x] ENOYL COA HYDRATASE/ISOMERASE (CROTONASE)                56   1e-10
1rjnA [c.14.1] MENB                                                    54   5e-10
1rjnC [c.14.1] MENB                                                    53   1e-09
1rjmB [c.14.1] MENB                                                    53   1e-09
1rjmA [c.14.1] MENB                                                    53   1e-09
1uiyA [c.14.1] ENOYL-COA HYDRATASE                                     52   1e-09
1szoF [c.14.1] 6-OXOCAMPHOR HYDROLASE                                  52   2e-09
1szoD [c.14.1] 6-OXOCAMPHOR HYDROLASE                                  52   2e-09
1szoB [c.14.1] 6-OXOCAMPHOR HYDROLASE                                  52   2e-09
1szoA [c.14.1] 6-OXOCAMPHOR HYDROLASE                                  52   2e-09
3g64A [x.x.x] PUTATIVE ENOYL-COA HYDRATASE                             52   3e-09
1o8uF [c.14.1] 6-OXO CAMPHOR HYDROLASE                                 51   3e-09
1o8uC [c.14.1] 6-OXO CAMPHOR HYDROLASE                                 51   3e-09
1o8uA [c.14.1] 6-OXO CAMPHOR HYDROLASE                                 51   3e-09
3fduF [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   51   4e-09
3fduE [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   51   4e-09
3fduD [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   51   4e-09
3fduC [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   51   4e-09
3fduB [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   51   4e-09
3fduA [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   51   4e-09
1wz8A [x.x.x] ENOYL-COA HYDRATASE                                      49   1e-08
2j5sA [x.x.x] BETA-DIKETONE HYDROLASE                                  47   6e-08
2j5gE [x.x.x] ALR4455 PROTEIN                                          47   6e-08
2j5gD [x.x.x] ALR4455 PROTEIN                                          47   6e-08
2j5gB [x.x.x] ALR4455 PROTEIN                                          47   6e-08
2j5gA [x.x.x] ALR4455 PROTEIN                                          47   6e-08
3isaF [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   47   6e-08
3isaD [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   47   6e-08
3isaC [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   47   6e-08
3isaB [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   47   6e-08
3isaA [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE                   47   6e-08
1rjmC [c.14.1] MENB                                                    45   2e-07
3hp0B [x.x.x] PUTATIVE POLYKETIDE BIOSYNTHESIS ENOYL-COA               39   1e-05
3hp0A [x.x.x] PUTATIVE POLYKETIDE BIOSYNTHESIS ENOYL-COA               39   1e-05
1xx4A [c.14.1] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL            39   2e-05
3bptA [x.x.x] 3-HYDROXYISOBUTYRYL-COA HYDROLASE                        39   2e-05
1sg4C [x.x.x] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL             35   2e-04
1sg4B [x.x.x] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL             35   2e-04
1sg4A [x.x.x] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL             35   2e-04

>3h81A [x.x.x] ENOYL-COA HYDRATASE ECHA8
          Length = 256

 Score =  201 bits (510), Expect = 3e-54
 Identities = 101/171 (59%), Positives = 124/171 (72%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W  +  VR P +A+VAG A GGGCELA+ CD+++AA +AKF  PEIKLG+LPG GG+QRL
Sbjct: 86  WGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPGMGGSQRL 145

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
            RAIGKAKAMD+ L+ R +DA EA+R GLVSRVV  D L  E    ATTI+  SA A   
Sbjct: 146 TRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARM 205

Query: 208 LKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVHR 258
            KE++NRAFE  L+EG+L+ERR  H+ FAT D  EG+ AF+EKR P F HR
Sbjct: 206 AKEAVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQFTHR 256



 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 18/26 (69%), Positives = 23/26 (88%)

Query: 6  IIVEREGRVGIVTLNRPEVLNALNDE 31
          I+VER+ RVGI+TLNRP+ LNALN +
Sbjct: 5  ILVERDQRVGIITLNRPQALNALNSQ 30


>3h81B [x.x.x] ENOYL-COA HYDRATASE ECHA8
          Length = 255

 Score =  199 bits (505), Expect = 1e-53
 Identities = 100/170 (58%), Positives = 123/170 (72%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W  +  VR P +A+VAG A GGGCELA+ CD+++AA +AKF  PEIKLG+LPG GG+QRL
Sbjct: 86  WGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPGMGGSQRL 145

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
            RAIGKAKAMD+ L+ R +DA EA+R GLVSRVV  D L  E    ATTI+  SA A   
Sbjct: 146 TRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARM 205

Query: 208 LKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVH 257
            KE++NRAFE  L+EG+L+ERR  H+ FAT D  EG+ AF+EKR P F H
Sbjct: 206 AKEAVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQFTH 255



 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 18/26 (69%), Positives = 23/26 (88%)

Query: 6  IIVEREGRVGIVTLNRPEVLNALNDE 31
          I+VER+ RVGI+TLNRP+ LNALN +
Sbjct: 5  ILVERDQRVGIITLNRPQALNALNSQ 30


>2hw5A [x.x.x] ENOYL-COA HYDRATASE
          Length = 260

 Score =  185 bits (470), Expect = 1e-49
 Identities = 105/253 (41%), Positives = 148/253 (58%), Gaps = 4/253 (1%)

Query: 6   IIVEREGR---VGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           II E+ G+   VG++ LNRP+ LNAL D                                
Sbjct: 6   IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFA 65

Query: 63  XXXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVA 122
                      S+ D YSS F+ ++W+ + +V+KPV+A+V G AFGGGCELA+ CDII A
Sbjct: 66  AGADIKEMQNLSFQDCYSSKFL-KHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYA 124

Query: 123 ARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVD 182
              A+FA PEI +G +PGAGGTQRL RA+GK+ AM+M L+   + A++A + GLVS++  
Sbjct: 125 GEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICP 184

Query: 183 DDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADARE 242
            + L EE ++ A  IAS S   +   KES+N AFE+ L EG   E++  ++ FAT D +E
Sbjct: 185 VETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKE 244

Query: 243 GIRAFLEKRKPSF 255
           G+ AF+EKRK +F
Sbjct: 245 GMTAFVEKRKANF 257


>1ey3A [c.14.1] ENOYL-COA HYDRATASE
          Length = 258

 Score =  178 bits (452), Expect = 1e-47
 Identities = 102/253 (40%), Positives = 146/253 (57%), Gaps = 4/253 (1%)

Query: 6   IIVEREGR---VGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           II E++G+   VG++ LNRP+ LNAL +                                
Sbjct: 4   IITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFA 63

Query: 63  XXXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVA 122
                      ++ D YS  F++ +W+ I R++KPV+A+V G A GGGCELA+ CDII A
Sbjct: 64  AGADIKEMQNRTFQDCYSGKFLS-HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYA 122

Query: 123 ARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVD 182
              A+F  PEI LG +PGAGGTQRL RA+GK+ AM+M L+   + A++A + GLVS++  
Sbjct: 123 GEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFP 182

Query: 183 DDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADARE 242
            + L EE ++ A  IA+ S   +   KES+N AFE+ L EG   E++  ++ FAT D RE
Sbjct: 183 VETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRRE 242

Query: 243 GIRAFLEKRKPSF 255
           G+ AF+EKRK +F
Sbjct: 243 GMSAFVEKRKANF 255


>1dubB [c.14.1] 2-ENOYL-COA HYDRATASE
          Length = 259

 Score =  178 bits (452), Expect = 1e-47
 Identities = 102/253 (40%), Positives = 146/253 (57%), Gaps = 4/253 (1%)

Query: 6   IIVEREGR---VGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           II E++G+   VG++ LNRP+ LNAL +                                
Sbjct: 5   IITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFA 64

Query: 63  XXXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVA 122
                      ++ D YS  F++ +W+ I R++KPV+A+V G A GGGCELA+ CDII A
Sbjct: 65  AGADIKEMQNRTFQDCYSGKFLS-HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYA 123

Query: 123 ARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVD 182
              A+F  PEI LG +PGAGGTQRL RA+GK+ AM+M L+   + A++A + GLVS++  
Sbjct: 124 GEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFP 183

Query: 183 DDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADARE 242
            + L EE ++ A  IA+ S   +   KES+N AFE+ L EG   E++  ++ FAT D RE
Sbjct: 184 VETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRRE 243

Query: 243 GIRAFLEKRKPSF 255
           G+ AF+EKRK +F
Sbjct: 244 GMSAFVEKRKANF 256


>1dubA [c.14.1] 2-ENOYL-COA HYDRATASE
          Length = 260

 Score =  178 bits (452), Expect = 1e-47
 Identities = 102/253 (40%), Positives = 146/253 (57%), Gaps = 4/253 (1%)

Query: 6   IIVEREGR---VGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           II E++G+   VG++ LNRP+ LNAL +                                
Sbjct: 6   IITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFA 65

Query: 63  XXXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVA 122
                      ++ D YS  F++ +W+ I R++KPV+A+V G A GGGCELA+ CDII A
Sbjct: 66  AGADIKEMQNRTFQDCYSGKFLS-HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYA 124

Query: 123 ARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVD 182
              A+F  PEI LG +PGAGGTQRL RA+GK+ AM+M L+   + A++A + GLVS++  
Sbjct: 125 GEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFP 184

Query: 183 DDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADARE 242
            + L EE ++ A  IA+ S   +   KES+N AFE+ L EG   E++  ++ FAT D RE
Sbjct: 185 VETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRRE 244

Query: 243 GIRAFLEKRKPSF 255
           G+ AF+EKRK +F
Sbjct: 245 GMSAFVEKRKANF 257


>2dubD [c.14.1] 2-ENOYL-COA HYDRATASE
          Length = 257

 Score =  174 bits (442), Expect = 2e-46
 Identities = 101/253 (39%), Positives = 144/253 (56%), Gaps = 7/253 (2%)

Query: 6   IIVEREGR---VGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           II E++G+   VG++ LNRP+ LNAL +                                
Sbjct: 6   IITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFA 65

Query: 63  XXXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVA 122
                      ++ D YS     ++W+ I R++KPV+A+V G A GGGCELA+ CDII A
Sbjct: 66  AGADIKEMQNRTFQDCYSG----KHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYA 121

Query: 123 ARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVD 182
              A+F  PEI LG +PGAGGTQRL RA+GK+ AM+M L+   + A++A + GLVS++  
Sbjct: 122 GEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFP 181

Query: 183 DDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADARE 242
            + L EE ++ A  IA+ S   +   KES+N AFE+ L EG   E++  ++ FAT D RE
Sbjct: 182 VETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRRE 241

Query: 243 GIRAFLEKRKPSF 255
           G+ AF+EKRK +F
Sbjct: 242 GMSAFVEKRKANF 254


>1mj3A [c.14.1] ENOYL-COA HYDRATASE, MITOCHONDRIAL
          Length = 258

 Score =  173 bits (439), Expect = 4e-46
 Identities = 101/253 (39%), Positives = 143/253 (56%), Gaps = 6/253 (2%)

Query: 6   IIVEREGR---VGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           II E++G+   VG++ LNRP+ LNAL +                                
Sbjct: 6   IITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFA 65

Query: 63  XXXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVA 122
                      ++ D YS      +W+ I R++KPV+A+V G A GGGCELA+ CDII A
Sbjct: 66  AGADIKEMQNRTFQDCYSG---LSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYA 122

Query: 123 ARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVD 182
              A+F  PEI LG +PGAGGTQRL RA+GK+ AM+M L+   + A++A + GLVS++  
Sbjct: 123 GEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFP 182

Query: 183 DDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADARE 242
            + L EE ++ A  IA+ S   +   KES+N AFE+ L EG   E++  ++ FAT D RE
Sbjct: 183 VETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRRE 242

Query: 243 GIRAFLEKRKPSF 255
           G+ AF+EKRK +F
Sbjct: 243 GMSAFVEKRKANF 255


>2dubE [c.14.1] 2-ENOYL-COA HYDRATASE
          Length = 255

 Score =  173 bits (438), Expect = 6e-46
 Identities = 101/253 (39%), Positives = 143/253 (56%), Gaps = 9/253 (3%)

Query: 6   IIVEREGR---VGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           II E++G+   VG++ LNRP+ LNAL +                                
Sbjct: 6   IITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFA 65

Query: 63  XXXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVA 122
                      ++ D YS      +W+ I R++KPV+A+V G A GGGCELA+ CDII A
Sbjct: 66  AGADIKEMQNRTFQDCYS------HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYA 119

Query: 123 ARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVD 182
              A+F  PEI LG +PGAGGTQRL RA+GK+ AM+M L+   + A++A + GLVS++  
Sbjct: 120 GEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFP 179

Query: 183 DDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADARE 242
            + L EE ++ A  IA+ S   +   KES+N AFE+ L EG   E++  ++ FAT D RE
Sbjct: 180 VETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRRE 239

Query: 243 GIRAFLEKRKPSF 255
           G+ AF+EKRK +F
Sbjct: 240 GMSAFVEKRKANF 252


>2dubA [c.14.1] 2-ENOYL-COA HYDRATASE
          Length = 254

 Score =  173 bits (438), Expect = 6e-46
 Identities = 101/253 (39%), Positives = 143/253 (56%), Gaps = 9/253 (3%)

