BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE39597.1 rpal2 ABE39597.1 GIB00345CH01 "ABC transporter
related"
         (235 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1ji0A [c.37.1] ABC TRANSPORTER                                        211   1e-57
1g9xA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID                124   3e-31
1g6hA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID                123   5e-31
1gajA [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID                122   1e-30
2it1B [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN            108   2e-26
2it1A [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN            108   2e-26
2oukB [x.x.x] PROTEIN ARTP                                            106   8e-26
2oljA [x.x.x] AMINO ACID ABC TRANSPORTER                              106   8e-26
1q12A [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING     99   1e-23
3fh6A [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          99   1e-23
2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          99   1e-23
2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          99   1e-23
2r6gB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          98   2e-23
2r6gA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          98   2e-23
3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING           98   2e-23
2yyzA [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN               93   7e-22
1oxvA [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           92   1e-21
1oxsC [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           92   1e-21
2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          91   3e-21
1vplA [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN                    86   8e-20
1g291 [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK        86   8e-20
2onkA [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING         83   9e-19
3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN               83   9e-19
2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          82   2e-18
2pcjA [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN         81   3e-18
1l2tB [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN        79   2e-17
1l2tA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN        79   2e-17
2hydA [x.x.x] ABC TRANSPORTER HOMOLOG                                  78   2e-17
3gfoA [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1                 78   2e-17
1z47B [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN             77   7e-17
1z47A [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN             77   7e-17
3fvqB [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC              76   9e-17
3fvqA [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC              76   9e-17
2yz2B [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN             75   2e-16
2yz2A [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN             75   2e-16
3g60A [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A                          75   2e-16
3g5uA [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A                          75   2e-16
1jj7A [c.37.1] PEPTIDE TRANSPORTER TAP1                                74   6e-16
1oxxK [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           73   1e-15
1f3oA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN        72   2e-15
1mt0A [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN                71   3e-15
2ff7A [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING                71   3e-15
1xefA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING                71   4e-15
2ffaA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING                71   4e-15
2d2fA [x.x.x] SUFC PROTEIN                                             71   4e-15
1b0uA [c.37.1] HISTIDINE PERMEASE                                      70   5e-15
2fgkA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING                70   6e-15
2ffbA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING                70   6e-15
3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING                70   6e-15
2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING             69   1e-14
2d2eA [x.x.x] SUFC PROTEIN                                             69   1e-14
2zu0C [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  69   2e-14
2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  69   2e-14
2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          69   2e-14
2ixeA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            67   5e-14
1mv5D [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING        67   7e-14
1mv5A [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING        67   7e-14
2ixeD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            67   7e-14
2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  66   9e-14
2ixfD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            66   1e-13
2ixfC [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            66   1e-13
2ixfA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            66   1e-13
2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  65   2e-13
2pjzA [x.x.x] HYPOTHETICAL PROTEIN ST1066                              63   1e-12
1pf4A [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA             62   1e-12
2ixgA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            62   1e-12
2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  62   2e-12
1v43A [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT ATP-BIN...    61   3e-12
2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                61   3e-12
2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                60   5e-12
2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                60   5e-12
2ghiA [x.x.x] TRANSPORT PROTEIN                                        60   8e-12
2ghiB [x.x.x] TRANSPORT PROTEIN                                        59   2e-11
2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                59   2e-11
2pzgB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                58   3e-11
1xmiB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               57   4e-11
1xmiE [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               57   5e-11
1xmiC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               57   5e-11
1xmiA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               57   5e-11
2pzfB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                57   7e-11
2pzfA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                57   7e-11
1xf9D [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               56   9e-11
1xf9C [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               56   9e-11
1xf9B [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               56   9e-11
1xf9A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               56   9e-11
1xmjA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               56   1e-10
1xfaA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1xmiD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r10A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0zD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0zC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0zB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0zA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0xD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0xC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0xB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0xA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0wC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0wB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1r0wA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1q3hD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1q3hC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1q3hB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
1q3hA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               55   2e-10
2pzgA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                55   2e-10
2pzeB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                55   2e-10
2pzeA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                55   2e-10
2ghiC [x.x.x] TRANSPORT PROTEIN                                        54   4e-10
3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN                      54   6e-10
1sgwA [c.37.1] PUTATIVE ABC TRANSPORTER                                53   8e-10
2ghiD [x.x.x] TRANSPORT PROTEIN                                        53   8e-10
2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                53   8e-10
2nq2D [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN         51   3e-09
2nq2C [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN         50   9e-09
2ihyA [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN                     50   9e-09
2ihyB [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN                     49   1e-08
2qi9C [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD              49   1e-08
1l7vC [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD          47   6e-08
1yqtA [x.x.x] RNASE L INHIBITOR                                        46   1e-07
2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1                46   1e-07
1z2rA [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA         44   5e-07
3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA         44   5e-07
2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          44   5e-07
2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          44   5e-07
2r6fB [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               40   5e-06
2r6fA [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               40   5e-06
2vf8B [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               39   2e-05
2vf8A [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               39   2e-05
2vf7C [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             39   2e-05
2vf7B [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             39   2e-05
2vf7A [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             39   2e-05
2ix3A [x.x.x] ELONGATION FACTOR 3                                      39   2e-05
2iwhB [x.x.x] ELONGATION FACTOR 3A                                     39   2e-05
2fa9A [x.x.x] GTP-BINDING PROTEIN SAR1B                                34   5e-04
2ix8A [x.x.x] ELONGATION FACTOR 3A                                     33   6e-04
2iw3B [x.x.x] ELONGATION FACTOR 3A                                     33   6e-04
2iw3A [x.x.x] ELONGATION FACTOR 3A                                     33   6e-04

>1ji0A [c.37.1] ABC TRANSPORTER
          Length = 231

 Score =  211 bits (538), Expect = 1e-57
 Identities = 134/234 (57%), Positives = 159/234 (67%), Gaps = 9/234 (3%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQL 60
           +L    L V +G I A++G+ LKV  G+ V LIGANGAGKTT L  I+GL RA  G I  
Sbjct: 5   VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIF 64

Query: 61  EGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFE 120
            G  I+       + +GI+  PEGRRIFP LTV ENL   +   R+  E I  DL+  F 
Sbjct: 65  NGQDITN-KPAHVINRGIALVPEGRRIFPELTVYENLGAYN---RKDKEGIKRDLEWIFS 120

Query: 121 LFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKL 180
           LFPRLKER KQLG +LSGGEQQ LAIGRAL +RPKLL  DEPSLGLAP L  EV+E ++ 
Sbjct: 121 LFPRLKERLKQLGGTLSGGEQQ-LAIGRAL-SRPKLL--DEPSLGLAPILVSEVFEVIQK 176

Query: 181 ISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKHNARVREAYLG 234
           I++ G TIL+VEQN + AL VA   YVLETG+IVLEG ASEL  N  VR+AYLG
Sbjct: 177 INQEGTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASELLDN-EVRKAYLG 229


>1g9xA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 253

 Score =  124 bits (311), Expect = 3e-31
 Identities = 73/250 (29%), Positives = 129/250 (51%), Gaps = 16/250 (6%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQL 60
           +L   ++V   G+  AL GV++ V  G+   +IG NG+GK+TL++ I+G  +A  G +  
Sbjct: 4   ILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYF 63

Query: 61  EGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVS----------WRRWGES 110
           E   I+          GI +  +  +    +TV ENL +  ++          +++W   
Sbjct: 64  ENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPK 123

Query: 111 IAADLDRTFEL--FPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP 168
               +++ F++  F +L     +    LSGG+ +++ IGRALM  PK++++DEP  G+AP
Sbjct: 124 EEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAP 183

Query: 169 RLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKHNA-- 226
            LA +++  V  +   G+T L++E    + L+  D  YV+  G+I+ EG   E   N   
Sbjct: 184 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLS 243

Query: 227 --RVREAYLG 234
             +V E Y+G
Sbjct: 244 DPKVVEIYIG 253


>1g6hA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 254

 Score =  123 bits (309), Expect = 5e-31
 Identities = 75/250 (30%), Positives = 129/250 (51%), Gaps = 16/250 (6%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQL 60
           +L   ++V   G+  AL GV++ V  G+   +IG NG+GK+TL++ I+G  +A  G +  
Sbjct: 4   ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYF 63

Query: 61  EGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENL----------SLASVSWRRWGES 110
           E   I+          GI +  +  +    +TV ENL           L S+ +++W   
Sbjct: 64  ENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPK 123

Query: 111 IAADLDRTFEL--FPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP 168
               +++ F++  F +L     +    LSGG+ +++ IGRALM  PK++++DEP  G+AP
Sbjct: 124 EEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAP 183

Query: 169 RLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKHNA-- 226
            LA +++  V  +   G+T L++E    + L+  D  YV+  G+I+ EG   E   N   
Sbjct: 184 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLS 243

Query: 227 --RVREAYLG 234
             +V E Y+G
Sbjct: 244 DPKVVEIYIG 253


>1gajA [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
          Length = 253

 Score =  122 bits (306), Expect = 1e-30
 Identities = 72/250 (28%), Positives = 129/250 (51%), Gaps = 16/250 (6%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQL 60
           +L   ++V   G+  AL GV++ V  G+   +IG NG+GK+TL++ I+G  +A  G +  
Sbjct: 3   ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYF 62

Query: 61  EGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVS----------WRRWGES 110
           E   I+          GI +  +  +    +TV ENL +  ++          +++W   
Sbjct: 63  ENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPK 122

Query: 111 IAADLDRTFEL--FPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP 168
               +++ F++  F +L     +    LSGG+ +++ IGRALM  PK++++D+P  G+AP
Sbjct: 123 EEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAP 182

Query: 169 RLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKHNA-- 226
            LA +++  V  +   G+T L++E    + L+  D  YV+  G+I+ EG   E   N   
Sbjct: 183 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLS 242

Query: 227 --RVREAYLG 234
             +V E Y+G
Sbjct: 243 DPKVVEIYIG 252


>2it1B [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
          Length = 361

 Score =  108 bits (269), Expect = 2e-26
 Identities = 70/225 (31%), Positives = 120/225 (53%), Gaps = 5/225 (2%)

Query: 6   DLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSI 65
           ++V   G+  AL  + LK+  GE +AL+G +G+GK+TLL+TI+G+ + +SG I  +   +
Sbjct: 7   NIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDV 66

Query: 66  SEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRL 125
           +E     R    +    +   ++P +TV +N++      +   E I   +    ++   +
Sbjct: 67  TELPPKDR---NVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKML-HI 122

Query: 126 KERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVK-LISES 184
            +   +  W LSGG+QQ +AI RAL+  P++LLLDEP   L   L  EV   +K L  E 
Sbjct: 123 DKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKEL 182

Query: 185 GLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKHNARVR 229
           G+T + V  +   AL++ADR  V+  G I+  G   E+ +  + +
Sbjct: 183 GITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYK 227


>2it1A [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
          Length = 362

 Score =  108 bits (269), Expect = 2e-26
 Identities = 70/225 (31%), Positives = 120/225 (53%), Gaps = 5/225 (2%)

Query: 6   DLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSI 65
           ++V   G+  AL  + LK+  GE +AL+G +G+GK+TLL+TI+G+ + +SG I  +   +
Sbjct: 8   NIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDV 67

Query: 66  SEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRL 125
           +E     R    +    +   ++P +TV +N++      +   E I   +    ++   +
Sbjct: 68  TELPPKDR---NVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKML-HI 123

Query: 126 KERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVK-LISES 184
            +   +  W LSGG+QQ +AI RAL+  P++LLLDEP   L   L  EV   +K L  E 
Sbjct: 124 DKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKEL 183

Query: 185 GLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKHNARVR 229
           G+T + V  +   AL++ADR  V+  G I+  G   E+ +  + +
Sbjct: 184 GITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYK 228


>2oukB [x.x.x] PROTEIN ARTP
          Length = 241

 Score =  106 bits (264), Expect = 8e-26
 Identities = 67/225 (29%), Positives = 114/225 (50%), Gaps = 5/225 (2%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQL 60
           M+  + L  + G +  L+G+ + +  GE V +IG +G+GK+T L  ++ L          
Sbjct: 2   MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXX 61

Query: 61  EGVSISEWSTD-RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTF 119
              ++    T+  +V + +    +   +FP +TV  N++LA +  R+W    A    +  
Sbjct: 62  XXXNLKAKDTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEA--KAM 119

Query: 120 ELFPR--LKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYER 177
           EL  +  LK++      SLSGG+ Q +AI RAL   PK++L DEP+  L P +  EV   
Sbjct: 120 ELLDKVGLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSV 179

Query: 178 VKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           +K ++  G+T++VV      A  V DR   ++ G I+ EG   +L
Sbjct: 180 MKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDL 224


>2oljA [x.x.x] AMINO ACID ABC TRANSPORTER
          Length = 242

 Score =  106 bits (264), Expect = 8e-26
 Identities = 67/225 (29%), Positives = 114/225 (50%), Gaps = 5/225 (2%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQL 60
           M+  + L  + G +  L+G+ + +  GE V +IG +G+GK+T L  ++ L          
Sbjct: 3   MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXX 62

Query: 61  EGVSISEWSTD-RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTF 119
              ++    T+  +V + +    +   +FP +TV  N++LA +  R+W    A    +  
Sbjct: 63  XXXNLKAKDTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEA--KAM 120

Query: 120 ELFPR--LKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYER 177
           EL  +  LK++      SLSGG+ Q +AI RAL   PK++L DEP+  L P +  EV   
Sbjct: 121 ELLDKVGLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSV 180

Query: 178 VKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           +K ++  G+T++VV      A  V DR   ++ G I+ EG   +L
Sbjct: 181 MKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDL 225