Query: 6   IIVEREGR---VGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 62
           II E++G+   VG++ LNRP+ LNAL +                                
Sbjct: 5   IITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFA 64

Query: 63  XXXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVA 122
                      ++ D YS      +W+ I R++KPV+A+V G A GGGCELA+ CDII A
Sbjct: 65  AGADIKEMQNRTFQDCYS------HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYA 118

Query: 123 ARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVD 182
              A+F  PEI LG +PGAGGTQRL RA+GK+ AM+M L+   + A++A + GLVS++  
Sbjct: 119 GEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFP 178

Query: 183 DDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADARE 242
            + L EE ++ A  IA+ S   +   KES+N AFE+ L EG   E++  ++ FAT D RE
Sbjct: 179 VETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRRE 238

Query: 243 GIRAFLEKRKPSF 255
           G+ AF+EKRK +F
Sbjct: 239 GMSAFVEKRKANF 251


>2qq3I [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I
          Length = 256

 Score =  147 bits (371), Expect = 3e-38
 Identities = 86/252 (34%), Positives = 135/252 (53%), Gaps = 5/252 (1%)

Query: 6   IIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 65
           I   +EG VGI+ L RP+VLNAL+ +                                  
Sbjct: 5   IAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGA 64

Query: 66  XXXXXXEWSYSDVYSSNFITR--NWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAA 123
                 E +  D     ++ +  +W+ +  V+ P++A+V             +CD+IVA+
Sbjct: 65  DIQ---EMAKDDPIRLEWLNQFADWDRLSIVKTPMIAAVNXXXXXXXXXXXXSCDLIVAS 121

Query: 124 RSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
            +A+F  PE+ LG++PGAGGTQRL + IG  +A++   +   + A+EA++ G+V+RVV  
Sbjct: 122 SAAEFGFPEVNLGVMPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSP 181

Query: 184 DRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREG 243
           + L EETM+LA  +A     AL  +KE++ +A + PL EG+ FER+  +  FA+ D +EG
Sbjct: 182 ELLMEETMRLAGRLAEQPPLALRLIKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQKEG 241

Query: 244 IRAFLEKRKPSF 255
           + AFLEKRKP F
Sbjct: 242 MAAFLEKRKPRF 253


>2qq3C [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I
          Length = 257

 Score =  147 bits (371), Expect = 3e-38
 Identities = 86/252 (34%), Positives = 135/252 (53%), Gaps = 5/252 (1%)

Query: 6   IIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 65
           I   +EG VGI+ L RP+VLNAL+ +                                  
Sbjct: 6   IAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGA 65

Query: 66  XXXXXXEWSYSDVYSSNFITR--NWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAA 123
                 E +  D     ++ +  +W+ +  V+ P++A+V             +CD+IVA+
Sbjct: 66  DIQ---EMAKDDPIRLEWLNQFADWDRLSIVKTPMIAAVNXXXXXXXXXXXXSCDLIVAS 122

Query: 124 RSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
            +A+F  PE+ LG++PGAGGTQRL + IG  +A++   +   + A+EA++ G+V+RVV  
Sbjct: 123 SAAEFGFPEVNLGVMPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSP 182

Query: 184 DRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREG 243
           + L EETM+LA  +A     AL  +KE++ +A + PL EG+ FER+  +  FA+ D +EG
Sbjct: 183 ELLMEETMRLAGRLAEQPPLALRLIKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQKEG 242

Query: 244 IRAFLEKRKPSF 255
           + AFLEKRKP F
Sbjct: 243 MAAFLEKRKPRF 254


>2pbpA [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I
          Length = 255

 Score =  147 bits (371), Expect = 3e-38
 Identities = 86/252 (34%), Positives = 135/252 (53%), Gaps = 5/252 (1%)

Query: 6   IIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 65
           I   +EG VGI+ L RP+VLNAL+ +                                  
Sbjct: 4   IAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGA 63

Query: 66  XXXXXXEWSYSDVYSSNFITR--NWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAA 123
                 E +  D     ++ +  +W+ +  V+ P++A+V             +CD+IVA+
Sbjct: 64  DIQ---EMAKDDPIRLEWLNQFADWDRLSIVKTPMIAAVNXXXXXXXXXXXXSCDLIVAS 120

Query: 124 RSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
            +A+F  PE+ LG++PGAGGTQRL + IG  +A++   +   + A+EA++ G+V+RVV  
Sbjct: 121 SAAEFGFPEVNLGVMPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSP 180

Query: 184 DRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREG 243
           + L EETM+LA  +A     AL  +KE++ +A + PL EG+ FER+  +  FA+ D +EG
Sbjct: 181 ELLMEETMRLAGRLAEQPPLALRLIKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQKEG 240

Query: 244 IRAFLEKRKPSF 255
           + AFLEKRKP F
Sbjct: 241 MAAFLEKRKPRF 252


>2vx2F [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
          Length = 254

 Score =  108 bits (271), Expect = 1e-26
 Identities = 61/161 (37%), Positives = 90/161 (55%), Gaps = 1/161 (0%)

Query: 97  PVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKA 156
           PV+A V GLA   GC+L  +CDI VA+  + FA P + +GL     G   L RA+ +  A
Sbjct: 95  PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVA-LARAVPRKVA 153

Query: 157 MDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAF 216
           ++M  +  P+ A+EA  +GL+S+VV +  L+EETM++A  IAS S P +   K +  +  
Sbjct: 154 LEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQL 213

Query: 217 EIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVH 257
              L        + +    A  D +EGI AFL+KRKP + H
Sbjct: 214 PQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH 254


>2vx2E [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
          Length = 255

 Score =  108 bits (271), Expect = 1e-26
 Identities = 61/161 (37%), Positives = 90/161 (55%), Gaps = 1/161 (0%)

Query: 97  PVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKA 156
           PV+A V GLA   GC+L  +CDI VA+  + FA P + +GL     G   L RA+ +  A
Sbjct: 96  PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVA-LARAVPRKVA 154

Query: 157 MDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAF 216
           ++M  +  P+ A+EA  +GL+S+VV +  L+EETM++A  IAS S P +   K +  +  
Sbjct: 155 LEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQL 214

Query: 217 EIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVH 257
              L        + +    A  D +EGI AFL+KRKP + H
Sbjct: 215 PQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH 255


>2vx2A [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
          Length = 256

 Score =  108 bits (271), Expect = 1e-26
 Identities = 61/161 (37%), Positives = 90/161 (55%), Gaps = 1/161 (0%)

Query: 97  PVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKA 156
           PV+A V GLA   GC+L  +CDI VA+  + FA P + +GL     G   L RA+ +  A
Sbjct: 97  PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVA-LARAVPRKVA 155

Query: 157 MDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAF 216
           ++M  +  P+ A+EA  +GL+S+VV +  L+EETM++A  IAS S P +   K +  +  
Sbjct: 156 LEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQL 215

Query: 217 EIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVH 257
              L        + +    A  D +EGI AFL+KRKP + H
Sbjct: 216 PQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH 256


>2vx2I [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
          Length = 254

 Score =  107 bits (266), Expect = 5e-26
 Identities = 60/157 (38%), Positives = 88/157 (56%), Gaps = 1/157 (0%)

Query: 97  PVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKA 156
           PV+A V GLA   GC+L  +CDI VA+  + FA P + +GL     G   L RA+ +  A
Sbjct: 96  PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVA-LARAVPRKVA 154

Query: 157 MDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAF 216
           ++M  +  P+ A+EA  +GL+S+VV +  L+EETM++A  IAS S P +   K +  +  
Sbjct: 155 LEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQL 214

Query: 217 EIPLAEGILFERRELHARFATADAREGIRAFLEKRKP 253
              L        + +    A  D +EGI AFL+KRKP
Sbjct: 215 PQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP 251


>2vx2H [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
          Length = 254

 Score =  107 bits (266), Expect = 5e-26
 Identities = 60/157 (38%), Positives = 88/157 (56%), Gaps = 1/157 (0%)

Query: 97  PVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKA 156
           PV+A V GLA   GC+L  +CDI VA+  + FA P + +GL     G   L RA+ +  A
Sbjct: 97  PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVA-LARAVPRKVA 155

Query: 157 MDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAF 216
           ++M  +  P+ A+EA  +GL+S+VV +  L+EETM++A  IAS S P +   K +  +  
Sbjct: 156 LEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQL 215

Query: 217 EIPLAEGILFERRELHARFATADAREGIRAFLEKRKP 253
              L        + +    A  D +EGI AFL+KRKP
Sbjct: 216 PQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP 252


>2vx2G [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
          Length = 253

 Score =  107 bits (266), Expect = 5e-26
 Identities = 60/157 (38%), Positives = 88/157 (56%), Gaps = 1/157 (0%)

Query: 97  PVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKA 156
           PV+A V GLA   GC+L  +CDI VA+  + FA P + +GL     G   L RA+ +  A
Sbjct: 96  PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVA-LARAVPRKVA 154

Query: 157 MDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAF 216
           ++M  +  P+ A+EA  +GL+S+VV +  L+EETM++A  IAS S P +   K +  +  
Sbjct: 155 LEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQL 214

Query: 217 EIPLAEGILFERRELHARFATADAREGIRAFLEKRKP 253
              L        + +    A  D +EGI AFL+KRKP
Sbjct: 215 PQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP 251


>2vx2B [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
          Length = 255

 Score =  107 bits (266), Expect = 5e-26
 Identities = 60/157 (38%), Positives = 88/157 (56%), Gaps = 1/157 (0%)

Query: 97  PVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKA 156
           PV+A V GLA   GC+L  +CDI VA+  + FA P + +GL     G   L RA+ +  A
Sbjct: 97  PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVA-LARAVPRKVA 155

Query: 157 MDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAF 216
           ++M  +  P+ A+EA  +GL+S+VV +  L+EETM++A  IAS S P +   K +  +  
Sbjct: 156 LEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQL 215

Query: 217 EIPLAEGILFERRELHARFATADAREGIRAFLEKRKP 253
              L        + +    A  D +EGI AFL+KRKP
Sbjct: 216 PQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP 252


>2zqqF [x.x.x] METHYLGLUTACONYL-COA HYDRATASE
          Length = 256

 Score =  101 bits (251), Expect = 3e-24
 Identities = 58/143 (40%), Positives = 80/143 (55%), Gaps = 4/143 (2%)

Query: 117 CDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGL 176
           CDI VAA SAK  L E KL ++PG GGTQRLPRAIG + A ++  SAR LD +EA   GL
Sbjct: 111 CDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGL 170

Query: 177 VSRVVDDDRLREETMKLATTIASFSAP----ALMALKESLNRAFEIPLAEGILFERRELH 232
           +S V++ ++  +   + A  +A    P    A+   K ++N+  E+ L  G+  E     
Sbjct: 171 ISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYA 230

Query: 233 ARFATADAREGIRAFLEKRKPSF 255
               T D  EG+ AF EKR P +
Sbjct: 231 QTIPTKDRLEGLLAFKEKRPPRY 253


>1hzdB [c.14.1] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE
          Length = 265

 Score =  101 bits (251), Expect = 3e-24
 Identities = 58/143 (40%), Positives = 80/143 (55%), Gaps = 4/143 (2%)

Query: 117 CDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGL 176
           CDI VAA SAK  L E KL ++PG GGTQRLPRAIG + A ++  SAR LD +EA   GL
Sbjct: 120 CDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGL 179

Query: 177 VSRVVDDDRLREETMKLATTIASFSAP----ALMALKESLNRAFEIPLAEGILFERRELH 232
           +S V++ ++  +   + A  +A    P    A+   K ++N+  E+ L  G+  E     
Sbjct: 180 ISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYA 239

Query: 233 ARFATADAREGIRAFLEKRKPSF 255
               T D  EG+ AF EKR P +
Sbjct: 240 QTIPTKDRLEGLLAFKEKRPPRY 262


>1hzdA [c.14.1] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE
          Length = 266

 Score =  101 bits (251), Expect = 3e-24
 Identities = 58/143 (40%), Positives = 80/143 (55%), Gaps = 4/143 (2%)

Query: 117 CDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGL 176
           CDI VAA SAK  L E KL ++PG GGTQRLPRAIG + A ++  SAR LD +EA   GL
Sbjct: 121 CDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGL 180

Query: 177 VSRVVDDDRLREETMKLATTIASFSAP----ALMALKESLNRAFEIPLAEGILFERRELH 232
           +S V++ ++  +   + A  +A    P    A+   K ++N+  E+ L  G+  E     
Sbjct: 181 ISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYA 240

Query: 233 ARFATADAREGIRAFLEKRKPSF 255
               T D  EG+ AF EKR P +
Sbjct: 241 QTIPTKDRLEGLLAFKEKRPPRY 263


>2iexB [x.x.x] DIHYDROXYNAPTHOIC ACID SYNTHETASE
          Length = 253

 Score = 95.9 bits (237), Expect = 1e-22
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 1/165 (0%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+ + KPV+A VAG A GGG  L + CD+ +AA +A F     K+G   G  G   L R 
Sbjct: 83  IRVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGAGYLARI 142

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  KA ++    R   A+EA   GLV++VV  ++L EET+K A  I   S  A+  LK 
Sbjct: 143 VGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRFLKA 202

Query: 211 SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           + N A    LA             + T +A+EG+RAF EKRKP F
Sbjct: 203 AFN-ADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDF 246


>2iexA [x.x.x] DIHYDROXYNAPTHOIC ACID SYNTHETASE
          Length = 253

 Score = 95.9 bits (237), Expect = 1e-22
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 1/165 (0%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+ + KPV+A VAG A GGG  L + CD+ +AA +A F     K+G   G  G   L R 
Sbjct: 83  IRVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGAGYLARI 142

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  KA ++    R   A+EA   GLV++VV  ++L EET+K A  I   S  A+  LK 
Sbjct: 143 VGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRFLKA 202

Query: 211 SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           + N A    LA             + T +A+EG+RAF EKRKP F
Sbjct: 203 AFN-ADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDF 246


>2ppyE [x.x.x] ENOYL-COA HYDRATASE
          Length = 256

 Score = 94.0 bits (232), Expect = 4e-22
 Identities = 61/173 (35%), Positives = 93/173 (53%), Gaps = 4/173 (2%)

Query: 83  FITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAG 142
           F     + I R  +  +A + G   GGG E ALACD+     + K  LPE+ LG+L G G
Sbjct: 85  FCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGVLAGTG 143

Query: 143 GTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSA 202
           GTQRL R IG ++A+D  ++   +  +EA   GLV+RV             A  +A+ + 
Sbjct: 144 GTQRLARLIGYSRALDN-ITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSAT 202

Query: 203 PALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
            A+  +K ++N   + PL   I +E    +  F + DA+EG+ AFLEKR+P++
Sbjct: 203 YAVSNIKLAING--KEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNW 253


>2ppyC [x.x.x] ENOYL-COA HYDRATASE
          Length = 257

 Score = 94.0 bits (232), Expect = 4e-22
 Identities = 61/173 (35%), Positives = 93/173 (53%), Gaps = 4/173 (2%)

Query: 83  FITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAG 142
           F     + I R  +  +A + G   GGG E ALACD+     + K  LPE+ LG+L G G
Sbjct: 86  FCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGVLAGTG 144

Query: 143 GTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSA 202
           GTQRL R IG ++A+D  ++   +  +EA   GLV+RV             A  +A+ + 
Sbjct: 145 GTQRLARLIGYSRALDN-ITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSAT 203

Query: 203 PALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
            A+  +K ++N   + PL   I +E    +  F + DA+EG+ AFLEKR+P++
Sbjct: 204 YAVSNIKLAING--KEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNW 254


>2ppyB [x.x.x] ENOYL-COA HYDRATASE
          Length = 255

 Score = 94.0 bits (232), Expect = 4e-22
 Identities = 61/173 (35%), Positives = 93/173 (53%), Gaps = 4/173 (2%)

Query: 83  FITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAG 142
           F     + I R  +  +A + G   GGG E ALACD+     + K  LPE+ LG+L G G
Sbjct: 84  FCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGVLAGTG 142

Query: 143 GTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSA 202
           GTQRL R IG ++A+D  ++   +  +EA   GLV+RV             A  +A+ + 
Sbjct: 143 GTQRLARLIGYSRALDN-ITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSAT 201

Query: 203 PALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
            A+  +K ++N   + PL   I +E    +  F + DA+EG+ AFLEKR+P++
Sbjct: 202 YAVSNIKLAING--KEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNW 252


>2ppyA [x.x.x] ENOYL-COA HYDRATASE
          Length = 258

 Score = 94.0 bits (232), Expect = 4e-22
 Identities = 61/173 (35%), Positives = 93/173 (53%), Gaps = 4/173 (2%)

Query: 83  FITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAG 142
           F     + I R  +  +A + G   GGG E ALACD+     + K  LPE+ LG+L G G
Sbjct: 87  FCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGVLAGTG 145

Query: 143 GTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSA 202
           GTQRL R IG ++A+D  ++   +  +EA   GLV+RV             A  +A+ + 
Sbjct: 146 GTQRLARLIGYSRALDN-ITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSAT 204

Query: 203 PALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
            A+  +K ++N   + PL   I +E    +  F + DA+EG+ AFLEKR+P++
Sbjct: 205 YAVSNIKLAING--KEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNW 255


>3gowF [x.x.x] PROBABLE ENOYL-COA HYDRATASE
          Length = 252

 Score = 93.6 bits (231), Expect = 6e-22
 Identities = 74/254 (29%), Positives = 109/254 (42%), Gaps = 2/254 (0%)

Query: 5   VIIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 64
           +++ ER+  V ++TLNRPE LNA+  E                                 
Sbjct: 1   MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAG 60

Query: 65  XXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAAR 124
                  +  Y + +   +  R  E +  + KP+              LAL  D+ +AA 
Sbjct: 61  QDLTEDRKPDY-EAHLRRY-NRVVEALSGLEKPLXXXXXXXXXXXXMSLALWGDLRLAAV 118

Query: 125 SAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDD 184
            A F    +++GL+P +G +  LPR +G AKA ++ L +  L AEEA   GLV RVV  +
Sbjct: 119 GASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAE 178

Query: 185 RLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGI 244
           +L EE + LA  +A     A    K+ L   + + L E +  E         T D  EG+
Sbjct: 179 KLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGV 238

Query: 245 RAFLEKRKPSFVHR 258
           RAF EKR P F  R
Sbjct: 239 RAFREKRPPRFQGR 252


>3hrxF [x.x.x] PROBABLE ENOYL-COA HYDRATASE
          Length = 250

 Score = 92.8 bits (229), Expect = 1e-21
 Identities = 73/254 (28%), Positives = 109/254 (42%), Gaps = 4/254 (1%)

Query: 5   VIIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 64
           +++ ER+  V ++TLNRPE LNA+  E                                 
Sbjct: 1   MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAG 60

Query: 65  XXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAAR 124
                  ++   + +   +  R  E +  + KP+              LAL  D+ +AA 
Sbjct: 61  QDLTEKPDY---EAHLRRY-NRVVEALSGLEKPLXXXXXXXXXXXXMSLALWGDLRLAAV 116

Query: 125 SAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDD 184
            A F    +++GL+P +G +  LPR +G AKA ++ L +  L AEEA   GLV RVV  +
Sbjct: 117 GASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAE 176

Query: 185 RLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGI 244
           +L EE + LA  +A     A    K+ L   + + L E +  E         T D  EG+
Sbjct: 177 KLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGV 236

Query: 245 RAFLEKRKPSFVHR 258
           RAF EKR P F  R
Sbjct: 237 RAFREKRPPRFQGR 250


>3gowA [x.x.x] PROBABLE ENOYL-COA HYDRATASE
          Length = 254

 Score = 92.8 bits (229), Expect = 1e-21
 Identities = 73/254 (28%), Positives = 105/254 (41%)

Query: 5   VIIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 64
           +++ ER+  V ++TLNRPE LNA+  E                                 
Sbjct: 1   MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAG 60

Query: 65  XXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAAR 124
                  +             R  E +  + KP+              LAL  D+ +AA 
Sbjct: 61  QDLTEFGDRKPDYEAHLRRYNRVVEALSGLEKPLXXXXXXXXXXXXMSLALWGDLRLAAV 120

Query: 125 SAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDD 184
            A F    +++GL+P +G +  LPR +G AKA ++ L +  L AEEA   GLV RVV  +
Sbjct: 121 GASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAE 180

Query: 185 RLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGI 244
           +L EE + LA  +A     A    K+ L   + + L E +  E         T D  EG+
Sbjct: 181 KLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGV 240

Query: 245 RAFLEKRKPSFVHR 258
           RAF EKR P F  R
Sbjct: 241 RAFREKRPPRFQGR 254


>1ef9A [c.14.1] METHYLMALONYL COA DECARBOXYLASE
          Length = 261

 Score = 88.2 bits (217), Expect = 2e-20
 Identities = 52/168 (30%), Positives = 93/168 (55%), Gaps = 2/168 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I++  KP+++ V G  +GG  E+ ++ D+I+AA ++ F++  + LG+     G   L R 
Sbjct: 92  IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRD 151

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
            G     ++  +A P+ A+ A   G+++ VV+ + L + T+++A  I+  +  A+  +KE
Sbjct: 152 AGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE 211

Query: 211 SLNRAFEIPLAEGILFERRE--LHARFATADAREGIRAFLEKRKPSFV 256
            L    E        FER +    A + + D +EG+ AFLEKRKP+FV
Sbjct: 212 ELRVLGEAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFLEKRKPNFV 259


>1ef8C [c.14.1] METHYLMALONYL COA DECARBOXYLASE
          Length = 250

 Score = 88.2 bits (217), Expect = 2e-20
 Identities = 52/168 (30%), Positives = 93/168 (55%), Gaps = 2/168 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I++  KP+++ V G  +GG  E+ ++ D+I+AA ++ F++  + LG+     G   L R 
Sbjct: 81  IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRD 140

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
            G     ++  +A P+ A+ A   G+++ VV+ + L + T+++A  I+  +  A+  +KE
Sbjct: 141 AGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE 200

Query: 211 SLNRAFEIPLAEGILFERRE--LHARFATADAREGIRAFLEKRKPSFV 256
            L    E        FER +    A + + D +EG+ AFLEKRKP+FV
Sbjct: 201 ELRVLGEAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFLEKRKPNFV 248


>1ef8B [c.14.1] METHYLMALONYL COA DECARBOXYLASE
          Length = 253

 Score = 88.2 bits (217), Expect = 2e-20
 Identities = 52/168 (30%), Positives = 93/168 (55%), Gaps = 2/168 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I++  KP+++ V G  +GG  E+ ++ D+I+AA ++ F++  + LG+     G   L R 
Sbjct: 84  IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRD 143

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
            G     ++  +A P+ A+ A   G+++ VV+ + L + T+++A  I+  +  A+  +KE
Sbjct: 144 AGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE 203

Query: 211 SLNRAFEIPLAEGILFERRE--LHARFATADAREGIRAFLEKRKPSFV 256
            L    E        FER +    A + + D +EG+ AFLEKRKP+FV
Sbjct: 204 ELRVLGEAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFLEKRKPNFV 251


>1ef8A [c.14.1] METHYLMALONYL COA DECARBOXYLASE
          Length = 256

 Score = 88.2 bits (217), Expect = 2e-20
 Identities = 52/168 (30%), Positives = 93/168 (55%), Gaps = 2/168 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I++  KP+++ V G  +GG  E+ ++ D+I+AA ++ F++  + LG+     G   L R 
Sbjct: 87  IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRD 146

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
            G     ++  +A P+ A+ A   G+++ VV+ + L + T+++A  I+  +  A+  +KE
Sbjct: 147 AGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE 206

Query: 211 SLNRAFEIPLAEGILFERRE--LHARFATADAREGIRAFLEKRKPSFV 256
            L    E        FER +    A + + D +EG+ AFLEKRKP+FV
Sbjct: 207 ELRVLGEAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFLEKRKPNFV 254


>2vreA [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE
          Length = 272

 Score = 84.0 bits (206), Expect = 5e-19
 Identities = 60/173 (34%), Positives = 93/173 (53%), Gaps = 5/173 (2%)

Query: 79  YSSNFITRNWET---IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKL 135
           Y  + ITR  ET   I+R  KPV+A+V G   GGG +L  ACDI   A+ A F + E+ +
Sbjct: 98  YLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDV 157

Query: 136 GLLPGAGGTQRLPRAIGKAKAM-DMCLSARPLDAEEADRYGLVSRVV-DDDRLREETMKL 193
           GL    G  QRLP+ IG    + ++  +AR + A+EA   GLVSRV  D + + +  + L
Sbjct: 158 GLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALAL 217

Query: 194 ATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRA 246
           A  I+S S  A+ + K +L  + +  +AE + +      +   T D  + ++A
Sbjct: 218 AAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQA 270


>2vreC [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE
          Length = 261

 Score = 83.2 bits (204), Expect = 8e-19
 Identities = 57/151 (37%), Positives = 85/151 (56%), Gaps = 5/151 (3%)

Query: 79  YSSNFITRNWET---IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKL 135
           Y  + ITR  ET   I+R  KPV+A+V G   GGG +L  ACDI   A+ A F + E+ +
Sbjct: 94  YLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDV 153

Query: 136 GLLPGAGGTQRLPRAIGKAKAM-DMCLSARPLDAEEADRYGLVSRVV-DDDRLREETMKL 193
           GL    G  QRLP+ IG    + ++  +AR + A+EA   GLVSRV  D + + +  + L
Sbjct: 154 GLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALAL 213

Query: 194 ATTIASFSAPALMALKESLNRAFEIPLAEGI 224
           A  I+S S  A+ + K +L  + +  +AE +
Sbjct: 214 AAEISSKSPVAVQSTKVNLLYSRDHSVAESL 244


>2vreB [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE
          Length = 260

 Score = 83.2 bits (204), Expect = 8e-19
 Identities = 57/151 (37%), Positives = 85/151 (56%), Gaps = 5/151 (3%)

Query: 79  YSSNFITRNWET---IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKL 135
           Y  + ITR  ET   I+R  KPV+A+V G   GGG +L  ACDI   A+ A F + E+ +
Sbjct: 93  YLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDV 152