>1q12A [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
          Length = 367

 Score = 99.4 bits (246), Expect = 1e-23
 Identities = 68/218 (31%), Positives = 115/218 (52%), Gaps = 9/218 (4%)

Query: 10  AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           A G+++  + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+ +    +++  
Sbjct: 9   AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP 68

Query: 70  TDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL--FPRLKE 127
              R   G+    +   ++P L+V EN+S          E I   +++  E+     L +
Sbjct: 69  PAER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD 125

Query: 128 RRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGL 186
           R+ +   +LSGG++Q +AIGR L+A P + LLDEP   L   L  ++  E  +L    G 
Sbjct: 126 RKPK---ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR 182

Query: 187 TILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           T++ V  + V A+++AD+  VL+ GR+   G   EL H
Sbjct: 183 TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH 220


>3fh6A [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 371

 Score = 99.4 bits (246), Expect = 1e-23
 Identities = 68/218 (31%), Positives = 115/218 (52%), Gaps = 9/218 (4%)

Query: 10  AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           A G+++  + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+ +    +++  
Sbjct: 11  AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP 70

Query: 70  TDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL--FPRLKE 127
              R   G+    +   ++P L+V EN+S          E I   +++  E+     L +
Sbjct: 71  PAER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD 127

Query: 128 RRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGL 186
           R+ +   +LSGG++Q +AIGR L+A P + LLDEP   L   L  ++  E  +L    G 
Sbjct: 128 RKPK---ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR 184

Query: 187 TILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           T++ V  + V A+++AD+  VL+ GR+   G   EL H
Sbjct: 185 TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH 222


>2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score = 99.4 bits (246), Expect = 1e-23
 Identities = 68/218 (31%), Positives = 115/218 (52%), Gaps = 9/218 (4%)

Query: 10  AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           A G+++  + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+ +    +++  
Sbjct: 11  AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP 70

Query: 70  TDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL--FPRLKE 127
              R   G+    +   ++P L+V EN+S          E I   +++  E+     L +
Sbjct: 71  PAER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD 127

Query: 128 RRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGL 186
           R+ +   +LSGG++Q +AIGR L+A P + LLDEP   L   L  ++  E  +L    G 
Sbjct: 128 RKPK---ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR 184

Query: 187 TILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           T++ V  + V A+++AD+  VL+ GR+   G   EL H
Sbjct: 185 TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH 222


>2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 374

 Score = 99.4 bits (246), Expect = 1e-23
 Identities = 68/218 (31%), Positives = 115/218 (52%), Gaps = 9/218 (4%)

Query: 10  AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           A G+++  + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+ +    +++  
Sbjct: 11  AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP 70

Query: 70  TDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL--FPRLKE 127
              R   G+    +   ++P L+V EN+S          E I   +++  E+     L +
Sbjct: 71  PAER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD 127

Query: 128 RRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGL 186
           R+ +   +LSGG++Q +AIGR L+A P + LLDEP   L   L  ++  E  +L    G 
Sbjct: 128 RKPK---ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR 184

Query: 187 TILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           T++ V  + V A+++AD+  VL+ GR+   G   EL H
Sbjct: 185 TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH 222


>2r6gB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score = 98.2 bits (243), Expect = 2e-23
 Identities = 67/218 (30%), Positives = 115/218 (52%), Gaps = 9/218 (4%)

Query: 10  AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           A G+++  + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+ +    +++  
Sbjct: 11  AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP 70

Query: 70  TDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL--FPRLKE 127
              R   G+    +   ++P L+V EN+S          E I   +++  E+     L +
Sbjct: 71  PAER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD 127

Query: 128 RRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGL 186
           R+ +   +LSGG++Q +AIGR L+A P + LLD+P   L   L  ++  E  +L    G 
Sbjct: 128 RKPK---ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGR 184

Query: 187 TILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           T++ V  + V A+++AD+  VL+ GR+   G   EL H
Sbjct: 185 TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH 222


>2r6gA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 371

 Score = 98.2 bits (243), Expect = 2e-23
 Identities = 67/218 (30%), Positives = 115/218 (52%), Gaps = 9/218 (4%)

Query: 10  AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           A G+++  + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+ +    +++  
Sbjct: 11  AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP 70

Query: 70  TDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL--FPRLKE 127
              R   G+    +   ++P L+V EN+S          E I   +++  E+     L +
Sbjct: 71  PAER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD 127

Query: 128 RRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGL 186
           R+ +   +LSGG++Q +AIGR L+A P + LLD+P   L   L  ++  E  +L    G 
Sbjct: 128 RKPK---ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGR 184

Query: 187 TILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           T++ V  + V A+++AD+  VL+ GR+   G   EL H
Sbjct: 185 TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH 222


>3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
          Length = 348

 Score = 98.2 bits (243), Expect = 2e-23
 Identities = 66/208 (31%), Positives = 109/208 (52%), Gaps = 8/208 (3%)

Query: 16  ALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVA 75
           +L  ++LKV +GE   ++G  GAGKT  L  I+G +   SG I L+G  +++ S ++   
Sbjct: 15  SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSPEKH-- 72

Query: 76  KGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWS 135
             I+   +   +FP + V++NL       +        D  R  ++   L +R      +
Sbjct: 73  -DIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKI-EHLLDRNPL---T 127

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLI-SESGLTILVVEQN 194
           LSGGEQQ +A+ RAL+  PK+LLLDEP   L PR  E   E + ++  ++ LT+L +  +
Sbjct: 128 LSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHD 187

Query: 195 TVLALSVADRAYVLETGRIVLEGPASEL 222
              A  +ADR  V+  G+++  G   E+
Sbjct: 188 QTEARIMADRIAVVMDGKLIQVGKPEEI 215


>2yyzA [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 358

 Score = 93.2 bits (230), Expect = 7e-22
 Identities = 66/215 (30%), Positives = 113/215 (52%), Gaps = 11/215 (5%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           G + A+ GV+ +V  GE VAL+G +G GKTT L  ++G+ + +SG+I  + V +++    
Sbjct: 13  GKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPK 72

Query: 72  RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESI---AADLDRTFELFPRLKER 128
            R    +    +   ++P +TV EN++    + R   + +     ++ R   L   L +R
Sbjct: 73  YR---EVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKL-LIDNLLDR 128

Query: 129 RKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVK-LISESGLT 187
           +      LSGG+QQ +A+ RAL+ +PK+LL DEP   L   L   +   +K L  E G+T
Sbjct: 129 KPT---QLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGIT 185

Query: 188 ILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
            + V  +   A+++A R  V   G++V  G   E+
Sbjct: 186 SVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEV 220


>1oxvA [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 353

 Score = 92.4 bits (228), Expect = 1e-21
 Identities = 69/218 (31%), Positives = 103/218 (47%), Gaps = 40/218 (18%)

Query: 8   VVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISE 67
           V   G ++AL  V + +  GE   ++G +GAGKTT +  I+GL+  S+G++  +      
Sbjct: 12  VFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD------ 65

Query: 68  WSTDRRVAKG--ISQAPEGRRI---------FPGLTVEENLSLASVSWRRWGESI----- 111
              DR VA    +   PE R+I         +P LT  EN++    + +   E I     
Sbjct: 66  ---DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVE 122

Query: 112 ----AADLDRTFELFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLA 167
                 D+      FPR           LSGG+QQ +A+ RAL+  P LLLLDEP   L 
Sbjct: 123 EVAKILDIHHVLNHFPR----------ELSGGQQQRVALARALVKDPSLLLLDEPFSNLD 172

Query: 168 PRLAEEVYERVKLI-SESGLTILVVEQNTVLALSVADR 204
            R+ +     VK + S  G+T+LVV  +     ++ADR
Sbjct: 173 ARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR 210


>1oxsC [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 352

 Score = 92.4 bits (228), Expect = 1e-21
 Identities = 69/218 (31%), Positives = 103/218 (47%), Gaps = 40/218 (18%)

Query: 8   VVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISE 67
           V   G ++AL  V + +  GE   ++G +GAGKTT +  I+GL+  S+G++  +      
Sbjct: 12  VFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD------ 65

Query: 68  WSTDRRVAKG--ISQAPEGRRI---------FPGLTVEENLSLASVSWRRWGESI----- 111
              DR VA    +   PE R+I         +P LT  EN++    + +   E I     
Sbjct: 66  ---DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVE 122

Query: 112 ----AADLDRTFELFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLA 167
                 D+      FPR           LSGG+QQ +A+ RAL+  P LLLLDEP   L 
Sbjct: 123 EVAKILDIHHVLNHFPR----------ELSGGQQQRVALARALVKDPSLLLLDEPFSNLD 172

Query: 168 PRLAEEVYERVKLI-SESGLTILVVEQNTVLALSVADR 204
            R+ +     VK + S  G+T+LVV  +     ++ADR
Sbjct: 173 ARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR 210


>2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 363

 Score = 90.9 bits (224), Expect = 3e-21
 Identities = 66/215 (30%), Positives = 111/215 (51%), Gaps = 13/215 (6%)

Query: 13  DILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDR 72
           ++   + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+ +    +++     
Sbjct: 7   NVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE 66

Query: 73  RVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL--FPRLKERRK 130
           R   G+        ++P L+V EN+S          E I   +++  E+     L +R+ 
Sbjct: 67  R---GVGMV----ALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKP 119

Query: 131 QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGLTIL 189
           +   +LSGG++Q +AIGR L+A P + LLDEP   L   L  ++  E  +L    G T++
Sbjct: 120 K---ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMI 176

Query: 190 VVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            V  + V A+++AD+  VL+ GR+   G   EL H
Sbjct: 177 YVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH 211


>1vplA [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 86.3 bits (212), Expect = 8e-20
 Identities = 67/194 (34%), Positives = 94/194 (48%), Gaps = 3/194 (1%)

Query: 36  NGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEE 95
           NGAGKTT L  IS L + SSG + + G ++ E      V K IS  PE    +  +   E
Sbjct: 37  NGAGKTTTLRIISTLIKPSSGIVTVFGKNVVE--EPHEVRKLISYLPEEAGAYRNMQGIE 94

Query: 96  NLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPK 155
            L   +  +      I   ++R  E+   L E+ K    + S G  + L I RALM  P+
Sbjct: 95  YLRFVAGFYASSSSEIEEMVERATEI-AGLGEKIKDRVSTYSKGMVRKLLIARALMVNPR 153

Query: 156 LLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVL 215
           L +LDEP+ GL    A EV + +K  S+ GLTILV   N +    + DR  ++  G IV 
Sbjct: 154 LAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRIALIHNGTIVE 213

Query: 216 EGPASELKHNARVR 229
            G   ELK   + +
Sbjct: 214 TGTVEELKERYKAQ 227


>1g291 [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
          Length = 372

 Score = 86.3 bits (212), Expect = 8e-20
 Identities = 66/227 (29%), Positives = 114/227 (50%), Gaps = 17/227 (7%)

Query: 6   DLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSI 65
           D+    G++ A++ ++L+V  GE + L+G +G GKTT L  I+GL   S G I +    +
Sbjct: 8   DVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLV 67

Query: 66  SEWSTDRRVAKGISQAPEGRRI---------FPGLTVEENLSLASVSWRRWGESIAADLD 116
           ++        KGI   P+ R I         +P +TV +N++      +   + I   + 
Sbjct: 68  AD------PEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVR 121

Query: 117 RTFELFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-Y 175
              EL   L E   +    LSGG++Q +A+GRA++ +P++ L+DEP   L  +L   +  
Sbjct: 122 EVAELL-GLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRA 180

Query: 176 ERVKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           E  KL  + G+T + V  + V A+++ DR  V+  G +   G   E+
Sbjct: 181 ELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEV 227


>2onkA [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
          Length = 240

 Score = 82.8 bits (203), Expect = 9e-19
 Identities = 59/192 (30%), Positives = 94/192 (48%), Gaps = 7/192 (3%)

Query: 32  LIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAKGISQAPEGRRIFPGL 91
           L+G  GAGK+  L  I+G+ +   G+++L G  I+    +RR   GI   P+   +FP L
Sbjct: 29  LLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPERR---GIGFVPQDYALFPHL 85

Query: 92  TVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSLSGGEQQMLAIGRALM 151
           +V  N++                          L +R+      LSGGE+Q +A+ RAL+
Sbjct: 86  SVYRNIAYGLXXXXXXXXXXXXXXMAEKLGIAHLLDRKPA---RLSGGERQRVALARALV 142

Query: 152 ARPKLLLLDEPSLGLAPRLAEEVYERVKLIS-ESGLTILVVEQNTVLALSVADRAYVLET 210
            +P+LLLLDEP   +  +    + E ++ +  E  + IL V  + + A  +AD   V+  
Sbjct: 143 IQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLADEVAVMLN 202

Query: 211 GRIVLEGPASEL 222
           GRIV +G   EL
Sbjct: 203 GRIVEKGKLKEL 214


>3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
          Length = 343

 Score = 82.8 bits (203), Expect = 9e-19
 Identities = 59/212 (27%), Positives = 103/212 (48%), Gaps = 4/212 (1%)

Query: 14  ILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDR- 72
           I AL  V+L V  G+   +IGA+GAGK+TL+  ++ L R + G + ++G  ++  S    
Sbjct: 18  IQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESEL 77

Query: 73  -RVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQ 131
            +  + I    +   +    TV  N++L         + +   +     L   L ++   
Sbjct: 78  TKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLV-GLGDKHDS 136

Query: 132 LGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISES-GLTILV 190
              +LSGG++Q +AI RAL + PK+LL DE +  L P     + E +K I+   GLTIL+
Sbjct: 137 YPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILL 196

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           +     +   + D   V+  G ++ +   SE+
Sbjct: 197 ITHEMDVVKRICDCVAVISNGELIEQDTVSEV 228


>2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 344

 Score = 81.6 bits (200), Expect = 2e-18
 Identities = 62/215 (28%), Positives = 102/215 (47%), Gaps = 32/215 (14%)

Query: 13  DILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDR 72
           ++   + + L +  GE V  +G +G GK+TLL  I+GL                      
Sbjct: 7   NVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL---------------------- 44

Query: 73  RVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFP--RLKERRK 130
               G+    +   ++P L+V EN+S          E I   +++  E+     L +R+ 
Sbjct: 45  ----GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKP 100

Query: 131 QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGLTIL 189
           +   +LSGG++Q +AIGR L+A P + LLDEP   L   L  ++  E  +L    G T++
Sbjct: 101 K---ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMI 157

Query: 190 VVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            V  + V A+++AD+  VL+ GR+   G   EL H
Sbjct: 158 YVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH 192


>2pcjA [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
          Length = 223

 Score = 81.3 bits (199), Expect = 3e-18
 Identities = 61/211 (28%), Positives = 110/211 (52%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVA- 75
           L+G++L V  GE V++IGA+G+GK+TLL+ +  L+  + G + LEG  + +++ ++ ++ 
Sbjct: 19  LKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEV-DYTNEKELSL 77

Query: 76  ---KGISQAPEGRRIFPGLTVEENLSLASVSW-------RRWGESIAADLDRTFELFPRL 125
              + +    +   + P LT  EN+ +  +         +  GE + ++L         L
Sbjct: 78  LRNRKLGFVFQFHYLIPELTALENVIVPMLKMGKPKKEAKERGEYLLSELG--------L 129

Query: 126 KERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESG 185
            ++  +  + LSGGEQQ +AI RAL   P LL  DEP+  L     + V +    I+E G
Sbjct: 130 GDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGG 189

Query: 186 LTILVVEQNTVLALSVADRAYVLETGRIVLE 216
            +I++V     LA  +  R   ++ G++V E
Sbjct: 190 TSIVMVTHERELA-ELTHRTLEMKDGKVVGE 219


>1l2tB [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 232

 Score = 78.6 bits (192), Expect = 2e-17
 Identities = 57/209 (27%), Positives = 101/209 (48%), Gaps = 6/209 (2%)

Query: 14  ILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRR 73
           I AL+ V L +  GE V+++G +G+GK+T+L+ I  L++ + G++ ++ +  ++   D  
Sbjct: 18  IYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDEL 77

Query: 74  VA---KGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFP--RLKER 128
                  I    +   + P LT  EN+ L  +   R   S      R  E      L+ER
Sbjct: 78  TKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEER 137

Query: 129 -RKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLT 187
                   LSGG+QQ +AI RAL   P ++L D+P+  L  +  E++ + +K ++E    
Sbjct: 138 FANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGK 197

Query: 188 ILVVEQNTVLALSVADRAYVLETGRIVLE 216
            +VV  + +      +R   L+ G +  E
Sbjct: 198 TVVVVTHDINVARFGERIIYLKDGEVERE 226


>1l2tA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 230

 Score = 78.6 bits (192), Expect = 2e-17
 Identities = 57/209 (27%), Positives = 101/209 (48%), Gaps = 6/209 (2%)

Query: 14  ILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRR 73
           I AL+ V L +  GE V+++G +G+GK+T+L+ I  L++ + G++ ++ +  ++   D  
Sbjct: 18  IYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDEL 77

Query: 74  VA---KGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFP--RLKER 128
                  I    +   + P LT  EN+ L  +   R   S      R  E      L+ER
Sbjct: 78  TKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEER 137

Query: 129 -RKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLT 187
                   LSGG+QQ +AI RAL   P ++L D+P+  L  +  E++ + +K ++E    
Sbjct: 138 FANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGK 197

Query: 188 ILVVEQNTVLALSVADRAYVLETGRIVLE 216
            +VV  + +      +R   L+ G +  E
Sbjct: 198 TVVVVTHDINVARFGERIIYLKDGEVERE 226


>2hydA [x.x.x] ABC TRANSPORTER HOMOLOG
          Length = 578

 Score = 78.2 bits (191), Expect = 2e-17
 Identities = 59/210 (28%), Positives = 103/210 (49%), Gaps = 8/210 (3%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GETVA +G +G GK+TL++ I      +SG I ++G +I ++ T   +  
Sbjct: 357 LKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTG-SLRN 415

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKE----RRKQL 132
            I    +   +F   TV+EN+ L   +        AA +    +    L +       + 
Sbjct: 416 QIGLVQQDNILFSD-TVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGER 474

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G  LSGG++Q L+I R  +  P +L+LDE +  L       + E + ++S+   T++V  
Sbjct: 475 GVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAH 534

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASEL 222
           +  +  ++ AD+  V+E G IV  G   EL
Sbjct: 535 R--LSTITHADKIVVIENGHIVETGTHREL 562


>3gfoA [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
          Length = 251

 Score = 78.2 bits (191), Expect = 2e-17
 Identities = 57/213 (26%), Positives = 103/213 (48%), Gaps = 10/213 (4%)

Query: 16  ALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSIS---EWSTDR 72
           AL+G+ + +  GE  A++G NG GK+TL    +G+ + SSG I  +   I    +     
Sbjct: 20  ALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDYSRKGIMKL 79

Query: 73  RVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL--FPRLKERRK 130
           R + GI       ++F   +V +++S  +V+ +   + I   +D   +      LK++  
Sbjct: 80  RESIGIVFQDPDNQLF-SASVYQDVSFGAVNMKLPEDEIRKRVDNALKRTGIEHLKDKPT 138

Query: 131 QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYE-RVKLISESGLTIL 189
                LS G+++ +AI   L+  PK+L+LDEP+ GL P    E+ +  V++  E G    
Sbjct: 139 H---CLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGXXXX 195

Query: 190 VVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
                        D  +V++ GR++L+G   E+
Sbjct: 196 XXXXXXXXVPLYCDNVFVMKEGRVILQGNPKEV 228


>1z47B [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
          Length = 342

 Score = 76.6 bits (187), Expect = 7e-17
 Identities = 57/212 (26%), Positives = 97/212 (45%), Gaps = 5/212 (2%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           G   +++GV+ ++  GE V L+G +G+GKTT+L  I+GL R + GD+ + G  +++    
Sbjct: 13  GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQ 72

Query: 72  RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQ 131
           +R    +    +   +F  +TV +N+S      R   + + A + R    F RL+    +
Sbjct: 73  KR---NVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARV-RELLRFMRLESYANR 128

Query: 132 LGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLI-SESGLTILV 190
               LSGG                    DEP   +  ++  E+   V+ +  E G+T + 
Sbjct: 129 FPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVF 188

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           V  +   AL VADR  VL  G +   G   E+
Sbjct: 189 VTHDQEEALEVADRVLVLHEGNVEQFGTPEEV 220


>1z47A [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
          Length = 345

 Score = 76.6 bits (187), Expect = 7e-17
 Identities = 57/212 (26%), Positives = 97/212 (45%), Gaps = 5/212 (2%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           G   +++GV+ ++  GE V L+G +G+GKTT+L  I+GL R + GD+ + G  +++    
Sbjct: 16  GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQ 75

Query: 72  RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQ 131
           +R    +    +   +F  +TV +N+S      R   + + A + R    F RL+    +
Sbjct: 76  KR---NVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARV-RELLRFMRLESYANR 131

Query: 132 LGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLI-SESGLTILV 190
               LSGG                    DEP   +  ++  E+   V+ +  E G+T + 
Sbjct: 132 FPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVF 191

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           V  +   AL VADR  VL  G +   G   E+
Sbjct: 192 VTHDQEEALEVADRVLVLHEGNVEQFGTPEEV 223


>3fvqB [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
          Length = 350

 Score = 76.3 bits (186), Expect = 9e-17
 Identities = 59/208 (28%), Positives = 98/208 (47%), Gaps = 3/208 (1%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRV-A 75
           L  ++L +  GE + +IGA+G GKTTLL  ++G  +  SG+I L G +I   +T+  V  
Sbjct: 19  LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRE 78

Query: 76  KGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWS 135
           + +    +   +FP LTV  N++    + +         ++   EL   + E   +    
Sbjct: 79  RRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLEL-TGISELAGRYPHE 137

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYE-RVKLISESGLTILVVEQN 194
           LSGG              P+L+LLDEP   L  +L  ++ E  +  +  +G + + V  +
Sbjct: 138 LSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHD 197

Query: 195 TVLALSVADRAYVLETGRIVLEGPASEL 222
              AL  ADR  V++ GRI+      EL
Sbjct: 198 REEALQYADRIAVMKQGRILQTASPHEL 225


>3fvqA [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
          Length = 343

 Score = 76.3 bits (186), Expect = 9e-17
 Identities = 59/208 (28%), Positives = 98/208 (47%), Gaps = 3/208 (1%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRV-A 75
           L  ++L +  GE + +IGA+G GKTTLL  ++G  +  SG+I L G +I   +T+  V  
Sbjct: 19  LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRE 78

Query: 76  KGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWS 135
           + +    +   +FP LTV  N++    + +         ++   EL   + E   +    
Sbjct: 79  RRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLEL-TGISELAGRYPHE 137

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYE-RVKLISESGLTILVVEQN 194
           LSGG              P+L+LLDEP   L  +L  ++ E  +  +  +G + + V  +
Sbjct: 138 LSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHD 197

Query: 195 TVLALSVADRAYVLETGRIVLEGPASEL 222
              AL  ADR  V++ GRI+      EL
Sbjct: 198 REEALQYADRIAVMKQGRILQTASPHEL 225


>2yz2B [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 263

 Score = 75.1 bits (183), Expect = 2e-16
 Identities = 59/211 (27%), Positives = 107/211 (50%), Gaps = 13/211 (6%)

Query: 16  ALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVA 75
           AL+ V+L +  GE + + G  G+GK+TLL  ++GL   +SGD+  +G     +   R + 
Sbjct: 22  ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIRRNI- 80

Query: 76  KGIS-QAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL----FPRLKERRK 130
            GI+ Q PE +  F    V + ++ A  ++    + +   + +  E     F   K+R  
Sbjct: 81  -GIAFQYPEDQ--FFAERVFDEVAFAVKNFYPDRDPVPL-VKKAMEFVGLDFDSFKDR-- 134

Query: 131 QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
            + + LSGGE++ +AI   ++  P +L+LDEP +GL      ++   V+     G T+++
Sbjct: 135 -VPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVIL 193

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEGPASE 221
           +  +    ++  DR  VLE G+ V +G   E
Sbjct: 194 ISHDIETVINHVDRVVVLEKGKKVFDGTRME 224


>2yz2A [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 266

 Score = 75.1 bits (183), Expect = 2e-16
 Identities = 59/211 (27%), Positives = 107/211 (50%), Gaps = 13/211 (6%)

Query: 16  ALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVA 75
           AL+ V+L +  GE + + G  G+GK+TLL  ++GL   +SGD+  +G     +   R + 
Sbjct: 22  ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIRRNI- 80

Query: 76  KGIS-QAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL----FPRLKERRK 130
            GI+ Q PE +  F    V + ++ A  ++    + +   + +  E     F   K+R  
Sbjct: 81  -GIAFQYPEDQ--FFAERVFDEVAFAVKNFYPDRDPVPL-VKKAMEFVGLDFDSFKDR-- 134

Query: 131 QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
            + + LSGGE++ +AI   ++  P +L+LDEP +GL      ++   V+     G T+++
Sbjct: 135 -VPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVIL 193

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEGPASE 221
           +  +    ++  DR  VLE G+ V +G   E
Sbjct: 194 ISHDIETVINHVDRVVVLEKGKKVFDGTRME 224


>3g60A [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
          Length = 1182

 Score = 75.1 bits (183), Expect = 2e-16
 Identities = 63/217 (29%), Positives = 110/217 (50%), Gaps = 14/217 (6%)

Query: 14   ILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD-R 72
            I  LQG++L+V  G+T+AL+G++G GK+T++  +       +G + L+G  I + +    
Sbjct: 957  IPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWL 1016

Query: 73   RVAKGI-SQAPEGRRIFPGLTVEENLSLASVSWRRWGESIA-----ADLDRTFELFP-RL 125
            R   GI SQ P    I    ++ EN++    S     E I      A++ +  +  P + 
Sbjct: 1017 RAQLGIVSQEP----ILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKY 1072

Query: 126  KERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESG 185
              R    G  LSGG++Q +AI RAL+ +P +LLLDE +  L    +E+V +     +  G
Sbjct: 1073 NTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTE-SEKVVQEALDKAREG 1131

Query: 186  LTILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
             T +V+  + +  +  AD   V++ G++   G   +L
Sbjct: 1132 RTCIVI-AHRLSTIQNADLIVVIQNGKVKEHGTHQQL 1167



 Score = 70.1 bits (170), Expect = 6e-15
 Identities = 60/216 (27%), Positives = 98/216 (45%), Gaps = 12/216 (5%)

Query: 13  DILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD- 71
           ++  L+G+ LKV +G+TVAL+G +G GK+T +  +  L     G + ++G  I   +   
Sbjct: 370 EVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRY 429

Query: 72  -RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK 130
            R +   +SQ P    +    T+ EN+              A      ++   +L  +  
Sbjct: 430 LREIIGVVSQEP----VLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFD 485

Query: 131 QL----GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGL 186
            L    G  LSGG++Q +AI RAL+  PK+LLLDE +  L       V   +    E   
Sbjct: 486 TLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRT 545

Query: 187 TILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           TI++  +  +  +  AD     + G IV +G   EL
Sbjct: 546 TIVIAHR--LSTVRNADVIAGFDGGVIVEQGNHDEL 579