Query: 136 GLLPGAGGTQRLPRAIGKAKAM-DMCLSARPLDAEEADRYGLVSRVV-DDDRLREETMKL 193
           GL    G  QRLP+ IG    + ++  +AR + A+EA   GLVSRV  D + + +  + L
Sbjct: 153 GLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALAL 212

Query: 194 ATTIASFSAPALMALKESLNRAFEIPLAEGI 224
           A  I+S S  A+ + K +L  + +  +AE +
Sbjct: 213 AAEISSKSPVAVQSTKVNLLYSRDHSVAESL 243


>2uzfB [x.x.x] NAPHTHOATE SYNTHASE
          Length = 257

 Score = 81.3 bits (199), Expect = 3e-18
 Identities = 56/166 (33%), Positives = 88/166 (53%), Gaps = 3/166 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+ + KPV+A V G A GGG  L + CD+ +AA +A F     K+G      G+  L R 
Sbjct: 87  IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARI 146

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  KA ++    R  +A+EA   GLV+ VV  +++ +ET++    I   S  AL  LK 
Sbjct: 147 VGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKA 206

Query: 211 SLNRAFE-IPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           ++N   + +   + +  +   L+  + T +A+EG  AF EKR P F
Sbjct: 207 AMNADTDGLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF 250


>2uzfA [x.x.x] NAPHTHOATE SYNTHASE
          Length = 260

 Score = 81.3 bits (199), Expect = 3e-18
 Identities = 56/166 (33%), Positives = 88/166 (53%), Gaps = 3/166 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+ + KPV+A V G A GGG  L + CD+ +AA +A F     K+G      G+  L R 
Sbjct: 90  IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARI 149

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  KA ++    R  +A+EA   GLV+ VV  +++ +ET++    I   S  AL  LK 
Sbjct: 150 VGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKA 209

Query: 211 SLNRAFE-IPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           ++N   + +   + +  +   L+  + T +A+EG  AF EKR P F
Sbjct: 210 AMNADTDGLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF 253


>3hinA [x.x.x] PUTATIVE 3-HYDROXYBUTYRYL-COA DEHYDRATASE
          Length = 258

 Score = 77.0 bits (188), Expect = 6e-17
 Identities = 64/248 (25%), Positives = 103/248 (41%), Gaps = 1/248 (0%)

Query: 4   NVIIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 63
           + ++V+  G V  + LNRP+  NALND                                 
Sbjct: 8   STLVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIPDQIRAVVIHGIGDHFSAGL 67

Query: 64  XXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAA 123
                   + +   V+S  +  R ++ I+  R PV+A++ G   GGG ELA A  I VA 
Sbjct: 68  DLSELRERDATEGLVHSQTW-HRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAE 126

Query: 124 RSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
            SA +ALPE              LPR IG A+  DM L+ R   A E   +G    ++++
Sbjct: 127 ASAYYALPEXXXXXXXXXXXXXXLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIEN 186

Query: 184 DRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREG 243
               ++ ++L   +A  +     A+ ++L    E     G+L E        +  +A+  
Sbjct: 187 GSAYDKALELGNRVAQNAPLTNFAVLQALPMIAEANPQTGLLMESLMATVAQSDQEAKTR 246

Query: 244 IRAFLEKR 251
           IRAFL+ +
Sbjct: 247 IRAFLDHK 254


>3hinB [x.x.x] PUTATIVE 3-HYDROXYBUTYRYL-COA DEHYDRATASE
          Length = 251

 Score = 76.6 bits (187), Expect = 7e-17
 Identities = 64/246 (26%), Positives = 102/246 (41%), Gaps = 1/246 (0%)

Query: 4   NVIIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 63
           + ++V+  G V  + LNRP+  NALND                                 
Sbjct: 6   STLVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIPDQIRAVVIHGIGDHFSAGL 65

Query: 64  XXXXXXXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAA 123
                   + +   V+S  +  R ++ I+  R PV+A++ G   GGG ELA A  I VA 
Sbjct: 66  DLSELRERDATEGLVHSQTW-HRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAE 124

Query: 124 RSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
            SA +ALPE              LPR IG A+  DM L+ R   A E   +G    ++++
Sbjct: 125 ASAYYALPEXXXXXXXXXXXXXXLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIEN 184

Query: 184 DRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREG 243
               ++ ++L   +A  +     A+ ++L    E     G+L E        +  +A+  
Sbjct: 185 GSAYDKALELGNRVAQNAPLTNFAVLQALPMIAEANPQTGLLMESLMATVAQSDQEAKTR 244

Query: 244 IRAFLE 249
           IRAFL+
Sbjct: 245 IRAFLD 250


>2vssE [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 240

 Score = 71.6 bits (174), Expect = 2e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 90  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINYGIPPGNLVSKAM 149

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 150 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 209

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 210 AKHGFKRCREL 220


>2vsuE [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 245

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 95  WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINYGIPPGNLVSKAM 154

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 155 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 214

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 215 AKHGFKRCREL 225


>2vssF [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 246

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 97  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 156

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 157 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 216

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 217 AKHGFKRCREL 227


>2vssC [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 235

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 85  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 144

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 145 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 204

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 205 AKHGFKRCREL 215


>2vssA [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 238

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 88  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 147

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 148 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 207

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 208 AKHGFKRCREL 218


>2j5iI [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 245

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 96  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 155

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 156 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 215

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 216 AKHGFKRCREL 226


>2j5iG [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 246

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 97  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 156

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 157 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 216

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 217 AKHGFKRCREL 227


>2j5iF [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 245

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 96  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 155

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 156 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 215

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 216 AKHGFKRCREL 226


>2j5iE [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 247

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 97  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 156

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 157 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 216

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 217 AKHGFKRCREL 227


>2j5iD [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 247

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 96  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 155

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 156 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 215

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 216 AKHGFKRCREL 226


>2j5iC [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 246

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 96  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 155

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 156 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 215

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 216 AKHGFKRCREL 226


>2j5iB [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 244

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 94  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 153

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 154 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 213

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 214 AKHGFKRCREL 224


>2j5iA [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 247

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 97  WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 156

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 157 ADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 216

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 217 AKHGFKRCREL 227


>2vsuF [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 245

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 96  WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 155

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 156 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 215

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 216 AKHGFKRCREL 226


>2vsuD [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 247

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 97  WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 156

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 157 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 216

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 217 AKHGFKRCREL 227


>2vsuC [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 251

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 94  WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 153

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 154 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 213

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 214 AKHGFKRCREL 224


>2vsuB [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 247

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 96  WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 155

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 156 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 215

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 216 AKHGFKRCREL 226


>2vsuA [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
          Length = 240

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 39/131 (29%), Positives = 66/131 (50%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W+ ++   KP +A V G  FGGG    +ACD+ + A  A F L EI  G+ PG   ++ +
Sbjct: 90  WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPGNLVSKAM 149

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G  +++   ++ +    ++A   GLV+  V   +LRE T++LA  +   +   L A
Sbjct: 150 ADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRA 209

Query: 208 LKESLNRAFEI 218
            K    R  E+
Sbjct: 210 AKHGFKRCREL 220


>3h0uC [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
          Length = 274

 Score = 69.7 bits (169), Expect = 9e-15
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 7/136 (5%)

Query: 99  LASVAGLAFGGGCELALACDIIVAAR-SAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAM 157
           +A + G A G G E  LACD+  A+R +A    PE+           Q L R +G+ +A+
Sbjct: 104 IAKLRGRARGAGSEFLLACDMRFASRENAILGQPEVXXXXXXXXXXXQHLTRLLGRGRAL 163

Query: 158 DMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAFE 217
           +  L++   DA+ A+RYG V+R V D  L E    +A  ++ F   AL+A K ++N A  
Sbjct: 164 EAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKSAIN-AIS 222

Query: 218 IPL-----AEGILFER 228
           +P      A+  LF++
Sbjct: 223 LPAPAEVRADAALFQQ 238


>3h0uB [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
          Length = 274

 Score = 69.7 bits (169), Expect = 9e-15
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 7/136 (5%)

Query: 99  LASVAGLAFGGGCELALACDIIVAAR-SAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAM 157
           +A + G A G G E  LACD+  A+R +A    PE+           Q L R +G+ +A+
Sbjct: 101 IAKLRGRARGAGSEFLLACDMRFASRENAILGQPEVXXXXXXXXXXXQHLTRLLGRGRAL 160

Query: 158 DMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAFE 217
           +  L++   DA+ A+RYG V+R V D  L E    +A  ++ F   AL+A K ++N A  
Sbjct: 161 EAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKSAIN-AIS 219

Query: 218 IPL-----AEGILFER 228
           +P      A+  LF++
Sbjct: 220 LPAPAEVRADAALFQQ 235


>3h0uA [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
          Length = 278

 Score = 69.7 bits (169), Expect = 9e-15
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 7/136 (5%)

Query: 99  LASVAGLAFGGGCELALACDIIVAAR-SAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAM 157
           +A + G A G G E  LACD+  A+R +A    PE+           Q L R +G+ +A+
Sbjct: 106 IAKLRGRARGAGSEFLLACDMRFASRENAILGQPEVXXXXXXXXXXXQHLTRLLGRGRAL 165

Query: 158 DMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAFE 217
           +  L++   DA+ A+RYG V+R V D  L E    +A  ++ F   AL+A K ++N A  
Sbjct: 166 EAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKSAIN-AIS 224

Query: 218 IPL-----AEGILFER 228
           +P      A+  LF++
Sbjct: 225 LPAPAEVRADAALFQQ 240


>2pg8C [x.x.x] DPGC
          Length = 415

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 4/132 (3%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W    R+ KP +A+V G A GGG +L L  D ++A+  A F+LP  K G++PGA    RL
Sbjct: 264 WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPGAANL-RL 322

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
            R  G   +  + L  R + A+E +   LV  VV+ D L      +  ++      A++A
Sbjct: 323 GRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLA 379

Query: 208 LKESLNRAFEIP 219
            +  LN A E P
Sbjct: 380 NRRMLNLADESP 391


>2pg8A [x.x.x] DPGC
          Length = 417

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 4/132 (3%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W    R+ KP +A+V G A GGG +L L  D ++A+  A F+LP  K G++PGA    RL
Sbjct: 266 WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPGAANL-RL 324

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
            R  G   +  + L  R + A+E +   LV  VV+ D L      +  ++      A++A
Sbjct: 325 GRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLA 381

Query: 208 LKESLNRAFEIP 219
            +  LN A E P
Sbjct: 382 NRRMLNLADESP 393


>2np9C [x.x.x] DPGC
          Length = 421

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 4/132 (3%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W    R+ KP +A+V G A GGG +L L  D ++A+  A F+LP  K G++PGA    RL
Sbjct: 264 WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPGAANL-RL 322

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
            R  G   +  + L  R + A+E +   LV  VV+ D L      +  ++      A++A
Sbjct: 323 GRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLA 379

Query: 208 LKESLNRAFEIP 219
            +  LN A E P
Sbjct: 380 NRRMLNLADESP 391


>2np9B [x.x.x] DPGC
          Length = 422

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 4/132 (3%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W    R+ KP +A+V G A GGG +L L  D ++A+  A F+LP  K G++PGA    RL
Sbjct: 265 WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPGAANL-RL 323

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
            R  G   +  + L  R + A+E +   LV  VV+ D L      +  ++      A++A
Sbjct: 324 GRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLA 380

Query: 208 LKESLNRAFEIP 219
            +  LN A E P
Sbjct: 381 NRRMLNLADESP 392


>2np9A [x.x.x] DPGC
          Length = 423

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 4/132 (3%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           W    R+ KP +A+V G A GGG +L L  D ++A+  A F+LP  K G++PGA    RL
Sbjct: 265 WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPGAANL-RL 323

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
            R  G   +  + L  R + A+E +   LV  VV+ D L      +  ++      A++A
Sbjct: 324 GRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLA 380

Query: 208 LKESLNRAFEIP 219
            +  LN A E P
Sbjct: 381 NRRMLNLADESP 392


>2fw2F [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
          Length = 260

 Score = 68.2 bits (165), Expect = 3e-14
 Identities = 47/166 (28%), Positives = 76/166 (45%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ SV G A G G  +   CD++ A   A F  P    G  P    +   P+
Sbjct: 95  TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPK 154

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +GKA A +M ++ R L A EA   GLVS+V       +E M     +AS++A  L   K
Sbjct: 155 MMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECK 214

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
             +    ++ L +    E   L   +++A   E +  ++E +   F
Sbjct: 215 ALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF 260


>2fw2E [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
          Length = 259

 Score = 68.2 bits (165), Expect = 3e-14
 Identities = 47/166 (28%), Positives = 76/166 (45%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ SV G A G G  +   CD++ A   A F  P    G  P    +   P+
Sbjct: 94  TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPK 153

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +GKA A +M ++ R L A EA   GLVS+V       +E M     +AS++A  L   K
Sbjct: 154 MMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECK 213

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
             +    ++ L +    E   L   +++A   E +  ++E +   F
Sbjct: 214 ALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF 259


>2fw2A [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
          Length = 258

 Score = 68.2 bits (165), Expect = 3e-14
 Identities = 47/166 (28%), Positives = 76/166 (45%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ SV G A G G  +   CD++ A   A F  P    G  P    +   P+
Sbjct: 93  TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPK 152