>3g5uA [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
          Length = 1182

 Score = 75.1 bits (183), Expect = 2e-16
 Identities = 63/217 (29%), Positives = 110/217 (50%), Gaps = 14/217 (6%)

Query: 14   ILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD-R 72
            I  LQG++L+V  G+T+AL+G++G GK+T++  +       +G + L+G  I + +    
Sbjct: 957  IPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWL 1016

Query: 73   RVAKGI-SQAPEGRRIFPGLTVEENLSLASVSWRRWGESIA-----ADLDRTFELFP-RL 125
            R   GI SQ P    I    ++ EN++    S     E I      A++ +  +  P + 
Sbjct: 1017 RAQLGIVSQEP----ILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKY 1072

Query: 126  KERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESG 185
              R    G  LSGG++Q +AI RAL+ +P +LLLDE +  L    +E+V +     +  G
Sbjct: 1073 NTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTE-SEKVVQEALDKAREG 1131

Query: 186  LTILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
             T +V+  + +  +  AD   V++ G++   G   +L
Sbjct: 1132 RTCIVI-AHRLSTIQNADLIVVIQNGKVKEHGTHQQL 1167



 Score = 70.1 bits (170), Expect = 6e-15
 Identities = 60/216 (27%), Positives = 98/216 (45%), Gaps = 12/216 (5%)

Query: 13  DILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD- 71
           ++  L+G+ LKV +G+TVAL+G +G GK+T +  +  L     G + ++G  I   +   
Sbjct: 370 EVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRY 429

Query: 72  -RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK 130
            R +   +SQ P    +    T+ EN+              A      ++   +L  +  
Sbjct: 430 LREIIGVVSQEP----VLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFD 485

Query: 131 QL----GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGL 186
            L    G  LSGG++Q +AI RAL+  PK+LLLDE +  L       V   +    E   
Sbjct: 486 TLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRT 545

Query: 187 TILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           TI++  +  +  +  AD     + G IV +G   EL
Sbjct: 546 TIVIAHR--LSTVRNADVIAGFDGGVIVEQGNHDEL 579


>1jj7A [c.37.1] PEPTIDE TRANSPORTER TAP1
          Length = 251

 Score = 73.6 bits (179), Expect = 6e-16
 Identities = 60/219 (27%), Positives = 112/219 (51%), Gaps = 15/219 (6%)

Query: 13  DILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDR 72
           D+L LQG+T  +  GE  AL+G NG+GK+T+   +  L + + G + L+G  + ++   R
Sbjct: 26  DVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYE-HR 84

Query: 73  RVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELF----PRLKER 128
            + + ++   +  ++F G +++EN++          E  AA +      F    P+  + 
Sbjct: 85  YLHRQVAAVGQEPQVF-GRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDT 143

Query: 129 R-KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP----RLAEEVYERVKLISE 183
              + G  LSGG++Q +A+ RAL+ +P +L+LD+ +  L      ++ + +YE  +  S 
Sbjct: 144 EVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSR 203

Query: 184 SGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           S   +L++ Q+  L +  AD    LE G I   G   +L
Sbjct: 204 S---VLLITQHLSL-VEQADHILFLEGGAIREGGTHQQL 238


>1oxxK [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 352

 Score = 72.8 bits (177), Expect = 1e-15
 Identities = 62/218 (28%), Positives = 92/218 (42%), Gaps = 40/218 (18%)

Query: 8   VVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISE 67
           V   G ++AL  V + +  GE   ++G +GAGKTT +  I+GL+  S+G++  +      
Sbjct: 12  VFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD------ 65

Query: 68  WSTDRRVAKG--ISQAPEGRRI---------FPGLTVEENLSLASVSWRRWGESI----- 111
              DR VA    +   PE R+I         +P LT  EN++    + +   E I     
Sbjct: 66  ---DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVE 122

Query: 112 ----AADLDRTFELFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLA 167
                 D+      FPR           LSG               P LLLLDEP   L 
Sbjct: 123 EVAKILDIHHVLNHFPR----------ELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLD 172

Query: 168 PRLAEEVYERVKLI-SESGLTILVVEQNTVLALSVADR 204
            R+ +     VK + S  G+T+LVV  +     ++ADR
Sbjct: 173 ARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR 210


>1f3oA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 225

 Score = 71.6 bits (174), Expect = 2e-15
 Identities = 65/208 (31%), Positives = 102/208 (49%), Gaps = 9/208 (4%)

Query: 14  ILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRR 73
           I AL+ V L +  GE V+ IG +G+GK+TL + I  L++ + G++ ++ +  ++   D  
Sbjct: 16  IYALKNVNLNIKEGEFVS-IGPSGSGKSTL-NIIGCLDKPTEGEVYIDNIKTNDLDDDEL 73

Query: 74  VA---KGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFE-LFPRLKER- 128
                  I    +   + P LT  EN+ L  +   R G S      R  E L   L+ER 
Sbjct: 74  TKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYR-GASGEERRKRALECLKAELEERF 132

Query: 129 RKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTI 188
                  LSGG+QQ +AI RAL   P ++L DEP+  L  +  E++    KL  E G T+
Sbjct: 133 ANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDGKTV 192

Query: 189 LVVEQNTVLALSVADRAYVLETGRIVLE 216
           +VV  +  +A    +R   L+ G +  E
Sbjct: 193 VVVTHDINVA-RFGERIIYLKDGEVERE 219


>1mt0A [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
          Length = 241

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 54/207 (26%), Positives = 102/207 (49%), Gaps = 12/207 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG--VSISEWSTDRRV 74
           L  + L +  GE + ++G +G+GK+TL   I       +G + ++G  +++++ +  RR 
Sbjct: 19  LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQ 78

Query: 75  AKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL-- 132
              + Q      +    ++ +N+SLA+          AA L    +    L+E    +  
Sbjct: 79  VGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG 134

Query: 133 --GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
             G  LSGG++Q +AI RAL+  PK+L+ DE +  L       +   +  I + G T+++
Sbjct: 135 EQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVII 193

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEG 217
           +  + +  +  ADR  V+E G+IV +G
Sbjct: 194 I-AHRLSTVKNADRIIVMEKGKIVEQG 219


>2ff7A [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 54/207 (26%), Positives = 102/207 (49%), Gaps = 12/207 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG--VSISEWSTDRRV 74
           L  + L +  GE + ++G +G+GK+TL   I       +G + ++G  +++++ +  RR 
Sbjct: 21  LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQ 80

Query: 75  AKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL-- 132
              + Q      +    ++ +N+SLA+          AA L    +    L+E    +  
Sbjct: 81  VGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG 136

Query: 133 --GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
             G  LSGG++Q +AI RAL+  PK+L+ DE +  L       +   +  I + G T+++
Sbjct: 137 EQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVII 195

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEG 217
           +  + +  +  ADR  V+E G+IV +G
Sbjct: 196 I-AHRLSTVKNADRIIVMEKGKIVEQG 221


>1xefA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 241

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 54/207 (26%), Positives = 101/207 (48%), Gaps = 12/207 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG--VSISEWSTDRRV 74
           L  + L +  GE + ++G +G+GK+TL   I       +G + ++G  +++++ +  RR 
Sbjct: 19  LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQ 78

Query: 75  AKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL-- 132
              + Q      +    ++ +N+SLA+          AA L    +    L+E    +  
Sbjct: 79  VGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG 134

Query: 133 --GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
             G  LSGG++Q +AI RAL+  PK+L+ DE +  L       +   +  I + G T+++
Sbjct: 135 EQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVII 193

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEG 217
           +    +  +  ADR  V+E G+IV +G
Sbjct: 194 IAAR-LSTVKNADRIIVMEKGKIVEQG 219


>2ffaA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 54/207 (26%), Positives = 101/207 (48%), Gaps = 12/207 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG--VSISEWSTDRRV 74
           L  + L +  GE + ++G +G+GK+TL   I       +G + ++G  +++++ +  RR 
Sbjct: 21  LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQ 80

Query: 75  AKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL-- 132
              + Q      +    ++ +N+SLA+          AA L    +    L+E    +  
Sbjct: 81  VGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG 136

Query: 133 --GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
             G  LSGG++Q +AI RAL+  PK+L+ DE +  L       +   +  I + G T+++
Sbjct: 137 EQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVII 195

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEG 217
           +    +  +  ADR  V+E G+IV +G
Sbjct: 196 IAAR-LSTVKNADRIIVMEKGKIVEQG 221


>2d2fA [x.x.x] SUFC PROTEIN
          Length = 246

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 64/215 (29%), Positives = 97/215 (45%), Gaps = 21/215 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISG--LNRASSGDIQLEGVSISEWSTDRRV 74
           L+GV L V  GE  AL+G NGAGK+TL   ++G        G+I L+G +I E S D R 
Sbjct: 18  LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPDERA 77

Query: 75  AKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGW 134
            KG+  A +     PG+T+   L LA  +  + G  +        E + ++K+  + L W
Sbjct: 78  RKGLFLAFQYPVEVPGVTIANFLRLALQA--KLGREVG-----VAEFWTKVKKALELLDW 130

Query: 135 -----------SLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISE 183
                        SGGE++   I + L+  P   +LDE   GL     + V   V  +  
Sbjct: 131 DESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRG 190

Query: 184 SGLTILVV-EQNTVLALSVADRAYVLETGRIVLEG 217
                LV+     +L     D+ +V+  GR+V  G
Sbjct: 191 PNFGALVITHYQRILNYIQPDKVHVMMDGRVVATG 225


>1b0uA [c.37.1] HISTIDINE PERMEASE
          Length = 258

 Score = 70.5 bits (171), Expect = 5e-15
 Identities = 60/233 (25%), Positives = 104/233 (44%), Gaps = 13/233 (5%)

Query: 6   DLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG--- 62
           DL   +G    L+GV+L+   G+           K+T L  I+ L + S G I + G   
Sbjct: 7   DLHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNI 66

Query: 63  ---------VSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAA 113
                    + +++ +  R +   ++   +   ++  +TV EN+  A +      +  A 
Sbjct: 67  NLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDAR 126

Query: 114 DLDRTFELFPRLKERRK-QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAE 172
           +    +     + ER + +    LSGG+QQ ++I RAL   P +LL DEP+  L P L  
Sbjct: 127 ERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVG 186

Query: 173 EVYERVKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKHN 225
           EV   ++ ++E G T++VV      A  V+     L  G+I  EG   ++  N
Sbjct: 187 EVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFGN 239


>2fgkA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 241

 Score = 70.1 bits (170), Expect = 6e-15
 Identities = 53/207 (25%), Positives = 102/207 (49%), Gaps = 12/207 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG--VSISEWSTDRRV 74
           L  + L +  GE + ++G +G+GK+TL   I       +G + ++G  +++++ +  RR 
Sbjct: 19  LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQ 78

Query: 75  AKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL-- 132
              + Q      +    ++ +N+SLA+          AA L    +    L+E    +  
Sbjct: 79  VGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG 134

Query: 133 --GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
             G  LSGG++Q +AI RAL+  PK+L+ D+ +  L       +   +  I + G T+++
Sbjct: 135 EQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK-GRTVII 193

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEG 217
           +  + +  +  ADR  V+E G+IV +G
Sbjct: 194 I-AHRLSTVKNADRIIVMEKGKIVEQG 219


>2ffbA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score = 70.1 bits (170), Expect = 6e-15
 Identities = 53/207 (25%), Positives = 102/207 (49%), Gaps = 12/207 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG--VSISEWSTDRRV 74
           L  + L +  GE + ++G +G+GK+TL   I       +G + ++G  +++++ +  RR 
Sbjct: 21  LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQ 80

Query: 75  AKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL-- 132
              + Q      +    ++ +N+SLA+          AA L    +    L+E    +  
Sbjct: 81  VGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG 136

Query: 133 --GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
             G  LSGG++Q +AI RAL+  PK+L+ D+ +  L       +   +  I + G T+++
Sbjct: 137 EQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK-GRTVII 195

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEG 217
           +  + +  +  ADR  V+E G+IV +G
Sbjct: 196 I-AHRLSTVKNADRIIVMEKGKIVEQG 221


>3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score = 70.1 bits (170), Expect = 6e-15
 Identities = 54/207 (26%), Positives = 101/207 (48%), Gaps = 12/207 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG--VSISEWSTDRRV 74
           L  + L +  GE + ++G  G+GK+TL   I       +G + ++G  +++++ +  RR 
Sbjct: 21  LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQ 80

Query: 75  AKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL-- 132
              + Q      +    ++ +N+SLA+          AA L    +    L+E    +  
Sbjct: 81  VGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG 136

Query: 133 --GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
             G  LSGG++Q +AI RAL+  PK+L+ DE +  L       +   +  I + G T+++
Sbjct: 137 EQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVII 195

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEG 217
           +  + +  +  ADR  V+E G+IV +G
Sbjct: 196 I-AHRLSTVKNADRIIVMEKGKIVEQG 221


>2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
          Length = 361

 Score = 68.9 bits (167), Expect = 1e-14
 Identities = 59/195 (30%), Positives = 99/195 (50%), Gaps = 19/195 (9%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           GD+ A++ ++L++  GE + L+G +G GKTT L  I+GL   + G I +E   +++    
Sbjct: 15  GDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYIEDNLVAD---- 69

Query: 72  RRVAKGISQAPEGR--------RIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFP 123
               KG+   P+ R         ++P  TV +N++      +   + I   +    EL  
Sbjct: 70  --PEKGVFVPPKERDVAVFQSYALYPH-TVYDNIAFPLKLRKVPKQEIDKRVREVAEL-- 124

Query: 124 RLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISE 183
            L E   +    LSGG++Q +A+GRA++ RPK + LDEP   L  +L  +  E  KL  +
Sbjct: 125 GLTELLNRKPRELSGGQRQRVALGRAIIRRPK-VFLDEPLSNLDAKLRVKRAELKKLQRQ 183

Query: 184 SGLTILVVEQNTVLA 198
            G+T + V  + V A
Sbjct: 184 LGVTTIYVTHDQVEA 198


>2d2eA [x.x.x] SUFC PROTEIN
          Length = 239

 Score = 68.9 bits (167), Expect = 1e-14
 Identities = 63/211 (29%), Positives = 98/211 (46%), Gaps = 18/211 (8%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISG--LNRASSGDIQLEGVSISEWSTDRRV 74
           L+GV L V  GE  AL+G NGAGK+TL   ++G        G+I L+G +I E S D R 
Sbjct: 18  LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPDERA 77

Query: 75  AKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGW 134
            KG+  A +   + PG+T+   L LA  +  + G  +        E + ++K+  + L W
Sbjct: 78  RKGLFLAFQ-YPVVPGVTIANFLRLALQA--KLGREVG-----VAEFWTKVKKALELLDW 129

Query: 135 S-------LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLT 187
                   L+ GE++   I + L+  P   +LDE   GL     + V   V  +      
Sbjct: 130 DESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFG 189

Query: 188 ILVV-EQNTVLALSVADRAYVLETGRIVLEG 217
            LV+     +L     D+ +V+  GR+V  G
Sbjct: 190 ALVITHYQRILNYIQPDKVHVMMDGRVVATG 220


>2zu0C [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 247

 Score = 68.6 bits (166), Expect = 2e-14
 Identities = 65/237 (27%), Positives = 111/237 (46%), Gaps = 17/237 (7%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLN--RASSGDI 58
           ML+  DL V+  D   L+G++L V  GE  A++G NG+GK+TL  T++G      + G +
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 59  QLEGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRT 118
           + +G  +   S + R  +GI  A +     PG++ +  L  A  + R +       LDR 
Sbjct: 61  EFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR- 117

Query: 119 FELFPRLKER-----------RKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLA 167
           F+    ++E+            + +    SGGE++   I +  +  P+L +LDE   GL 
Sbjct: 118 FDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLD 177

Query: 168 PRLAEEVYERVKLISESGLT-ILVVEQNTVLALSVADRAYVLETGRIVLEGPASELK 223
               + V + V  + +   + I+V     +L     D  +VL  GRIV  G  + +K
Sbjct: 178 IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVK 234


>2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 68.6 bits (166), Expect = 2e-14
 Identities = 65/237 (27%), Positives = 111/237 (46%), Gaps = 17/237 (7%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLN--RASSGDI 58
           ML+  DL V+  D   L+G++L V  GE  A++G NG+GK+TL  T++G      + G +
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 59  QLEGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRT 118
           + +G  +   S + R  +GI  A +     PG++ +  L  A  + R +       LDR 
Sbjct: 61  EFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR- 117

Query: 119 FELFPRLKER-----------RKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLA 167
           F+    ++E+            + +    SGGE++   I +  +  P+L +LDE   GL 
Sbjct: 118 FDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLD 177

Query: 168 PRLAEEVYERVKLISESGLT-ILVVEQNTVLALSVADRAYVLETGRIVLEGPASELK 223
               + V + V  + +   + I+V     +L     D  +VL  GRIV  G  + +K
Sbjct: 178 IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVK 234


>2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 330

 Score = 68.6 bits (166), Expect = 2e-14
 Identities = 57/216 (26%), Positives = 95/216 (43%), Gaps = 47/216 (21%)

Query: 10  AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           A G+++  + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+ +    +++  
Sbjct: 11  AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP 70

Query: 70  TDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERR 129
              R   G+        +F    +E                              + +R 
Sbjct: 71  PAER---GVGM------VFQSYALEV-----------------------------INQRV 92

Query: 130 KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGLTI 188
            Q+         ++LAIGR L+A P + LLDEP   L   L  ++  E  +L    G T+
Sbjct: 93  NQVA--------EVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTM 144

Query: 189 LVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           + V  + V A+++AD+  VL+ GR+   G   EL H
Sbjct: 145 IYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH 180


>2ixeA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 251

 Score = 67.0 bits (162), Expect = 5e-14
 Identities = 59/226 (26%), Positives = 108/226 (47%), Gaps = 25/226 (11%)

Query: 11  HGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST 70
           H ++  LQG+T  +  G+  AL+G NG+GK+T+   +  L + + G + L+G  + ++  
Sbjct: 24  HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH 83

Query: 71  D--RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDR----TFELFPR 124
                    + Q P    +  G +  EN++          E  A  ++         FP+
Sbjct: 84  HYLHTQVAAVGQEP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQ 139

Query: 125 LKERR-KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP----RLAEEVYERVK 179
             +    + G  LSGG++Q +A+ RAL+ +P+LL+LD  +  L      R+   +YE  +
Sbjct: 140 GYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPE 199

Query: 180 LISESGLTILVVEQNTVLALSVADRAY---VLETGRIVLEGPASEL 222
             S    T+L++ Q     LS+A+RA+    L+ G +  +G   +L
Sbjct: 200 WASR---TVLLITQQ----LSLAERAHHILFLKEGSVCEQGTHLQL 238


>1mv5D [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
          Length = 241

 Score = 66.6 bits (161), Expect = 7e-14
 Identities = 54/212 (25%), Positives = 100/212 (47%), Gaps = 11/212 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ ++ +      +A  G +G GK+T+   +    + ++G+I ++G  I   S +   ++
Sbjct: 18  LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQ 77

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTF-----ELFP-RLKERRK 130
            I    +   I  G T+ ENL+   +      E +   LD  F     E  P +L     
Sbjct: 78  -IGFVSQDSAIMAG-TIRENLTYG-LEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVG 134

Query: 131 QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
           + G  +SGG++Q LAI RA +  PK+L+LDE +  L       V + +  + +   T+++
Sbjct: 135 ERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVI 194

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
             + + +    AD+ Y +E G+I   G  +EL
Sbjct: 195 AHRLSTIV--DADKIYFIEKGQITGSGKHNEL 224


>1mv5A [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
          Length = 242

 Score = 66.6 bits (161), Expect = 7e-14
 Identities = 54/212 (25%), Positives = 100/212 (47%), Gaps = 11/212 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ ++ +      +A  G +G GK+T+   +    + ++G+I ++G  I   S +   ++
Sbjct: 18  LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQ 77

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTF-----ELFP-RLKERRK 130
            I    +   I  G T+ ENL+   +      E +   LD  F     E  P +L     
Sbjct: 78  -IGFVSQDSAIMAG-TIRENLTYG-LEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVG 134

Query: 131 QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
           + G  +SGG++Q LAI RA +  PK+L+LDE +  L       V + +  + +   T+++
Sbjct: 135 ERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVI 194

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
             + + +    AD+ Y +E G+I   G  +EL
Sbjct: 195 AHRLSTIV--DADKIYFIEKGQITGSGKHNEL 224


>2ixeD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 248

 Score = 66.6 bits (161), Expect = 7e-14
 Identities = 56/219 (25%), Positives = 104/219 (47%), Gaps = 18/219 (8%)

Query: 11  HGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST 70
           H ++  LQG+T  +  G+  AL+G NG+GK+T+   +  L + + G + L+G  + ++  
Sbjct: 26  HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH 85

Query: 71  DRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK 130
                +  +  P    +  G +  EN++          E  A  ++     F     +  
Sbjct: 86  HYLHTQVAAVGP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGY 141

Query: 131 QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP----RLAEEVYERVKLISESGL 186
                LSGG++Q +A+ RAL+ +P+LL+LD  +  L      R+   +YE  +  S    
Sbjct: 142 DTEVQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASR--- 198

Query: 187 TILVVEQNTVLALSVADRAY---VLETGRIVLEGPASEL 222
           T+L++ Q     LS+A+RA+    L+ G +  +G   +L
Sbjct: 199 TVLLITQQ----LSLAERAHHILFLKEGSVCEQGTHLQL 233


>2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 66.2 bits (160), Expect = 9e-14
 Identities = 64/236 (27%), Positives = 111/236 (47%), Gaps = 17/236 (7%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLN--RASSGDI 58
           ML+  DL V+  D   L+G++L V  GE  A++G NG+GK+TL  T++G      + G +
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 59  QLEGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRT 118
           + +G  +   S + R  +GI  A +     PG++ +  L  A  + R +       LDR 
Sbjct: 61  EFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR- 117

Query: 119 FELFPRLKER-----------RKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLA 167
           F+    ++E+            + +    SGGE++   I +  +  P+L +LDE S  L 
Sbjct: 118 FDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDE-SDSLD 176

Query: 168 PRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELK 223
               + V + V  + +   + ++V    +L     D  +VL  GRIV  G  + +K
Sbjct: 177 IDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVLYQGRIVKSGDFTLVK 232


>2ixfD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 250

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 60/224 (26%), Positives = 110/224 (49%), Gaps = 23/224 (10%)

Query: 11  HGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST 70
           H ++  LQG+T  +  G+  AL+G NG+GK+T+   +  L + + G + L+G  + ++  
Sbjct: 25  HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY-- 82

Query: 71  DRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDR----TFELFPRLK 126
           D         A  G+ +F G +  EN++          E  A  ++         FP+  
Sbjct: 83  DHHYLH-TQVAAVGQLLF-GRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGY 140

Query: 127 ERR-KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP----RLAEEVYERVKLI 181
           +    + G  LSGG++Q +A+ RAL+ +P+LL+LD+ +  L      R+   +YE  +  
Sbjct: 141 DTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWA 200

Query: 182 SESGLTILVVEQNTVLALSVADRAY---VLETGRIVLEGPASEL 222
           S +   +L+  Q     LS+A+RA+    L+ G +  +G   +L
Sbjct: 201 SRT--VLLITHQ-----LSLAERAHHILFLKEGSVCEQGTHLQL 237


>2ixfC [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 252

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 58/226 (25%), Positives = 108/226 (47%), Gaps = 25/226 (11%)

Query: 11  HGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST 70
           H ++  LQG+T  +  G+  AL+G NG+GK+T+   +  L + + G + L+G  + ++  
Sbjct: 24  HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH 83

Query: 71  D--RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDR----TFELFPR 124
                    + Q P    +  G +  EN++          E  A  ++         FP+
Sbjct: 84  HYLHTQVAAVGQEP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQ 139

Query: 125 LKERR-KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP----RLAEEVYERVK 179
             +    + G  LSGG++Q +A+ RAL+ +P+LL+LD+ +  L      R+   +YE  +
Sbjct: 140 GYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPE 199

Query: 180 LISESGLTILVVEQNTVLALSVADRAY---VLETGRIVLEGPASEL 222
             S +   +L+  Q     LS+A+RA+    L+ G +  +G   +L
Sbjct: 200 WASRT--VLLITHQ-----LSLAERAHHILFLKEGSVCEQGTHLQL 238


>2ixfA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 255

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 58/226 (25%), Positives = 108/226 (47%), Gaps = 25/226 (11%)

Query: 11  HGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST 70
           H ++  LQG+T  +  G+  AL+G NG+GK+T+   +  L + + G + L+G  + ++  
Sbjct: 28  HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH 87

Query: 71  D--RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDR----TFELFPR 124
                    + Q P    +  G +  EN++          E  A  ++         FP+
Sbjct: 88  HYLHTQVAAVGQEP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQ 143

Query: 125 LKERR-KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP----RLAEEVYERVK 179
             +    + G  LSGG++Q +A+ RAL+ +P+LL+LD+ +  L      R+   +YE  +
Sbjct: 144 GYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPE 203

Query: 180 LISESGLTILVVEQNTVLALSVADRAY---VLETGRIVLEGPASEL 222
             S +   +L+  Q     LS+A+RA+    L+ G +  +G   +L
Sbjct: 204 WASRT--VLLITHQ-----LSLAERAHHILFLKEGSVCEQGTHLQL 242


>2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 243

 Score = 65.1 bits (157), Expect = 2e-13
 Identities = 66/237 (27%), Positives = 112/237 (47%), Gaps = 18/237 (7%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLN--RASSGDI 58
           ML+  DL V+  D   L+G++L V  GE  A++G NG+GK+TL  T++G      + G +
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 59  QLEGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRT 118
           + +G  +   S + R  +GI  A +     PG++ +  L  A  + R +       LDR 
Sbjct: 61  EFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR- 117

Query: 119 FELFPRLKER-----------RKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLA 167
           F+    ++E+            + +    SGGE++   I +  +  P+L +LDE S GL 
Sbjct: 118 FDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDE-SDGLD 176

Query: 168 PRLAEEVYERVKLISESGLT-ILVVEQNTVLALSVADRAYVLETGRIVLEGPASELK 223
               + V + V  + +   + I+V     +L     D  +VL  GRIV  G  + +K
Sbjct: 177 IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVK 233


>2pjzA [x.x.x] HYPOTHETICAL PROTEIN ST1066
          Length = 261

 Score = 62.8 bits (151), Expect = 1e-12
 Identities = 61/206 (29%), Positives = 100/206 (48%), Gaps = 21/206 (10%)

Query: 16  ALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVA 75
           +L+ + L+V  GE V ++G NG+GKTTLL  ISGL    SG+I + G+ + +     R +
Sbjct: 20  SLENINLEV-NGEKVIILGPNGSGKTTLLRAISGL-LPYSGNIFINGMEVRKIRNYIRYS 77

Query: 76  KGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLK---ERRKQL 132
             + +A E      G+TV + + L       + E    D D   E+   LK   E  ++ 
Sbjct: 78  TNLPEAYE-----IGVTVNDIVYL-------YEELKGLDRDLFLEMLKALKLGEEILRRK 125