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +GKA A +M ++ R L A EA   GLVS+V       +E M     +AS++A  L   K
Sbjct: 153 MMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECK 212

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
             +    ++ L +    E   L   +++A   E +  ++E +   F
Sbjct: 213 ALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF 258


>2fw2D [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
          Length = 257

 Score = 67.4 bits (163), Expect = 4e-14
 Identities = 46/162 (28%), Positives = 75/162 (46%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ SV G A G G  +   CD++ A   A F  P    G  P    +   P+
Sbjct: 94  TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPK 153

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +GKA A +M ++ R L A EA   GLVS+V       +E M     +AS++A  L   K
Sbjct: 154 MMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECK 213

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKR 251
             +    ++ L +    E   L   +++A   E +  ++E +
Sbjct: 214 ALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENK 255


>2fw2C [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
          Length = 256

 Score = 67.4 bits (163), Expect = 4e-14
 Identities = 46/162 (28%), Positives = 75/162 (46%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ SV G A G G  +   CD++ A   A F  P    G  P    +   P+
Sbjct: 95  TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPK 154

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +GKA A +M ++ R L A EA   GLVS+V       +E M     +AS++A  L   K
Sbjct: 155 MMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECK 214

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKR 251
             +    ++ L +    E   L   +++A   E +  ++E +
Sbjct: 215 ALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENK 256


>3h02E [x.x.x] NAPHTHOATE SYNTHASE
          Length = 253

 Score = 67.0 bits (162), Expect = 6e-14
 Identities = 57/165 (34%), Positives = 84/165 (50%), Gaps = 10/165 (6%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+   KPV+A VAG + GGG    L CD+ +AA +A F     K+G   G  G     R 
Sbjct: 92  IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDGGWGAS-YARI 147

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G+ KA ++    R  DA++A   GLV+ VV    L +ET++    + +  +PAL  LK 
Sbjct: 148 VGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA 204

Query: 211 SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           +LN   +    +  L E       F T + +EG  AF +KR+P F
Sbjct: 205 ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF 246


>3h02D [x.x.x] NAPHTHOATE SYNTHASE
          Length = 253

 Score = 67.0 bits (162), Expect = 6e-14
 Identities = 57/165 (34%), Positives = 84/165 (50%), Gaps = 10/165 (6%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+   KPV+A VAG + GGG    L CD+ +AA +A F     K+G   G  G     R 
Sbjct: 92  IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDGGWGAS-YARI 147

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G+ KA ++    R  DA++A   GLV+ VV    L +ET++    + +  +PAL  LK 
Sbjct: 148 VGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA 204

Query: 211 SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           +LN   +    +  L E       F T + +EG  AF +KR+P F
Sbjct: 205 ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF 246


>3h02C [x.x.x] NAPHTHOATE SYNTHASE
          Length = 251

 Score = 67.0 bits (162), Expect = 6e-14
 Identities = 57/165 (34%), Positives = 84/165 (50%), Gaps = 10/165 (6%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+   KPV+A VAG + GGG    L CD+ +AA +A F     K+G   G  G     R 
Sbjct: 90  IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDGGWGAS-YARI 145

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G+ KA ++    R  DA++A   GLV+ VV    L +ET++    + +  +PAL  LK 
Sbjct: 146 VGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA 202

Query: 211 SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           +LN   +    +  L E       F T + +EG  AF +KR+P F
Sbjct: 203 ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF 244


>3h02B [x.x.x] NAPHTHOATE SYNTHASE
          Length = 251

 Score = 67.0 bits (162), Expect = 6e-14
 Identities = 57/165 (34%), Positives = 84/165 (50%), Gaps = 10/165 (6%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+   KPV+A VAG + GGG    L CD+ +AA +A F     K+G   G  G     R 
Sbjct: 90  IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDGGWGAS-YARI 145

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G+ KA ++    R  DA++A   GLV+ VV    L +ET++    + +  +PAL  LK 
Sbjct: 146 VGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA 202

Query: 211 SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           +LN   +    +  L E       F T + +EG  AF +KR+P F
Sbjct: 203 ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF 244


>3h02A [x.x.x] NAPHTHOATE SYNTHASE
          Length = 255

 Score = 67.0 bits (162), Expect = 6e-14
 Identities = 57/165 (34%), Positives = 84/165 (50%), Gaps = 10/165 (6%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+   KPV+A VAG + GGG    L CD+ +AA +A F     K+G   G  G     R 
Sbjct: 94  IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDGGWGAS-YARI 149

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G+ KA ++    R  DA++A   GLV+ VV    L +ET++    + +  +PAL  LK 
Sbjct: 150 VGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA 206

Query: 211 SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           +LN   +    +  L E       F T + +EG  AF +KR+P F
Sbjct: 207 ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF 248


>2fw2B [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
          Length = 255

 Score = 66.6 bits (161), Expect = 8e-14
 Identities = 46/160 (28%), Positives = 74/160 (46%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ SV G A G G  +   CD++ A   A F  P    G  P    +   P+
Sbjct: 95  TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPK 154

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +GKA A +M ++ R L A EA   GLVS+V       +E M     +AS++A  L   K
Sbjct: 155 MMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECK 214

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLE 249
             +    ++ L +    E   L   +++A   E +  ++E
Sbjct: 215 ALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVE 254


>2ej5A [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
          Length = 250

 Score = 66.6 bits (161), Expect = 8e-14
 Identities = 56/247 (22%), Positives = 92/247 (37%), Gaps = 7/247 (2%)

Query: 9   EREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 68
           E +G+V  +TLNRP+ LNA  ++                                     
Sbjct: 8   EVKGQVAWLTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGE--- 64

Query: 69  XXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKF 128
              +  + DV  S +     + +  + KP                   CD  + +  A F
Sbjct: 65  ---DLDHGDVLRSRYAPM-MKALHHLEKPXXXXXXXXXXXXXXXXXXXCDFRLLSEKASF 120

Query: 129 ALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLRE 188
           A   I +GL+P AG    LPR +G+AKA+++ +    +            +V+      E
Sbjct: 121 APAFIHVGLVPDAGHLYYLPRLVGRAKALELAVLGEKVXXXXXXXXXXXXKVIPLSDWEE 180

Query: 189 ETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFL 248
           E  + A  +++    A+  +K  L  + E      +  E         T+D REG++AF 
Sbjct: 181 EVKQFAERLSAMPTKAIGLIKRLLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFF 240

Query: 249 EKRKPSF 255
           EKRKP F
Sbjct: 241 EKRKPLF 247


>1rjnB [c.14.1] MENB
          Length = 275

 Score = 66.2 bits (160), Expect = 1e-13
 Identities = 52/184 (28%), Positives = 82/184 (44%), Gaps = 2/184 (1%)

Query: 73  WSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALP 131
           W++        I      I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   
Sbjct: 86  WAFCSGGDQRHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQT 145

Query: 132 EIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETM 191
           +  +G   G  G+  L R +G+  A ++    R   AE+  + G V+ V +   L    +
Sbjct: 146 DADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGL 205

Query: 192 KLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKR 251
           + A  I + S  A   LK + N   +  L    LF        + T +A EG  AFL+KR
Sbjct: 206 QWAAEINAKSPQAQRMLKFAFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKR 264

Query: 252 KPSF 255
            P +
Sbjct: 265 PPDW 268


>1wdmB [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
           ALPHA SUBUNIT
          Length = 710

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 37/82 (45%), Positives = 47/82 (57%)

Query: 112 ELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEA 171
           E+ LA D  V A SAK  LPE+KLG+ PG GGT RLPR IG   A++   S +   AE+A
Sbjct: 120 EMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDA 179

Query: 172 DRYGLVSRVVDDDRLREETMKL 193
            +   V  VV  D+L    + L
Sbjct: 180 LKVSAVDAVVTADKLGAAALDL 201


>1wdmA [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
           ALPHA SUBUNIT
          Length = 707

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 37/82 (45%), Positives = 47/82 (57%)

Query: 112 ELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEA 171
           E+ LA D  V A SAK  LPE+KLG+ PG GGT RLPR IG   A++   S +   AE+A
Sbjct: 120 EMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDA 179

Query: 172 DRYGLVSRVVDDDRLREETMKL 193
            +   V  VV  D+L    + L
Sbjct: 180 LKVSAVDAVVTADKLGAAALDL 201


>1wdlB [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
           ALPHA SUBUNIT
          Length = 706

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 37/82 (45%), Positives = 47/82 (57%)

Query: 112 ELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEA 171
           E+ LA D  V A SAK  LPE+KLG+ PG GGT RLPR IG   A++   S +   AE+A
Sbjct: 120 EMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDA 179

Query: 172 DRYGLVSRVVDDDRLREETMKL 193
            +   V  VV  D+L    + L
Sbjct: 180 LKVSAVDAVVTADKLGAAALDL 201


>1wdlA [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
           ALPHA SUBUNIT
          Length = 715

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 37/82 (45%), Positives = 47/82 (57%)

Query: 112 ELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEA 171
           E+ LA D  V A SAK  LPE+KLG+ PG GGT RLPR IG   A++   S +   AE+A
Sbjct: 120 EMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDA 179

Query: 172 DRYGLVSRVVDDDRLREETMKL 193
            +   V  VV  D+L    + L
Sbjct: 180 LKVSAVDAVVTADKLGAAALDL 201


>1wdkB [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
           ALPHA SUBUNIT
          Length = 711

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 37/82 (45%), Positives = 47/82 (57%)

Query: 112 ELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEA 171
           E+ LA D  V A SAK  LPE+KLG+ PG GGT RLPR IG   A++   S +   AE+A
Sbjct: 120 EMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDA 179

Query: 172 DRYGLVSRVVDDDRLREETMKL 193
            +   V  VV  D+L    + L
Sbjct: 180 LKVSAVDAVVTADKLGAAALDL 201


>1wdkA [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
           ALPHA SUBUNIT
          Length = 708

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 37/82 (45%), Positives = 47/82 (57%)

Query: 112 ELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEA 171
           E+ LA D  V A SAK  LPE+KLG+ PG GGT RLPR IG   A++   S +   AE+A
Sbjct: 120 EMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDA 179

Query: 172 DRYGLVSRVVDDDRLREETMKL 193
            +   V  VV  D+L    + L
Sbjct: 180 LKVSAVDAVVTADKLGAAALDL 201


>2ej5B [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
          Length = 251

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 56/247 (22%), Positives = 91/247 (36%), Gaps = 6/247 (2%)

Query: 9   EREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 68
           E +G+V  +TLNRP+ LNA  ++                                     
Sbjct: 8   EVKGQVAWLTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGEDLS 67

Query: 69  XXXEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKF 128
                 + DV  S +     + +  + KP                   CD  + +  A F
Sbjct: 68  -----DHGDVLRSRYAPM-MKALHHLEKPXXXXXXXXXXXXXXXXXXXCDFRLLSEKASF 121

Query: 129 ALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLRE 188
           A   I +GL+P AG    LPR +G+AKA+++ +    +            +V+      E
Sbjct: 122 APAFIHVGLVPDAGHLYYLPRLVGRAKALELAVLGEKVXXXXXXXXXXXXKVIPLSDWEE 181

Query: 189 ETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFL 248
           E  + A  +++    A+  +K  L  + E      +  E         T+D REG++AF 
Sbjct: 182 EVKQFAERLSAMPTKAIGLIKRLLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFF 241

Query: 249 EKRKPSF 255
           EKRKP F
Sbjct: 242 EKRKPLF 248


>1q51A [c.14.1] MENB
          Length = 271

 Score = 65.1 bits (157), Expect = 2e-13
 Identities = 52/184 (28%), Positives = 82/184 (44%), Gaps = 2/184 (1%)

Query: 73  WSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALP 131
           W++        I      I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   
Sbjct: 82  WAFCSGGDQLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQT 141

Query: 132 EIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETM 191
           +  +G   G  G+  L R +G+  A ++    R   AE+  + G V+ V +   L    +
Sbjct: 142 DADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGL 201

Query: 192 KLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKR 251
           + A  I + S  A   LK + N   +  L    LF        + T +A EG  AFL+KR
Sbjct: 202 QWAAEINAKSPQAQRMLKFAFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKR 260

Query: 252 KPSF 255
            P +
Sbjct: 261 PPDW 264


>2gtrB [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN
          Length = 258

 Score = 65.1 bits (157), Expect = 2e-13
 Identities = 46/166 (27%), Positives = 74/166 (44%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ +V G A G G  +   CD++ A   A F  P    G  P    T   P+
Sbjct: 93  TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPK 152

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G A A +M LS R L A+EA   GLVS+V       +E M     +AS +   L   K
Sbjct: 153 IMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESK 212

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
             +    ++ L +    E   L   + +A   + +  +L+++   F
Sbjct: 213 ALVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF 258


>1q52K [c.14.1] MENB
          Length = 271

 Score = 64.7 bits (156), Expect = 3e-13
 Identities = 50/166 (30%), Positives = 78/166 (46%), Gaps = 2/166 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALPEIKLGLLPGAGGTQRLPR 149
           I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   +  +G   G  G+  L R
Sbjct: 100 IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLAR 159

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G+  A ++    R   AE+  + G V+ V +   L    ++ A  I + S  A   LK
Sbjct: 160 QVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLK 219