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
            + LS G+  ++    AL ++P+++ LDEP   +       +   +K   + G  ILV  
Sbjct: 126 LYKLSAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKEG--ILVTH 183

Query: 193 QNTVLALSVADRAYVLETGRIVLEGP 218
           +  +L L    +AY L   R  L+GP
Sbjct: 184 ELDMLNLYKEYKAYFLVGNR--LQGP 207


>1pf4A [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
          Length = 520

 Score = 62.4 bits (150), Expect = 1e-12
 Identities = 53/207 (25%), Positives = 98/207 (47%), Gaps = 9/207 (4%)

Query: 16  ALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVA 75
           AL  V+  +  G+TVAL+G +G+GK+T+ +  +      SG I L+G  + ++     + 
Sbjct: 314 ALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKL-TNLR 372

Query: 76  KGISQAPEGRRIFPGLTVEENLSLASV-SWRRWGESIAADLDRTFELFPRLKERRKQL-- 132
           +  +   +   +F   T+  N++ A+   + R     AA      E    + +    +  
Sbjct: 373 RHFALVSQNVHLFND-TIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIG 431

Query: 133 --GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
             G SLSGG++Q +AI RAL+    +L+LDE +  L    +E   +      +   T+LV
Sbjct: 432 ENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTE-SERAIQAALDELQKNKTVLV 490

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEG 217
           +  + +  +  AD   V++ G I+  G
Sbjct: 491 I-AHRLSTIEQADEILVVDEGEIIERG 516


>2ixgA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 254

 Score = 62.4 bits (150), Expect = 1e-12
 Identities = 57/226 (25%), Positives = 107/226 (47%), Gaps = 25/226 (11%)

Query: 11  HGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST 70
           H ++  LQG+T  +  G+  AL+G NG+GK+T+   +  L + + G + L+G  + ++  
Sbjct: 26  HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH 85

Query: 71  D--RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDR----TFELFPR 124
                    + Q P    +  G +  EN++          E  A  ++         FP+
Sbjct: 86  HYLHTQVAAVGQEP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQ 141

Query: 125 LKERR-KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAP----RLAEEVYERVK 179
             +    + G  L+ G++Q +A+ RAL+ +P+LL+LD  +  L      R+   +YE  +
Sbjct: 142 GYDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPE 201

Query: 180 LISESGLTILVVEQNTVLALSVADRAY---VLETGRIVLEGPASEL 222
             S    T+L++ Q     LS+A+RA+    L+ G +  +G   +L
Sbjct: 202 WASR---TVLLITQQ----LSLAERAHHILFLKEGSVCEQGTHLQL 240


>2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 241

 Score = 61.6 bits (148), Expect = 2e-12
 Identities = 63/236 (26%), Positives = 109/236 (46%), Gaps = 18/236 (7%)

Query: 1   MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLN--RASSGDI 58
           ML+  DL V+  D   L+G++L V  GE  A++G NG+GK+TL  T++G      + G +
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 59  QLEGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRT 118
           + +G  +   S + R  +GI  A +     PG++ +  L  A  + R +       LDR 
Sbjct: 61  EFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR- 117

Query: 119 FELFPRLKER-----------RKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLA 167
           F+    ++E+            + +    SGGE++   I +  +  P+L +LDE     A
Sbjct: 118 FDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDDIDA 177

Query: 168 PRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELK 223
            ++  +    ++    S   I+V     +L     D  +VL  GRIV  G  + +K
Sbjct: 178 LKVVADGVNSLRDGKRS--FIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVK 231


>1v43A [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
           ATP-BINDING PROTEIN
          Length = 353

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 54/218 (24%), Positives = 97/218 (44%), Gaps = 13/218 (5%)

Query: 6   DLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSI 65
           +L    G+  A+  + L +  GE + L+G +G GKTT L  I+GL   + G I       
Sbjct: 11  NLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRI------- 63

Query: 66  SEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRL 125
             +  DR V     +      +F  +TV EN++     + +  + I   +    EL  ++
Sbjct: 64  --YFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPK--DEIDKRVRWAAELL-QI 118

Query: 126 KERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISES- 184
           +E   +    LSGG              P +LL+DEP   L  +L   +   +K + +  
Sbjct: 119 EELLNRYPAQLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKL 178

Query: 185 GLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
            +T + V  + V A+++ DR  V+  G+++  G  +E+
Sbjct: 179 KVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEV 216


>2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 59/209 (28%), Positives = 95/209 (45%), Gaps = 19/209 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 34  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 79

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESI-AADLDRTFELFPRLKERRKQLGWS 135
            IS   +   I PG T++EN+   S    R+   I A  L+     F   ++    LG +
Sbjct: 80  RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKF--AEKDNIVLGIT 136

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNT 195
           LSGG++  +++ RA+     L LLD P   L     +E++E       +  T ++V  + 
Sbjct: 137 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSK 195

Query: 196 VLALSVADRAYVLETGRIVLEGPASELKH 224
           +  L  AD+  +L  G     G  SEL++
Sbjct: 196 MEHLKKADKILILHEGSSYFYGTFSELQN 224


>2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 249

 Score = 60.5 bits (145), Expect = 5e-12
 Identities = 59/209 (28%), Positives = 94/209 (44%), Gaps = 18/209 (8%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 29  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 74

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESI-AADLDRTFELFPRLKERRKQLGWS 135
            IS   +   I PG T++EN+   S    R+   I A  L+     F   K+     G +
Sbjct: 75  RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAE-KDNIVLGGIT 132

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNT 195
           LSGG++  +++ RA+     L LLD P   L     +E++E       +  T ++V  + 
Sbjct: 133 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSK 191

Query: 196 VLALSVADRAYVLETGRIVLEGPASELKH 224
           +  L  AD+  +L  G     G  SEL++
Sbjct: 192 MEHLKKADKILILHEGSSYFYGTFSELQN 220


>2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 231

 Score = 60.5 bits (145), Expect = 5e-12
 Identities = 59/209 (28%), Positives = 94/209 (44%), Gaps = 18/209 (8%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 15  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 60

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESI-AADLDRTFELFPRLKERRKQLGWS 135
            IS   +   I PG T++EN+   S    R+   I A  L+     F   K+     G +
Sbjct: 61  RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAE-KDNIVLGGIT 118

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNT 195
           LSGG++  +++ RA+     L LLD P   L     +E++E       +  T ++V  + 
Sbjct: 119 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSK 177

Query: 196 VLALSVADRAYVLETGRIVLEGPASELKH 224
           +  L  AD+  +L  G     G  SEL++
Sbjct: 178 MEHLKKADKILILHEGSSYFYGTFSELQN 206


>2ghiA [x.x.x] TRANSPORT PROTEIN
          Length = 255

 Score = 59.7 bits (143), Expect = 8e-12
 Identities = 48/210 (22%), Positives = 103/210 (49%), Gaps = 9/210 (4%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +   + +G T AL+G  G+GK+T+   +     A  GDI++ G ++++++ +  +  
Sbjct: 35  LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNS-IRS 92

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            I   P+   +F   T++ N+    +         A    + ++    L ++   +    
Sbjct: 93  IIGIVPQDTILF-NETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNK 151

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G  LSGGE+Q +AI R L+  PK+++ DE +  L  +  E ++++         T++++ 
Sbjct: 152 GMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSK-TEYLFQKAVEDLRKNRTLIII- 209

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASEL 222
            + +  +S A+   +L  G+IV +G   +L
Sbjct: 210 AHRLSTISSAESIILLNKGKIVEKGTHKDL 239


>2ghiB [x.x.x] TRANSPORT PROTEIN
          Length = 248

 Score = 58.5 bits (140), Expect = 2e-11
 Identities = 50/209 (23%), Positives = 101/209 (48%), Gaps = 12/209 (5%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +   + +G T AL+G  G+GK+T+   +     A  GDI++ G ++++++ +  +  
Sbjct: 35  LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNS-IRS 92

Query: 77  GISQAPEGRRIFPGLTVEENL---SLASVSWRRWGESIAADLDRTFELFPRLKERRKQLG 133
            I   P+   +F   T++ N+    L +        + +A L    E  P+  +      
Sbjct: 93  IIGIVPQDTILF-NETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNK 151

Query: 134 WSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQ 193
             LSGGE+Q +AI R L+  PK+++ DE +   +    E ++++         T++++  
Sbjct: 152 MKLSGGERQRIAIARCLLKDPKIVIFDEAT---SDSKTEYLFQKAVEDLRKNRTLIIIAH 208

Query: 194 NTVLALSVADRAYVLETGRIVLEGPASEL 222
            T+   S A+   +L  G+IV +G   +L
Sbjct: 209 RTI---SSAESIILLNKGKIVEKGTHKDL 234


>2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 253

 Score = 58.5 bits (140), Expect = 2e-11
 Identities = 58/209 (27%), Positives = 94/209 (44%), Gaps = 20/209 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 31  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 76

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESI-AADLDRTFELFPRLKERRKQLGWS 135
            IS   +   I PG T++EN+   S    R+   I A  L+     F    E+   +  +
Sbjct: 77  RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKF---AEKDNIVLIT 132

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNT 195
           LSGG++  +++ RA+     L LLD P   L     +E++E       +  T ++V  + 
Sbjct: 133 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSK 191

Query: 196 VLALSVADRAYVLETGRIVLEGPASELKH 224
           +  L  AD+  +L  G     G  SEL++
Sbjct: 192 MEHLKKADKILILHEGSSYFYGTFSELQN 220


>2pzgB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 215

 Score = 57.8 bits (138), Expect = 3e-11
 Identities = 58/214 (27%), Positives = 96/214 (44%), Gaps = 18/214 (8%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           G    L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G         
Sbjct: 18  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------- 68

Query: 72  RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK- 130
                 IS   +   I PG T++EN+ +  VS+  +         +  E   +  E+   
Sbjct: 69  -----RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNI 121

Query: 131 QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILV 190
            LG +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T ++
Sbjct: 122 VLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL 181

Query: 191 VEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           V  + +  L  AD+  +L  G     G  SEL++
Sbjct: 182 V-TSKMEHLKKADKILILHEGSSYFYGTFSELQN 214


>1xmiB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 57.4 bits (137), Expect = 4e-11
 Identities = 57/208 (27%), Positives = 97/208 (46%), Gaps = 24/208 (11%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 39  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 84

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSL 136
            IS   +   I PG T++EN+ +A VS+  +         R+     +L+E   ++  +L
Sbjct: 85  RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRY-------RSVIKACQLEEDISKIVLTL 135

Query: 137 SGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTV 196
           SGG++  +++ RA+     L LLD P   L     +E++E       +  T ++V  + +
Sbjct: 136 SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKM 194

Query: 197 LALSVADRAYVLETGRIVLEGPASELKH 224
             L  AD+  +L  G     G  SEL++
Sbjct: 195 EHLKKADKILILHEGSSYFYGTFSELQN 222


>1xmiE [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 57.0 bits (136), Expect = 5e-11
 Identities = 57/212 (26%), Positives = 96/212 (45%), Gaps = 21/212 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 36  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 81

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK----QL 132
            IS   +   I PG T++EN+ +A VS+  +         +  E   +  E+      + 
Sbjct: 82  RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 139

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T ++V 
Sbjct: 140 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV- 198

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            + +  L  AD+  +L  G     G  SEL++
Sbjct: 199 TSKMEHLKKADKILILHEGSSYFYGTFSELQN 230


>1xmiC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 270

 Score = 57.0 bits (136), Expect = 5e-11
 Identities = 57/212 (26%), Positives = 96/212 (45%), Gaps = 21/212 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 40  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 85

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK----QL 132
            IS   +   I PG T++EN+ +A VS+  +         +  E   +  E+      + 
Sbjct: 86  RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 143

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T ++V 
Sbjct: 144 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV- 202

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            + +  L  AD+  +L  G     G  SEL++
Sbjct: 203 TSKMEHLKKADKILILHEGSSYFYGTFSELQN 234


>1xmiA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 57.0 bits (136), Expect = 5e-11
 Identities = 57/212 (26%), Positives = 96/212 (45%), Gaps = 21/212 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 37  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 82

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK----QL 132
            IS   +   I PG T++EN+ +A VS+  +         +  E   +  E+      + 
Sbjct: 83  RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 140

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T ++V 
Sbjct: 141 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV- 199

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            + +  L  AD+  +L  G     G  SEL++
Sbjct: 200 TSKMEHLKKADKILILHEGSSYFYGTFSELQN 231


>2pzfB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 216

 Score = 56.6 bits (135), Expect = 7e-11
 Identities = 59/215 (27%), Positives = 94/215 (43%), Gaps = 18/215 (8%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           G    L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G         
Sbjct: 17  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------- 67

Query: 72  RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESI-AADLDRTFELFPRLKE-RR 129
                 IS   +   I PG T++EN+   S    R+   I A  L+     F        
Sbjct: 68  -----RISFCSQFSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVL 121

Query: 130 KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTIL 189
            + G +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T +
Sbjct: 122 GEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI 181

Query: 190 VVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           +V  + +  L  AD+  +L  G     G  SEL++
Sbjct: 182 LV-TSKMEHLKKADKILILHEGSSYFYGTFSELQN 215


>2pzfA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 224

 Score = 56.6 bits (135), Expect = 7e-11
 Identities = 59/215 (27%), Positives = 94/215 (43%), Gaps = 18/215 (8%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           G    L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G         
Sbjct: 17  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------- 67

Query: 72  RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESI-AADLDRTFELFPRLKE-RR 129
                 IS   +   I PG T++EN+   S    R+   I A  L+     F        
Sbjct: 68  -----RISFCSQFSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVL 121

Query: 130 KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTIL 189
            + G +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T +
Sbjct: 122 GEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI 181