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
            + N   +  L    LF        + T +A EG  AFL+KR P +
Sbjct: 220 FAFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW 264


>1q52B [c.14.1] MENB
          Length = 279

 Score = 64.7 bits (156), Expect = 3e-13
 Identities = 50/166 (30%), Positives = 78/166 (46%), Gaps = 2/166 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALPEIKLGLLPGAGGTQRLPR 149
           I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   +  +G   G  G+  L R
Sbjct: 108 IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLAR 167

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G+  A ++    R   AE+  + G V+ V +   L    ++ A  I + S  A   LK
Sbjct: 168 QVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLK 227

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
            + N   +  L    LF        + T +A EG  AFL+KR P +
Sbjct: 228 FAFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW 272


>1q52A [c.14.1] MENB
          Length = 269

 Score = 64.7 bits (156), Expect = 3e-13
 Identities = 50/166 (30%), Positives = 78/166 (46%), Gaps = 2/166 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALPEIKLGLLPGAGGTQRLPR 149
           I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   +  +G   G  G+  L R
Sbjct: 98  IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLAR 157

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G+  A ++    R   AE+  + G V+ V +   L    ++ A  I + S  A   LK
Sbjct: 158 QVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLK 217

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
            + N   +  L    LF        + T +A EG  AFL+KR P +
Sbjct: 218 FAFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW 262


>1q51B [c.14.1] MENB
          Length = 280

 Score = 64.7 bits (156), Expect = 3e-13
 Identities = 50/166 (30%), Positives = 78/166 (46%), Gaps = 2/166 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALPEIKLGLLPGAGGTQRLPR 149
           I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   +  +G   G  G+  L R
Sbjct: 109 IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLAR 168

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G+  A ++    R   AE+  + G V+ V +   L    ++ A  I + S  A   LK
Sbjct: 169 QVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLK 228

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
            + N   +  L    LF        + T +A EG  AFL+KR P +
Sbjct: 229 FAFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW 273


>2gtrA [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN
          Length = 258

 Score = 64.3 bits (155), Expect = 4e-13
 Identities = 45/162 (27%), Positives = 73/162 (45%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ +V G A G G  +   CD++ A   A F  P    G  P    T   P+
Sbjct: 94  TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPK 153

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G A A +M LS R L A+EA   GLVS+V       +E M     +AS +   L   K
Sbjct: 154 IMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESK 213

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKR 251
             +    ++ L +    E   L   + +A   + +  +L+++
Sbjct: 214 ALVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRK 255


>2fbmB [x.x.x] Y CHROMOSOME CHROMODOMAIN PROTEIN 1, TELOMERIC
          Length = 250

 Score = 63.2 bits (152), Expect = 8e-13
 Identities = 45/160 (28%), Positives = 71/160 (44%), Gaps = 3/160 (1%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ SV G A G G  +   CD++ A   A F  P    G  P    +   P+
Sbjct: 93  TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPK 152

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +GKA A +M ++ R L A EA   GLVS+V       +E M     +AS++   L   K
Sbjct: 153 MMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVLEECK 212

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLE 249
             +    ++ L +      RE         + +GI + L+
Sbjct: 213 ALVRCNIKLELEQA---NERECEVLRKIWSSAQGIESMLK 249


>2fbmA [x.x.x] Y CHROMOSOME CHROMODOMAIN PROTEIN 1, TELOMERIC
          Length = 251

 Score = 63.2 bits (152), Expect = 8e-13
 Identities = 45/160 (28%), Positives = 71/160 (44%), Gaps = 3/160 (1%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ SV G A G G  +   CD++ A   A F  P    G  P    +   P+
Sbjct: 94  TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPK 153

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +GKA A +M ++ R L A EA   GLVS+V       +E M     +AS++   L   K
Sbjct: 154 MMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVLEECK 213

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLE 249
             +    ++ L +      RE         + +GI + L+
Sbjct: 214 ALVRCNIKLELEQA---NERECEVLRKIWSSAQGIESMLK 250


>2a7kC [x.x.x] CARB
          Length = 238

 Score = 62.4 bits (150), Expect = 1e-12
 Identities = 47/154 (30%), Positives = 75/154 (48%), Gaps = 3/154 (1%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 87  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 145

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 146 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 205

Query: 208 LKESLNRAFEIPLAEGILFERRELH-ARFATADA 240
            K ++N+ F I L E      + +H A F   DA
Sbjct: 206 TKRAVNKPF-IHLLEQTRDASKAVHKAAFQARDA 238


>2gtrC [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN
          Length = 250

 Score = 62.0 bits (149), Expect = 2e-12
 Identities = 41/125 (32%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 90  TIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPR 149
           T  + +KP++ +V G A G G  +   CD++ A   A F  P    G  P    T   P+
Sbjct: 94  TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPK 153

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G A A +M LS R L A+EA   GLVS+V       +E M     +AS + P ++   
Sbjct: 154 IMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCN-PVVLEES 212

Query: 210 ESLNR 214
           ++L R
Sbjct: 213 KALVR 217


>1dciA [c.14.1] DIENOYL-COA ISOMERASE
          Length = 275

 Score = 62.0 bits (149), Expect = 2e-12
 Identities = 52/178 (29%), Positives = 85/178 (47%), Gaps = 5/178 (2%)

Query: 79  YSSNFITRNWET---IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKL 135
           Y  + I+R  +T   I++  KPV             +L  ACDI    + A F + E+ +
Sbjct: 88  YLRDLISRYQKTFTVIEKCPKPVXXXXXXXXXXXXVDLISACDIRYCTQDAFFQVKEVDV 147

Query: 136 GLLPGAGGTQRLPRAIG-KAKAMDMCLSARPLDAEEADRYGLVSRVV-DDDRLREETMKL 193
           GL    G  QRLP+ IG ++   ++  +AR + A+EA   GLVSRV  D D +      L
Sbjct: 148 GLAADVGTLQRLPKVIGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFAL 207

Query: 194 ATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKR 251
           A  I+S S  A+   K +L  + +  + E + +      +   T D  + ++A +EK+
Sbjct: 208 AADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKK 265


>2a81A [x.x.x] CARB
          Length = 235

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 87  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 145

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 146 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 205

Query: 208 LKESLNRAF 216
            K ++N+ F
Sbjct: 206 TKRAVNKPF 214


>2a7kI [x.x.x] CARB
          Length = 228

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 86  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 144

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 145 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 204

Query: 208 LKESLNRAF 216
            K ++N+ F
Sbjct: 205 TKRAVNKPF 213


>2a7kH [x.x.x] CARB
          Length = 231

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 87  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 145

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 146 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 205

Query: 208 LKESLNRAF 216
            K ++N+ F
Sbjct: 206 TKRAVNKPF 214


>2a7kG [x.x.x] CARB
          Length = 228

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 85  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 143

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 144 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 203

Query: 208 LKESLNRAF 216
            K ++N+ F
Sbjct: 204 TKRAVNKPF 212


>2a7kF [x.x.x] CARB
          Length = 226

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 87  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 145

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 146 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 205

Query: 208 LKESLNRAF 216
            K ++N+ F
Sbjct: 206 TKRAVNKPF 214


>2a7kE [x.x.x] CARB
          Length = 236

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 87  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 145

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 146 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 205

Query: 208 LKESLNRAF 216
            K ++N+ F
Sbjct: 206 TKRAVNKPF 214


>2a7kD [x.x.x] CARB
          Length = 228

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 85  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 143

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 144 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 203

Query: 208 LKESLNRAF 216
            K ++N+ F
Sbjct: 204 TKRAVNKPF 212


>2a7kB [x.x.x] CARB
          Length = 230

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 87  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 145

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 146 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 205

Query: 208 LKESLNRAF 216
            K ++N+ F
Sbjct: 206 TKRAVNKPF 214


>2a7kA [x.x.x] CARB
          Length = 229

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRL 147
           ++ +  V KP +A+V G A G G + AL  D  + A +A F +PE+K G+    G    L
Sbjct: 86  YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-IL 144

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
               G +   ++    + LDA     Y LV++VV+   L +  +  A  +AS+ A A + 
Sbjct: 145 GFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN 204

Query: 208 LKESLNRAF 216
            K ++N+ F
Sbjct: 205 TKRAVNKPF 213


>3gkbC [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
          Length = 276

 Score = 60.8 bits (146), Expect = 4e-12
 Identities = 48/162 (29%), Positives = 74/162 (45%), Gaps = 4/162 (2%)

Query: 89  ETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAK-FALPEIKLGLLPGAGGTQRL 147
           E I+   +  +  +AG A GGG                      E  +G++PG GGTQ L
Sbjct: 96  ELIRHQPQVTIVKLAGKARGGGXXXXXXXXXXXXXXXXXGLGQIEALMGIIPGGGGTQYL 155

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G+ +A+++ L+A   DAE A  YG ++R +  D L E   ++A  IA+     + A
Sbjct: 156 RGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEA 215

Query: 208 LKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLE 249
            K SL       L EG+L E     A F+   A++ I   L+
Sbjct: 216 AKRSLPAD---DLKEGLLGENDAWAATFSLPAAQQLISGGLK 254


>3gkbB [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
          Length = 280

 Score = 60.8 bits (146), Expect = 4e-12
 Identities = 48/162 (29%), Positives = 74/162 (45%), Gaps = 4/162 (2%)

Query: 89  ETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAK-FALPEIKLGLLPGAGGTQRL 147
           E I+   +  +  +AG A GGG                      E  +G++PG GGTQ L
Sbjct: 93  ELIRHQPQVTIVKLAGKARGGGXXXXXXXXXXXXXXXXXGLGQIEALMGIIPGGGGTQYL 152

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G+ +A+++ L+A   DAE A  YG ++R +  D L E   ++A  IA+     + A
Sbjct: 153 RGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEA 212

Query: 208 LKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLE 249
            K SL       L EG+L E     A F+   A++ I   L+
Sbjct: 213 AKRSLPAD---DLKEGLLGENDAWAATFSLPAAQQLISGGLK 251


>3gkbA [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
          Length = 274

 Score = 60.8 bits (146), Expect = 4e-12
 Identities = 48/162 (29%), Positives = 74/162 (45%), Gaps = 4/162 (2%)

Query: 89  ETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAK-FALPEIKLGLLPGAGGTQRL 147
           E I+   +  +  +AG A GGG                      E  +G++PG GGTQ L
Sbjct: 94  ELIRHQPQVTIVKLAGKARGGGXXXXXXXXXXXXXXXXXGLGQIEALMGIIPGGGGTQYL 153

Query: 148 PRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMA 207
              +G+ +A+++ L+A   DAE A  YG ++R +  D L E   ++A  IA+     + A
Sbjct: 154 RGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEA 213

Query: 208 LKESLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLE 249
            K SL       L EG+L E     A F+   A++ I   L+
Sbjct: 214 AKRSLPAD---DLKEGLLGENDAWAATFSLPAAQQLISGGLK 252


>3he2C [x.x.x] ENOYL-COA HYDRATASE ECHA6
          Length = 238

 Score = 60.1 bits (144), Expect = 7e-12
 Identities = 48/159 (30%), Positives = 69/159 (43%), Gaps = 6/159 (3%)

Query: 97  PVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKA 156
           PV+ ++ G A G G +LA+ CD+ V A  A F  P  K GL       +RL   +G  +A
Sbjct: 83  PVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDNWSIRRLSSLVGHGRA 142

Query: 157 MDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAF 216
             M LSA  L AE A   G+ +R+        +    A  IA  +  A+   K  LN   
Sbjct: 143 RAMLLSAEKLTAEIALHTGMANRI----GTLADAQAWAAEIARLAPLAIQHAKRVLND-- 196

Query: 217 EIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           +  + E     +      + + D  E   A +EKR P F
Sbjct: 197 DGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF 235


>3he2A [x.x.x] ENOYL-COA HYDRATASE ECHA6
          Length = 240

 Score = 60.1 bits (144), Expect = 7e-12
 Identities = 48/159 (30%), Positives = 69/159 (43%), Gaps = 6/159 (3%)

Query: 97  PVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKA 156
           PV+ ++ G A G G +LA+ CD+ V A  A F  P  K GL       +RL   +G  +A
Sbjct: 85  PVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDNWSIRRLSSLVGHGRA 144

Query: 157 MDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAF 216
             M LSA  L AE A   G+ +R+        +    A  IA  +  A+   K  LN   
Sbjct: 145 RAMLLSAEKLTAEIALHTGMANRI----GTLADAQAWAAEIARLAPLAIQHAKRVLND-- 198

Query: 217 EIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSF 255
           +  + E     +      + + D  E   A +EKR P F
Sbjct: 199 DGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF 237


>3h02F [x.x.x] NAPHTHOATE SYNTHASE
          Length = 228

 Score = 56.6 bits (135), Expect = 8e-11
 Identities = 45/123 (36%), Positives = 66/123 (53%), Gaps = 7/123 (5%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I+   KPV+A VAG + GGG    L CD+ +AA +A F     K+G   G  G     R 
Sbjct: 92  IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDGGWGAS-YARI 147

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G+ KA ++    R  DA++A   GLV+ VV    L +ET++    +   ++PAL  LK 
Sbjct: 148 VGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQ--NSPALRCLKA 204

Query: 211 SLN 213
           +LN
Sbjct: 205 ALN 207


>1nzyC [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
          Length = 268