Query: 190 VVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
           +V  + +  L  AD+  +L  G     G  SEL++
Sbjct: 182 LV-TSKMEHLKKADKILILHEGSSYFYGTFSELQN 215


>1xf9D [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 260

 Score = 56.2 bits (134), Expect = 9e-11
 Identities = 56/211 (26%), Positives = 96/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 31  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 76

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ ++ VS+  +         +  +   +  E+   +    
Sbjct: 77  RVSFCSQFSWIMPG-TIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 134

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 135 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 193

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 194 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 224


>1xf9C [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 56.2 bits (134), Expect = 9e-11
 Identities = 56/211 (26%), Positives = 96/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 36  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 81

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ ++ VS+  +         +  +   +  E+   +    
Sbjct: 82  RVSFCSQFSWIMPG-TIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 198

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 199 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 229


>1xf9B [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 56.2 bits (134), Expect = 9e-11
 Identities = 56/211 (26%), Positives = 96/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 36  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 81

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ ++ VS+  +         +  +   +  E+   +    
Sbjct: 82  RVSFCSQFSWIMPG-TIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 198

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 199 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 229


>1xf9A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 56.2 bits (134), Expect = 9e-11
 Identities = 56/211 (26%), Positives = 96/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 35  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 80

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ ++ VS+  +         +  +   +  E+   +    
Sbjct: 81  RVSFCSQFSWIMPG-TIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 197

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 198 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 228


>1xmjA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 246

 Score = 55.8 bits (133), Expect = 1e-10
 Identities = 60/219 (27%), Positives = 95/219 (43%), Gaps = 18/219 (8%)

Query: 8   VVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISE 67
           V A  +   L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G     
Sbjct: 7   VTAFWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----- 61

Query: 68  WSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESI-AADLDRTFELFPRLK 126
                     IS   +   I PG T++EN+   S    R+   I A  L+     F    
Sbjct: 62  ---------RISFCSQFSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKD 111

Query: 127 E-RRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESG 185
                + G +LS G+Q  +++ RA+     L LLD P   L     +E++E       + 
Sbjct: 112 NIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMAN 171

Query: 186 LTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            T ++V  + +  L  AD+  +L  G     G  SEL++
Sbjct: 172 KTRILV-TSKMEHLKKADKILILHEGSSYFYGTFSELQN 209


>1xfaA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 55.5 bits (132), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 35  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 80

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 81  RVSFCSQFSWIMPG-TIKENI-IRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 197

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 198 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 228


>1xmiD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 268

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 59/211 (27%), Positives = 97/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 39  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 84

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWG-ESI--AADLDRTFELFPRLKERRKQLG 133
            IS   +   I PG T++EN+ +A VS+  +   S+  A  L+     F   K+      
Sbjct: 85  RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAE-KDNIVLGE 141

Query: 134 WSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQ 193
            +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T ++V  
Sbjct: 142 ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-T 200

Query: 194 NTVLALSVADRAYVLETGRIVLEGPASELKH 224
           + +  L  AD+  +L  G     G  SEL++
Sbjct: 201 SKMEHLKKADKILILHEGSSYFYGTFSELQN 231


>1r10A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 35  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 80

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 81  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 197

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 198 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 228


>1r0zD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 256

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 30  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 75

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 76  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 133

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 134 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 192

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 193 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 223


>1r0zC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 273

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 47  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 92

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 93  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 150

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 151 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 209

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 210 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 240


>1r0zB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 271

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 45  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 90

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 91  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 148

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 149 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 207

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 208 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 238


>1r0zA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 271

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 45  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 90

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 91  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 148

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 149 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 207

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 208 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 238


>1r0xD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 263

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 34  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 79

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 80  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 137

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 138 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 196

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 197 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 227


>1r0xC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 36  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 81

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 82  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 198

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 199 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 229


>1r0xB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 36  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 81

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 82  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 198

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 199 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 229


>1r0xA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 35  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 80

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 81  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 197

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 198 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 228


>1r0wC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 38  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 83

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 84  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 141

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 142 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 200

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 201 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 231


>1r0wB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 38  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 83

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 84  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 141

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 142 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 200

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 201 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 231


>1r0wA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 37  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 82

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 83  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 140

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 141 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 199

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 200 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 230


>1q3hD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 35  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 80

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 81  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 197

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 198 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 228


>1q3hC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 37  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 82

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 83  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 140

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 141 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 199

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 200 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 230


>1q3hB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 38  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 83

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 84  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 141

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 142 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 200

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 201 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 231


>1q3hA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 21/211 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ + L +  GE +A+ G+ G+GKT+LL  I G   AS G I+  G              
Sbjct: 36  LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------------- 81

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQL---- 132
            +S   +   I PG T++EN+ +  VS+  +         +  +   +  E+   +    
Sbjct: 82  RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LSGG++  +++ RA+     L LLD P   L     E+V+E       +  T ++V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV- 198

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELK 223
            + +  L  AD+  +L  G     G  SEL+
Sbjct: 199 TSKMEHLRKADKILILHQGSSYFYGTFSELQ 229


>2pzgA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 223

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 57/217 (26%), Positives = 96/217 (44%), Gaps = 21/217 (9%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           G    L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G         
Sbjct: 15  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------- 65

Query: 72  RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK- 130
                 IS   +   I PG T++EN+ +  VS+  +         +  E   +  E+   
Sbjct: 66  -----RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNI 118

Query: 131 ---QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLT 187
              + G +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T
Sbjct: 119 VLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKT 178

Query: 188 ILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            ++V  + +  L  AD+  +L  G     G  SEL++
Sbjct: 179 RILV-TSKMEHLKKADKILILHEGSSYFYGTFSELQN 214


>2pzeB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 219

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 57/217 (26%), Positives = 96/217 (44%), Gaps = 21/217 (9%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           G    L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G         
Sbjct: 16  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------- 66

Query: 72  RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK- 130
                 IS   +   I PG T++EN+ +  VS+  +         +  E   +  E+   
Sbjct: 67  -----RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNI 119

Query: 131 ---QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLT 187
              + G +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T
Sbjct: 120 VLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKT 179

Query: 188 ILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            ++V  + +  L  AD+  +L  G     G  SEL++
Sbjct: 180 RILV-TSKMEHLKKADKILILHEGSSYFYGTFSELQN 215


>2pzeA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 226

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 57/217 (26%), Positives = 96/217 (44%), Gaps = 21/217 (9%)

Query: 12  GDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTD 71
           G    L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G         
Sbjct: 19  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------- 69

Query: 72  RRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK- 130
                 IS   +   I PG T++EN+ +  VS+  +         +  E   +  E+   
Sbjct: 70  -----RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNI 122

Query: 131 ---QLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLT 187
              + G +LSGG++  +++ RA+     L LLD P   L     +E++E       +  T
Sbjct: 123 VLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKT 182

Query: 188 ILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            ++V  + +  L  AD+  +L  G     G  SEL++
Sbjct: 183 RILV-TSKMEHLKKADKILILHEGSSYFYGTFSELQN 218


>2ghiC [x.x.x] TRANSPORT PROTEIN
          Length = 248

 Score = 54.3 bits (129), Expect = 4e-10
 Identities = 46/207 (22%), Positives = 102/207 (49%), Gaps = 8/207 (3%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +   + +G T AL+G  G+GK+T+   +     A  GDI++ G ++++++ +  +  
Sbjct: 35  LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNS-IRS 92

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLD-RTFELFPRLKERRKQLGWS 135
            I   P+   +F   T++ N+    +      E I A    + ++    L ++   +   
Sbjct: 93  IIGIVPQDTILF-NETIKYNILYGKLDATE--EVIKATKSAQLYDFIEALPKKWDTIVGG 149

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNT 195
           +  GE+Q +AI R L+  PK+++ DE +  L  +  E ++++         T++++  + 
Sbjct: 150 MKLGERQRIAIARCLLKDPKIVIFDEATSSLDSK-TEYLFQKAVEDLRKNRTLIII-AHR 207

Query: 196 VLALSVADRAYVLETGRIVLEGPASEL 222
           +  +S A+   +L  G+IV +G   +L
Sbjct: 208 LSTISSAESIILLNKGKIVEKGTHKDL 234


>3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 593

 Score = 53.5 bits (127), Expect = 6e-10
 Identities = 56/193 (29%), Positives = 88/193 (45%), Gaps = 30/193 (15%)

Query: 23  KVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAKGISQAP 82
           ++  GE + ++G NG GKTT +  ++G+   + G +        EW         ++  P
Sbjct: 364 EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKV--------EWDLT------VAYKP 409

Query: 83  EGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPR----LKERRKQLGWSLSG 138
           +  +     TV E LS    S       + ++  +T  L P     L +R  +    LSG
Sbjct: 410 QYIKAEYEGTVYELLSKIDSS------KLNSNFYKTELLKPLGIIDLYDRNVE---DLSG 460

Query: 139 GEQQMLAIGRALMARPKLLLLDEPS--LGLAPRLAEEVYERVKLISESGLTILVVEQNTV 196
           GE Q +AI   L+    + LLDEPS  L +  RLA     R  L+ ++  T LVVE + +
Sbjct: 461 GELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIR-HLMEKNEKTALVVEHDVL 519

Query: 197 LALSVADRAYVLE 209
           +   V+DR  V E
Sbjct: 520 MIDYVSDRLIVFE 532



 Score = 40.4 bits (93), Expect = 5e-06
 Identities = 24/73 (32%), Positives = 39/73 (53%)

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNT 195
           LSGGE Q +AI  AL+ +      DEPS  L  R   +V   ++ ++  G  +LVVE + 
Sbjct: 215 LSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDL 274

Query: 196 VLALSVADRAYVL 208
            +   ++D  +V+
Sbjct: 275 AVLDYLSDVIHVV 287


>1sgwA [c.37.1] PUTATIVE ABC TRANSPORTER
          Length = 200

 Score = 53.1 bits (126), Expect = 8e-10
 Identities = 51/190 (26%), Positives = 93/190 (48%), Gaps = 14/190 (7%)

Query: 2   LTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLE 61
           L   DL V + D   L+ +T+ +  G  V   G NG GKTTLL TIS   +   G+I   
Sbjct: 3   LEIRDLSVGY-DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYN 61

Query: 62  GVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENL-SLASVSWRRWGESIAADLDRTFE 120
           GV I+      +V   I   PE   +   ++VE+ L ++AS+   +  ++   D   + E
Sbjct: 62  GVPIT------KVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALESVE 115

Query: 121 LFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERV-K 179
           +     + +K+LG  LS G  + + +   L+   ++ +LD+P + +      +V + + +
Sbjct: 116 VL----DLKKKLG-ELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILE 170

Query: 180 LISESGLTIL 189
           ++ E G+ I+
Sbjct: 171 ILKEKGIVII 180


>2ghiD [x.x.x] TRANSPORT PROTEIN
          Length = 224

 Score = 53.1 bits (126), Expect = 8e-10
 Identities = 46/206 (22%), Positives = 100/206 (48%), Gaps = 16/206 (7%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +   + +G T AL+G  G+GK+T+   +     A  GDI++ G ++++++ +  +  
Sbjct: 21  LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNS-IRS 78

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSL 136
            I   P+   +F   T++ N+    +         A    + ++    L ++   +   L
Sbjct: 79  IIGIVPQDTILF-NETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTI--VL 135

Query: 137 SGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTV 196
           SGGE+Q +AI R L+  PK+++ D+          E ++++     E   T++++  + +
Sbjct: 136 SGGERQRIAIARCLLKDPKIVIFDDSK-------TEYLFQKA---VEDNRTLIII-AHRL 184

Query: 197 LALSVADRAYVLETGRIVLEGPASEL 222
             +S A+   +L  G+IV +G   +L
Sbjct: 185 STISSAESIILLNKGKIVEKGTHKDL 210


>2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 254

 Score = 53.1 bits (126), Expect = 8e-10
 Identities = 56/212 (26%), Positives = 94/212 (44%), Gaps = 21/212 (9%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ +  K+  G+ +A+ G+ GAGKT+LL  I G    S G I+  G              
Sbjct: 22  LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------------- 67

Query: 77  GISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRK----QL 132
            IS   +   I PG T++EN+ +  VS+  +         +  E   +  E+      + 
Sbjct: 68  RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 125

Query: 133 GWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           G +LS G+Q  +++ RA+     L LLD P   L     +E++E       +  T ++V 
Sbjct: 126 GITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV- 184

Query: 193 QNTVLALSVADRAYVLETGRIVLEGPASELKH 224
            + +  L  AD+  +L  G     G  SEL++
Sbjct: 185 TSKMEHLKKADKILILHEGSSYFYGTFSELQN 216


>2nq2D [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 248

 Score = 51.2 bits (121), Expect = 3e-09
 Identities = 46/200 (23%), Positives = 86/200 (43%), Gaps = 24/200 (12%)

Query: 16  ALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVA 75
           A Q +   +  G+ +A++G NG GK+TLL  + G++R   G I+              V 
Sbjct: 16  AFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIE--------------VY 61

Query: 76  KGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL------FPRLKERR 129
           + I   P+    F        L +  +       + A      +++      +  L    
Sbjct: 62  QSIGFVPQ---FFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLA 118

Query: 130 KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYE-RVKLISESGLTI 188
           K+   SLSGG++Q++ I RA+ +  KL+LLDEP+  L     + V    + L     +T+
Sbjct: 119 KREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTV 178

Query: 189 LVVEQNTVLALSVADRAYVL 208
           +         +++A++  +L
Sbjct: 179 VFTTHQPNQVVAIANKTLLL 198


>2nq2C [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 251

 Score = 49.7 bits (117), Expect = 9e-09
 Identities = 45/198 (22%), Positives = 85/198 (42%), Gaps = 24/198 (12%)