 Score = 56.2 bits (134), Expect = 1e-10
 Identities = 40/137 (29%), Positives = 60/137 (43%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I RV++P                    D+ + A SAKF      +G+      +  L R 
Sbjct: 96  IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGNDTATSYSLARI 155

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  +AM++ L+ R L  EEA  +GLVSRV   D  RE   K+A  +A+      +  KE
Sbjct: 156 VGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE 215

Query: 211 SLNRAFEIPLAEGILFE 227
             +  +  P+ E   FE
Sbjct: 216 RFHAGWMQPVEECTEFE 232


>1nzyB [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
          Length = 269

 Score = 56.2 bits (134), Expect = 1e-10
 Identities = 40/137 (29%), Positives = 60/137 (43%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I RV++P                    D+ + A SAKF      +G+      +  L R 
Sbjct: 96  IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGNDTATSYSLARI 155

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  +AM++ L+ R L  EEA  +GLVSRV   D  RE   K+A  +A+      +  KE
Sbjct: 156 VGMRRAMELMLTDRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE 215

Query: 211 SLNRAFEIPLAEGILFE 227
             +  +  P+ E   FE
Sbjct: 216 RFHAGWMQPVEECTEFE 232


>1nzyA [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
          Length = 269

 Score = 56.2 bits (134), Expect = 1e-10
 Identities = 40/137 (29%), Positives = 60/137 (43%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I RV++P                    D+ + A SAKF      +G+      +  L R 
Sbjct: 96  IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGNDTATSYSLARI 155

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  +AM++ L+ R L  EEA  +GLVSRV   D  RE   K+A  +A+      +  KE
Sbjct: 156 VGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE 215

Query: 211 SLNRAFEIPLAEGILFE 227
             +  +  P+ E   FE
Sbjct: 216 RFHAGWMQPVEECTEFE 232


>1jxzC [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
          Length = 264

 Score = 56.2 bits (134), Expect = 1e-10
 Identities = 40/137 (29%), Positives = 60/137 (43%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I RV++P                    D+ + A SAKF      +G+      +  L R 
Sbjct: 96  IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGNDTATSYSLARI 155

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  +AM++ L+ R L  EEA  +GLVSRV   D  RE   K+A  +A+      +  KE
Sbjct: 156 VGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE 215

Query: 211 SLNRAFEIPLAEGILFE 227
             +  +  P+ E   FE
Sbjct: 216 RFHAGWMQPVEECTEFE 232


>1jxzB [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
          Length = 269

 Score = 56.2 bits (134), Expect = 1e-10
 Identities = 40/137 (29%), Positives = 60/137 (43%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I RV++P                    D+ + A SAKF      +G+      +  L R 
Sbjct: 96  IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGNDTATSYSLARI 155

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  +AM++ L+ R L  EEA  +GLVSRV   D  RE   K+A  +A+      +  KE
Sbjct: 156 VGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE 215

Query: 211 SLNRAFEIPLAEGILFE 227
             +  +  P+ E   FE
Sbjct: 216 RFHAGWMQPVEECTEFE 232


>1jxzA [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
          Length = 268

 Score = 56.2 bits (134), Expect = 1e-10
 Identities = 40/137 (29%), Positives = 60/137 (43%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRA 150
           I RV++P                    D+ + A SAKF      +G+      +  L R 
Sbjct: 95  IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGNDTATSYSLARI 154

Query: 151 IGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE 210
           +G  +AM++ L+ R L  EEA  +GLVSRV   D  RE   K+A  +A+      +  KE
Sbjct: 155 VGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE 214

Query: 211 SLNRAFEIPLAEGILFE 227
             +  +  P+ E   FE
Sbjct: 215 RFHAGWMQPVEECTEFE 231


>3i47A [x.x.x] ENOYL COA HYDRATASE/ISOMERASE (CROTONASE)
          Length = 259

 Score = 55.8 bits (133), Expect = 1e-10
 Identities = 42/130 (32%), Positives = 66/130 (50%), Gaps = 2/130 (1%)

Query: 127 KFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRL 186
           +F   E+KLGL+P A  +  + RAIG+  A  + +SA   DA  A    LV   V DD L
Sbjct: 130 RFCFSEVKLGLIP-AVISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTL 188

Query: 187 REETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATAD-AREGIR 245
            E T+K A+ I++ +  A+   K+         + E ++     L A    +D  +EG++
Sbjct: 189 LEFTLKYASQISNNAPEAVKNSKQLAQYVANKKIDEELVRYTASLIAHKRVSDEGQEGLK 248

Query: 246 AFLEKRKPSF 255
           AFL K  P++
Sbjct: 249 AFLNKEIPNW 258


>1rjnA [c.14.1] MENB
          Length = 259

 Score = 53.9 bits (128), Expect = 5e-10
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 2/154 (1%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALPEIKLGLLPGAGGTQRLPR 149
           I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   +  +G   G  G+  L R
Sbjct: 106 IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLAR 165

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G+  A ++    R   AE+  + G V+ V +   L    ++ A  I + S  A   LK
Sbjct: 166 QVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLK 225

Query: 210 ESLNRAFEIPLAEGILFERRELHARFATADAREG 243
            + N   +  L    LF        + T +A EG
Sbjct: 226 FAFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEG 258


>1rjnC [c.14.1] MENB
          Length = 245

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALPEIKLGLLPGAGGTQRLPR 149
           I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   +  +G   G  G+  L R
Sbjct: 103 IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLAR 162

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G+  A ++    R   AE+  + G V+ V +   L    ++ A  I + S  A   LK
Sbjct: 163 QVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLK 222

Query: 210 ESLN 213
            + N
Sbjct: 223 FAFN 226


>1rjmB [c.14.1] MENB
          Length = 240

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALPEIKLGLLPGAGGTQRLPR 149
           I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   +  +G   G  G+  L R
Sbjct: 98  IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLAR 157

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G+  A ++    R   AE+  + G V+ V +   L    ++ A  I + S  A   LK
Sbjct: 158 QVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLK 217

Query: 210 ESLN 213
            + N
Sbjct: 218 FAFN 221


>1rjmA [c.14.1] MENB
          Length = 239

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALPEIKLGLLPGAGGTQRLPR 149
           I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   +  +G   G  G+  L R
Sbjct: 97  IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLAR 156

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G+  A ++    R   AE+  + G V+ V +   L    ++ A  I + S  A   LK
Sbjct: 157 QVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLK 216

Query: 210 ESLN 213
            + N
Sbjct: 217 FAFN 220


>1uiyA [c.14.1] ENOYL-COA HYDRATASE
          Length = 248

 Score = 52.4 bits (124), Expect = 1e-09
 Identities = 41/130 (31%), Positives = 59/130 (45%), Gaps = 2/130 (1%)

Query: 126 AKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDR 185
           A+    E+K+G +  A  +  L RA+G+  A D+ L+ R ++A EA   GLV+R+     
Sbjct: 121 ARLGYTEVKIGFV-AALVSVILVRAVGEKAAKDLLLTGRLVEAREAKALGLVNRIAPPGX 179

Query: 186 LREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADAREGIR 245
                      +A  +AP  + L + L  A    L +G             T D  EGIR
Sbjct: 180 XXXXXXXXXXXVAK-NAPTSLRLTKELLLALPGGLEDGFRLAALANAWVRETGDLAEGIR 238

Query: 246 AFLEKRKPSF 255
           AF EKR P F
Sbjct: 239 AFFEKRPPRF 248


>1szoF [c.14.1] 6-OXOCAMPHOR HYDROLASE
          Length = 248

 Score = 52.0 bits (123), Expect = 2e-09
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 6/139 (4%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFAL-PEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+A+V G       E+ +  DI++AA SA F   P    G++PG G     P  +G
Sbjct: 103 IEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLG 161

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIAS----FSAPALMAL 208
             +     L+ + LDA  A  YG V+ V+ +  L     +LA  IA         A   L
Sbjct: 162 SNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVL 221

Query: 209 KESLNRAFEIPLAEGILFE 227
              L R  E  L+ G+  E
Sbjct: 222 TRQLRRVMEADLSLGLAHE 240


>1szoD [c.14.1] 6-OXOCAMPHOR HYDROLASE
          Length = 251

 Score = 52.0 bits (123), Expect = 2e-09
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 6/139 (4%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFAL-PEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+A+V G       E+ +  DI++AA SA F   P    G++PG G     P  +G
Sbjct: 106 IEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLG 164

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIAS----FSAPALMAL 208
             +     L+ + LDA  A  YG V+ V+ +  L     +LA  IA         A   L
Sbjct: 165 SNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVL 224

Query: 209 KESLNRAFEIPLAEGILFE 227
              L R  E  L+ G+  E
Sbjct: 225 TRQLRRVMEADLSLGLAHE 243


>1szoB [c.14.1] 6-OXOCAMPHOR HYDROLASE
          Length = 248

 Score = 52.0 bits (123), Expect = 2e-09
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 6/139 (4%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFAL-PEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+A+V G       E+ +  DI++AA SA F   P    G++PG G     P  +G
Sbjct: 104 IEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLG 162

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIAS----FSAPALMAL 208
             +     L+ + LDA  A  YG V+ V+ +  L     +LA  IA         A   L
Sbjct: 163 SNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVL 222

Query: 209 KESLNRAFEIPLAEGILFE 227
              L R  E  L+ G+  E
Sbjct: 223 TRQLRRVMEADLSLGLAHE 241


>1szoA [c.14.1] 6-OXOCAMPHOR HYDROLASE
          Length = 249

 Score = 52.0 bits (123), Expect = 2e-09
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 6/139 (4%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFAL-PEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+A+V G       E+ +  DI++AA SA F   P    G++PG G     P  +G
Sbjct: 104 IEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLG 162

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIAS----FSAPALMAL 208
             +     L+ + LDA  A  YG V+ V+ +  L     +LA  IA         A   L
Sbjct: 163 SNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVL 222

Query: 209 KESLNRAFEIPLAEGILFE 227
              L R  E  L+ G+  E
Sbjct: 223 TRQLRRVMEADLSLGLAHE 241


>3g64A [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
          Length = 268

 Score = 51.6 bits (122), Expect = 3e-09
 Identities = 45/141 (31%), Positives = 61/141 (43%), Gaps = 3/141 (2%)

Query: 118 DIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLV 177
           D  VA  S +FA    ++GL  G G    LPR +G   A  + L    + A EA+R GL+
Sbjct: 131 DFRVADPSTRFAFLFTRVGLSGGDGAAYLLPRVVGLGHATRLLL-GDTVRAPEAERIGLI 189

Query: 178 SRVVDDDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFAT 237
           S + ++ R  E    LA  +A   A A    K  L    + PLA  +  +     A    
Sbjct: 190 SELTEEGRADEAARTLARRLADGPALAHAQTKALLTAELD-PLAAAVELD-ASTQALLTG 247

Query: 238 ADAREGIRAFLEKRKPSFVHR 258
            D  E   AF EKR P +  R
Sbjct: 248 EDYAEFHAAFTEKRPPKWQGR 268


>1o8uF [c.14.1] 6-OXO CAMPHOR HYDROLASE
          Length = 248

 Score = 51.2 bits (121), Expect = 3e-09
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 6/139 (4%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFAL-PEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+A+V G       E+ +  DI++AA SA F   P    G++PG G     P  +G
Sbjct: 103 IEVPVIAAVNGPVTNHP-EIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLG 161

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIAS----FSAPALMAL 208
             +     L+ + LDA  A  YG V+ V+ +  L     +LA  IA         A   L
Sbjct: 162 SNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVL 221

Query: 209 KESLNRAFEIPLAEGILFE 227
              L R  E  L+ G+  E
Sbjct: 222 TRQLRRVMEADLSLGLAHE 240


>1o8uC [c.14.1] 6-OXO CAMPHOR HYDROLASE
          Length = 247

 Score = 51.2 bits (121), Expect = 3e-09
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 6/139 (4%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFAL-PEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+A+V G       E+ +  DI++AA SA F   P    G++PG G     P  +G
Sbjct: 102 IEVPVIAAVNGPVTNHP-EIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLG 160

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIAS----FSAPALMAL 208
             +     L+ + LDA  A  YG V+ V+ +  L     +LA  IA         A   L
Sbjct: 161 SNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVL 220

Query: 209 KESLNRAFEIPLAEGILFE 227
              L R  E  L+ G+  E
Sbjct: 221 TRQLRRVMEADLSLGLAHE 239


>1o8uA [c.14.1] 6-OXO CAMPHOR HYDROLASE
          Length = 249

 Score = 51.2 bits (121), Expect = 3e-09
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 6/139 (4%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFAL-PEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+A+V G       E+ +  DI++AA SA F   P    G++PG G     P  +G
Sbjct: 104 IEVPVIAAVNGPVTNHP-EIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLG 162

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIAS----FSAPALMAL 208
             +     L+ + LDA  A  YG V+ V+ +  L     +LA  IA         A   L
Sbjct: 163 SNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVL 222

Query: 209 KESLNRAFEIPLAEGILFE 227
              L R  E  L+ G+  E
Sbjct: 223 TRQLRRVMEADLSLGLAHE 241


>3fduF [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 215

 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 93  RVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIG 152
           R+ KP+                L  D++ A  +A F +P + LGL P  G +Q L +  G
Sbjct: 77  RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAG 136

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
             KA ++  +A+  +AE A + GLV+ +V+D
Sbjct: 137 YHKAAELLFTAKKFNAETALQAGLVNEIVED 167


>3fduE [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 234

 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 93  RVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIG 152
           R+ KP+                L  D++ A  +A F +P + LGL P  G +Q L +  G
Sbjct: 87  RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAG 146

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
             KA ++  +A+  +AE A + GLV+ +V+D
Sbjct: 147 YHKAAELLFTAKKFNAETALQAGLVNEIVED 177


>3fduD [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 225

 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 93  RVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIG 152
           R+ KP+                L  D++ A  +A F +P + LGL P  G +Q L +  G
Sbjct: 86  RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAG 145

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
             KA ++  +A+  +AE A + GLV+ +V+D
Sbjct: 146 YHKAAELLFTAKKFNAETALQAGLVNEIVED 176


>3fduC [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 227

 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 93  RVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIG 152
           R+ KP+                L  D++ A  +A F +P + LGL P  G +Q L +  G
Sbjct: 83  RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAG 142

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
             KA ++  +A+  +AE A + GLV+ +V+D
Sbjct: 143 YHKAAELLFTAKKFNAETALQAGLVNEIVED 173


>3fduB [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 232

 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 93  RVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIG 152
           R+ KP+                L  D++ A  +A F +P + LGL P  G +Q L +  G
Sbjct: 86  RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAG 145

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
             KA ++  +A+  +AE A + GLV+ +V+D
Sbjct: 146 YHKAAELLFTAKKFNAETALQAGLVNEIVED 176


>3fduA [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 248

 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 93  RVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIG 152
           R+ KP+                L  D++ A  +A F +P + LGL P  G +Q L +  G
Sbjct: 96  RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAG 155

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDD 183
             KA ++  +A+  +AE A + GLV+ +V+D
Sbjct: 156 YHKAAELLFTAKKFNAETALQAGLVNEIVED 186


>1wz8A [x.x.x] ENOYL-COA HYDRATASE
          Length = 263

 Score = 49.3 bits (116), Expect = 1e-08
 Identities = 28/81 (34%), Positives = 44/81 (54%)

Query: 133 IKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMK 192
           ++LG+  G       P  +G AKA    L   PL  EEA+R GLV+  V+D+++ E+ ++
Sbjct: 141 LRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALE 200

Query: 193 LATTIASFSAPALMALKESLN 213
           +A  +A     AL   K +LN
Sbjct: 201 VAERLAQGPKEALHHTKHALN 221


>2j5sA [x.x.x] BETA-DIKETONE HYDROLASE
          Length = 250

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 2/132 (1%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFA-LPEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+++V G A     E  L  DII+A+ +  F  +P +  G++PG G     P A+G
Sbjct: 104 IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQDMPHLNAGIVPGDGVHILWPLALG 162

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESL 212
             +      +   L A++A    +V  V+   +L E   ++A T+A      L   + +L
Sbjct: 163 LYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVAL 222

Query: 213 NRAFEIPLAEGI 224
            +  +  + EGI
Sbjct: 223 TQRLKRLVNEGI 234


>2j5gE [x.x.x] ALR4455 PROTEIN
          Length = 249

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 2/132 (1%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFA-LPEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+++V G A     E  L  DII+A+ +  F  +P +  G++PG G     P A+G
Sbjct: 102 IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQDMPHLNAGIVPGDGVHILWPLALG 160

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESL 212
             +      +   L A++A    +V  V+   +L E   ++A T+A      L   + +L
Sbjct: 161 LYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVAL 220

Query: 213 NRAFEIPLAEGI 224
            +  +  + EGI
Sbjct: 221 TQRLKRLVNEGI 232


>2j5gD [x.x.x] ALR4455 PROTEIN
          Length = 249

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 2/132 (1%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFA-LPEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+++V G A     E  L  DII+A+ +  F  +P +  G++PG G     P A+G
Sbjct: 102 IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQDMPHLNAGIVPGDGVHILWPLALG 160

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESL 212
             +      +   L A++A    +V  V+   +L E   ++A T+A      L   + +L
Sbjct: 161 LYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVAL 220

Query: 213 NRAFEIPLAEGI 224
            +  +  + EGI
Sbjct: 221 TQRLKRLVNEGI 232


>2j5gB [x.x.x] ALR4455 PROTEIN
          Length = 249

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 2/132 (1%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFA-LPEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+++V G A     E  L  DII+A+ +  F  +P +  G++PG G     P A+G
Sbjct: 103 IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQDMPHLNAGIVPGDGVHILWPLALG 161

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESL 212
             +      +   L A++A    +V  V+   +L E   ++A T+A      L   + +L
Sbjct: 162 LYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVAL 221

Query: 213 NRAFEIPLAEGI 224
            +  +  + EGI
Sbjct: 222 TQRLKRLVNEGI 233


>2j5gA [x.x.x] ALR4455 PROTEIN
          Length = 248

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 2/132 (1%)

Query: 94  VRKPVLASVAGLAFGGGCELALACDIIVAARSAKFA-LPEIKLGLLPGAGGTQRLPRAIG 152
           +  PV+++V G A     E  L  DII+A+ +  F  +P +  G++PG G     P A+G
Sbjct: 102 IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQDMPHLNAGIVPGDGVHILWPLALG 160

Query: 153 KAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESL 212
             +      +   L A++A    +V  V+   +L E   ++A T+A      L   + +L
Sbjct: 161 LYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVAL 220

Query: 213 NRAFEIPLAEGI 224
            +  +  + EGI
Sbjct: 221 TQRLKRLVNEGI 232


>3isaF [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 242

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 99  LASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMD 158
           LA   G  FG G +L  AC        A F +P +K GL+ G   T+R    +G  +A+ 
Sbjct: 100 LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG---TRRFRDIVGADQALS 156

Query: 159 MCLSARPLDAEEADRYGLV 177
           +  SAR  DA+EA R G V
Sbjct: 157 ILGSARAFDADEARRIGFV 175


>3isaD [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 242

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 99  LASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMD 158
           LA   G  FG G +L  AC        A F +P +K GL+ G   T+R    +G  +A+ 
Sbjct: 99  LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG---TRRFRDIVGADQALS 155

Query: 159 MCLSARPLDAEEADRYGLV 177
           +  SAR  DA+EA R G V
Sbjct: 156 ILGSARAFDADEARRIGFV 174


>3isaC [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 239

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 99  LASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMD 158
           LA   G  FG G +L  AC        A F +P +K GL+ G   T+R    +G  +A+ 
Sbjct: 97  LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG---TRRFRDIVGADQALS 153

Query: 159 MCLSARPLDAEEADRYGLV 177
           +  SAR  DA+EA R G V
Sbjct: 154 ILGSARAFDADEARRIGFV 172


>3isaB [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 239

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 99  LASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMD 158
           LA   G  FG G +L  AC        A F +P +K GL+ G   T+R    +G  +A+ 
Sbjct: 98  LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG---TRRFRDIVGADQALS 154

Query: 159 MCLSARPLDAEEADRYGLV 177
           +  SAR  DA+EA R G V
Sbjct: 155 ILGSARAFDADEARRIGFV 173


>3isaA [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
          Length = 240

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 99  LASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMD 158
           LA   G  FG G +L  AC        A F +P +K GL+ G   T+R    +G  +A+ 
Sbjct: 99  LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG---TRRFRDIVGADQALS 155

Query: 159 MCLSARPLDAEEADRYGLV 177
           +  SAR  DA+EA R G V
Sbjct: 156 ILGSARAFDADEARRIGFV 174


>1rjmC [c.14.1] MENB
          Length = 238

 Score = 45.4 bits (106), Expect = 2e-07
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 4/124 (3%)

Query: 91  IKRVRKPVLASVAGLAFGGGCELALACDIIVAARS-AKFALPEIKLGLLPGAGGTQRLPR 149
           I+ + K V+  V G A GGG  L + CD+ +A+R  A+F   +       G  G+  L R
Sbjct: 100 IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDAD---FDGGYGSAYLAR 156

Query: 150 AIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALK 209
            +G+  A ++    R   AE+  + G V+ V +   L    ++ A  I + S  A   LK
Sbjct: 157 QVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLK 216

Query: 210 ESLN 213
            + N
Sbjct: 217 FAFN 220


>3hp0B [x.x.x] PUTATIVE POLYKETIDE BIOSYNTHESIS ENOYL-COA
          Length = 244

 Score = 39.3 bits (90), Expect = 1e-05
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 99  LASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMD 158
           ++ V G    GG     A DI +A ++A F+L E+  GL P A     L R IG+ KA  
Sbjct: 98  ISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYP-ACVLPFLIRRIGRQKA-- 154

Query: 159 MCLSARPLDAEEADRYGLV 177
                +P+  +EA  +GL+
Sbjct: 155 HYTLTKPISVQEASEWGLI 173


>3hp0A [x.x.x] PUTATIVE POLYKETIDE BIOSYNTHESIS ENOYL-COA
          Length = 243

 Score = 39.3 bits (90), Expect = 1e-05
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 99  LASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMD 158
           ++ V G    GG     A DI +A ++A F+L E+  GL P A     L R IG+ KA  
Sbjct: 98  ISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYP-ACVLPFLIRRIGRQKA-- 154

Query: 159 MCLSARPLDAEEADRYGLV 177
                +P+  +EA  +GL+
Sbjct: 155 HYTLTKPISVQEASEWGLI 173


>1xx4A [c.14.1] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL
          Length = 254

 Score = 38.5 bits (88), Expect = 2e-05
 Identities = 36/161 (22%), Positives = 68/161 (42%), Gaps = 10/161 (6%)

Query: 98  VLASVAGLAFGGGCELALACDIIVAARSAKF--ALPEIKLGLLPGAGGTQRLPRAIGKAK 155
           +++++ G +  GGC +AL CD  + A ++K+   L E  LG++            IG   
Sbjct: 98  LISAINGASPAGGCLMALTCDYRIMADNSKYTIGLNESLLGIVAPFWLKDNYVNTIGHRA 157

Query: 156 AMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKESLNRA 215
           A             EA + GLV  VV +D++  +   +     +    +    K  + +A
Sbjct: 158 AERALQLGTLFPPAEALKVGLVDEVVPEDQVHSKARSVMAKWFTIPDHSRQLTKSMMRKA 217

Query: 216 FEIPLAEGILFERRELHARFATADAREGIR----AFLEKRK 252
                A+ ++ +R      F +  +R+ I+     +LEK K
Sbjct: 218 ----TADNLIKQREADIQNFTSFISRDSIQKSLHVYLEKLK 254


>3bptA [x.x.x] 3-HYDROXYISOBUTYRYL-COA HYDROLASE
          Length = 352

 Score = 38.5 bits (88), Expect = 2e-05
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

Query: 95  RKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKA 154
           +KP +A + G+  GGG  L++     VA     FA PE  +GL P  GG   LPR  GK 
Sbjct: 99  QKPYVALIHGIT-GGGVGLSVHGQFRVATEKCLFA-PETAIGLFPDVGGGYFLPRLQGKL 156

Query: 155 KAMDMCLSARPLDAEEADRYGLVSRVV 181
               + L+   L   +  R G+ +  V
Sbjct: 157 -GYFLALTGFRLKGRDVYRAGIATHFV 182


>1sg4C [x.x.x] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL
          Length = 250

 Score = 35.0 bits (79), Expect = 2e-04
 Identities = 24/106 (22%), Positives = 48/106 (45%), Gaps = 2/106 (1%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKF--ALPEIKLGLLPGAGGTQ 145
           W  + +    +++++ G    GGC +AL CD  + A + ++   L E +LG++       
Sbjct: 88  WLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKD 147

Query: 146 RLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETM 191
            L   IG   A             EA + G+V +VV +++++   +
Sbjct: 148 TLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTAL 193


>1sg4B [x.x.x] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL
          Length = 258

 Score = 35.0 bits (79), Expect = 2e-04
 Identities = 24/106 (22%), Positives = 48/106 (45%), Gaps = 2/106 (1%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKF--ALPEIKLGLLPGAGGTQ 145
           W  + +    +++++ G    GGC +AL CD  + A + ++   L E +LG++       
Sbjct: 88  WLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKD 147

Query: 146 RLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETM 191
            L   IG   A             EA + G+V +VV +++++   +
Sbjct: 148 TLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTAL 193


>1sg4A [x.x.x] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL
          Length = 249

 Score = 35.0 bits (79), Expect = 2e-04
 Identities = 24/106 (22%), Positives = 48/106 (45%), Gaps = 2/106 (1%)

Query: 88  WETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKF--ALPEIKLGLLPGAGGTQ 145
           W  + +    +++++ G    GGC +AL CD  + A + ++   L E +LG++       
Sbjct: 89  WLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKD 148

Query: 146 RLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETM 191
            L   IG   A             EA + G+V +VV +++++   +
Sbjct: 149 TLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTAL 194


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.328    0.143    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 1,118,182,672
Number of extensions: 45724642
Number of successful extensions: 115288
Number of sequences better than 1.0e-03: 4106
Number of HSP's gapped: 110015
Number of HSP's successfully gapped: 5952
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)