Query: 18  QGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAKG 77
           Q +   +  G+ +A++G NG GK+TLL  + G++R   G I+              V + 
Sbjct: 21  QQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIE--------------VYQS 66

Query: 78  ISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFEL------FPRLKERRKQ 131
           I   P+    F        L +  +       + A      +++      +  L    K+
Sbjct: 67  IGFVPQ---FFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKR 123

Query: 132 LGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYE-RVKLISESGLTILV 190
              SLSGG++Q++ I RA+ +  KL+LLDEP+  L     + V    + L     +T++ 
Sbjct: 124 EFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVF 183

Query: 191 VEQNTVLALSVADRAYVL 208
                   +++A++  +L
Sbjct: 184 TTHQPNQVVAIANKTLLL 201


>2ihyA [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 49.7 bits (117), Expect = 9e-09
 Identities = 48/155 (30%), Positives = 81/155 (52%), Gaps = 20/155 (12%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
           L+ ++ ++A G+   L G NGAGKTTLL+ ++    A+SG + L G       T R+   
Sbjct: 17  LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGYSAETVRQHIG 76

Query: 77  GISQA-----PEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQ 131
            +S +      EG R+     ++  +S A        + I  +  +  +L    K  ++ 
Sbjct: 77  FVSHSLLEKFQEGERV-----IDVVISGAI------DDEIRNEAHQLLKLVGSAK-AQQY 124

Query: 132 LGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGL 166
           +G+ LS GE+Q + I RAL  +P++L+LDEP+ GL
Sbjct: 125 IGY-LSTGEKQRV-IARAL-GQPQVLILDEPAAGL 156


>2ihyB [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 251

 Score = 49.3 bits (116), Expect = 1e-08
 Identities = 47/159 (29%), Positives = 85/159 (53%), Gaps = 16/159 (10%)

Query: 17  LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG----VSISEWSTDR 72
           L+ ++ ++A G+   L G NGAGKTTLL+ ++    A+SG + L G    V  S  +  +
Sbjct: 18  LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGKVGYSAETVRQ 77

Query: 73  RVA----KGISQAPEGRRIFPGLTVEENLSLASVS-WRRWGESIAADLDRTFELFPRLKE 127
            +       + +  EG R+   + V  + +  S+  ++   + I  +  +  +L    K 
Sbjct: 78  HIGFVSHSLLEKFQEGERV---IDVVISGAFKSIGVYQDIDDEIRNEAHQLLKLVGSAK- 133

Query: 128 RRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGL 166
            ++ +G+ LS GE+Q + I RAL  +P++L+LDEP+ GL
Sbjct: 134 AQQYIGY-LSTGEKQRV-IARAL-GQPQVLILDEPAAGL 169


>2qi9C [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
          Length = 240

 Score = 48.9 bits (115), Expect = 1e-08
 Identities = 62/223 (27%), Positives = 100/223 (44%), Gaps = 32/223 (14%)

Query: 23  KVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDR----RVAKGI 78
           +V  GE + L+G NGAGK+TLL   +    +  G IQ  G  +  WS  +    R     
Sbjct: 20  EVRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPLEAWSATKLALHRAYLSQ 76

Query: 79  SQAPE-GRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSLS 137
            Q P     ++  LT+ ++         +    +  D+     L  +L     Q    LS
Sbjct: 77  QQTPPFATPVWHYLTLHQH--------DKTRTELLNDVAGALALDDKLGRSTNQ----LS 124

Query: 138 GGEQQMLAIGRALM-----ARP--KLLLLDEP-SLGLAPRLAEEVYERVKLISESGLTIL 189
           GGE Q + +   ++     A P  +LLLLDEP SL +A + A +  + +  +S+ GL I 
Sbjct: 125 GGEWQRVRLAAVVLQITPQANPAGQLLLLDEPNSLDVAQQSALD--KILSALSQQGLAI- 181

Query: 190 VVEQNTVLALSVADRAYVLETGRIVLEGPASELKHNARVREAY 232
           V   +    L  A RA++L+ G++   G   E+     + +AY
Sbjct: 182 VSSHDLNHTLRHAHRAWLLKGGKLA-SGRREEVLTPPNLAQAY 223


>1l7vC [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
          Length = 224

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 61/223 (27%), Positives = 99/223 (44%), Gaps = 32/223 (14%)

Query: 23  KVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDR----RVAKGI 78
           +V  GE + L+G NGAGK+TLL   +    +  G IQ  G  +  WS  +    R     
Sbjct: 20  EVRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPLEAWSATKLALHRAYLSQ 76

Query: 79  SQAPE-GRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSLS 137
            Q P     ++  LT+ ++         +    +  D+     L  +L     Q    LS
Sbjct: 77  QQTPPFATPVWHYLTLHQH--------DKTRTELLNDVAGALALDDKLGRSTNQ----LS 124

Query: 138 GGEQQMLAIGRALM-----ARP--KLLLLDEP-SLGLAPRLAEEVYERVKLISESGLTIL 189
           GGE Q + +   ++     A P  +LLLLDEP SL +A + A +  + +  + + GL I 
Sbjct: 125 GGEWQRVRLAAVVLQITPQANPAGQLLLLDEPNSLDVAQQSALD--KILSALCQQGLAI- 181

Query: 190 VVEQNTVLALSVADRAYVLETGRIVLEGPASELKHNARVREAY 232
           V   +    L  A RA++L+ G++   G   E+     + +AY
Sbjct: 182 VSSHDLNHTLRHAHRAWLLKGGKLA-SGRREEVLTPPNLAQAY 223


>1yqtA [x.x.x] RNASE L INHIBITOR
          Length = 507

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 53/186 (28%), Positives = 82/186 (44%), Gaps = 29/186 (15%)

Query: 23  KVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAKGISQAP 82
           ++  GE + ++G NG GKTT +  ++G+   + G I        EW         ++  P
Sbjct: 284 EIKKGEVIGIVGPNGIGKTTFVK-LAGVEEPTEGKI--------EWDLT------VAYKP 328

Query: 83  EGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPR----LKERRKQLGWSLSG 138
           +  +     TV E LS    S       + ++  +T  L P     L +R       LSG
Sbjct: 329 QYIKADYEGTVYELLSKIDAS------KLNSNFYKTELLKPLGIIDLYDREVN---ELSG 379

Query: 139 GEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLA 198
           GE Q +AI   L+    + LLDEPS  L       V   ++ + ++  T LVVE + VL 
Sbjct: 380 GELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHD-VLI 438

Query: 199 LSVADR 204
             V+DR
Sbjct: 439 DYVSDR 444



 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 25/73 (34%), Positives = 38/73 (52%)

Query: 136 LSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNT 195
           LSGGE Q +AI  AL+        DEPS  L  R        ++ +SE G ++LVVE + 
Sbjct: 135 LSGGELQRVAIAAALLRNATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVEHDL 194

Query: 196 VLALSVADRAYVL 208
            +   ++D  +V+
Sbjct: 195 AVLDYLSDIIHVV 207


>2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
          Length = 230

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 50/219 (22%), Positives = 93/219 (42%), Gaps = 23/219 (10%)

Query: 10  AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           A  D   L G+T  +  G  VA++G  G GK++LL  +        G + ++G       
Sbjct: 13  ARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKG------- 65

Query: 70  TDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESI--AADLDRTFELFPRLKE 127
                   ++  P+   I    ++ EN+         +  S+  A  L    E+ P    
Sbjct: 66  -------SVAYVPQQAWI-QNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDR 117

Query: 128 RR-KQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERV---KLISE 183
               + G +LSGG++Q +++ RA+ +   + L D+P   +   + + ++E V   K + +
Sbjct: 118 TEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLK 177

Query: 184 SGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASEL 222
           +   ILV   +++  L   D   V+  G+I   G   EL
Sbjct: 178 NKTRILVT--HSMSYLPQVDVIIVMSGGKISEMGSYQEL 214


>1z2rA [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
          Length = 496

 Score = 43.9 bits (102), Expect = 5e-07
 Identities = 19/57 (33%), Positives = 36/57 (63%)

Query: 13  DILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           ++ AL+ + LK+  G+TVAL+G +G+GK+T+   I+       G I ++G  + E++
Sbjct: 289 EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYT 345


>3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
          Length = 572

 Score = 43.9 bits (102), Expect = 5e-07
 Identities = 19/57 (33%), Positives = 36/57 (63%)

Query: 13  DILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWS 69
           ++ AL+ + LK+  G+TVAL+G +G+GK+T+   I+       G I ++G  + E++
Sbjct: 346 EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYT 402


>2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 299

 Score = 43.9 bits (102), Expect = 5e-07
 Identities = 19/49 (38%), Positives = 31/49 (63%)

Query: 10 AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDI 58
          A G+++  + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+
Sbjct: 11 AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL 59



 Score = 41.2 bits (95), Expect = 3e-06
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 2/74 (2%)

Query: 151 MARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET 210
           M  P + LLDEP L  A R+   + E  +L    G T++ V  + V A+++AD+  VL+ 
Sbjct: 78  MVEPSVFLLDEP-LDAALRVQMRI-EISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA 135

Query: 211 GRIVLEGPASELKH 224
           GR+   G   EL H
Sbjct: 136 GRVAQVGKPLELYH 149


>2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 301

 Score = 43.9 bits (102), Expect = 5e-07
 Identities = 19/49 (38%), Positives = 31/49 (63%)

Query: 10 AHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDI 58
          A G+++  + + L +  GE V  +G +G GK+TLL  I+GL   +SGD+
Sbjct: 11 AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL 59



 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 151 MARPKLLLLDEPSLGLAPRLAEEV-YERVKLISESGLTILVVEQNTVLALSVADRAYVLE 209
           M  P + LLDEP   L   L  ++  E  +L    G T++ V  + V A+++AD+  VL+
Sbjct: 78  MVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD 137

Query: 210 TGRIVLEGPASELKH 224
            GR+   G   EL H
Sbjct: 138 AGRVAQVGKPLELYH 152


>2r6fB [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 864

 Score = 40.4 bits (93), Expect = 5e-06
 Identities = 43/157 (27%), Positives = 72/157 (45%), Gaps = 35/157 (22%)

Query: 108 GESIAADLDRT------FELFPRLKERRKQL------------GWSLSGGEQQMLAIGRA 149
           G++IA  LD        F   P++K + + L              +LSGGE Q + +   
Sbjct: 696 GKNIAEVLDTVEDALDFFASIPKIKRKLETLYDVGLGYKLGQPATTLSGGEAQRVKLAAE 755

Query: 150 LMARPK---LLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAY 206
           L  R     L +LDEP+ GL       + + +  + ++G T+LV+E N +  +  AD  Y
Sbjct: 756 LHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHN-LDVIKTAD--Y 812

Query: 207 VLET--------GRIVLEGPASELKHNARVREAYLGR 235
           +++         G+IV  G   E+   A V+E++ GR
Sbjct: 813 IIDLGPEGGDRGGQIVAVGTPEEV---AEVKESHTGR 846



 Score = 33.1 bits (74), Expect = 8e-04
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 7/105 (6%)

Query: 135 SLSGGEQQMLAIGRALMARPK--LLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           +LSGGE Q + +   + +R    L +LDEPS+GL  R  + +   +K   + G T++VVE
Sbjct: 406 TLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLK-SRDLGNTLIVVE 464

Query: 193 --QNTVLALSVAD--RAYVLETGRIVLEGPASELKHNARVREAYL 233
             ++T+ A  + D      +  G +V  G   E+     +   YL
Sbjct: 465 HDEDTLAADYLIDIGPGAGIHGGEVVAAGTPEEVNDPNSLTGQYL 509


>2r6fA [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 884

 Score = 40.4 bits (93), Expect = 5e-06
 Identities = 43/157 (27%), Positives = 72/157 (45%), Gaps = 35/157 (22%)

Query: 108 GESIAADLDRT------FELFPRLKERRKQL------------GWSLSGGEQQMLAIGRA 149
           G++IA  LD        F   P++K + + L              +LSGGE Q + +   
Sbjct: 716 GKNIAEVLDTVEDALDFFASIPKIKRKLETLYDVGLGYKLGQPATTLSGGEAQRVKLAAE 775

Query: 150 LMARPK---LLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAY 206
           L  R     L +LDEP+ GL       + + +  + ++G T+LV+E N +  +  AD  Y
Sbjct: 776 LHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHN-LDVIKTAD--Y 832

Query: 207 VLET--------GRIVLEGPASELKHNARVREAYLGR 235
           +++         G+IV  G   E+   A V+E++ GR
Sbjct: 833 IIDLGPEGGDRGGQIVAVGTPEEV---AEVKESHTGR 866



 Score = 33.1 bits (74), Expect = 8e-04
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 7/105 (6%)

Query: 135 SLSGGEQQMLAIGRALMARPK--LLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           +LSGGE Q + +   + +R    L +LDEPS+GL  R  + +   +K   + G T++VVE
Sbjct: 426 TLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLK-SRDLGNTLIVVE 484

Query: 193 --QNTVLALSVAD--RAYVLETGRIVLEGPASELKHNARVREAYL 233
             ++T+ A  + D      +  G +V  G   E+     +   YL
Sbjct: 485 HDEDTLAADYLIDIGPGAGIHGGEVVAAGTPEEVNDPNSLTGQYL 529


>2vf8B [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 835

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 20/131 (15%)

Query: 113 ADLDRTFELFPRLKE------RRKQLGWSLSGGEQQMLAIGRALMARPK---LLLLDEPS 163
           AD    F     L+E      R  Q    LSGGE Q + +   L    +   + +LDEP+
Sbjct: 695 ADESAIFRALDTLREVGLGYLRLGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPT 754

Query: 164 LGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET--------GRIVL 215
            GL P   E +  ++  + ++G T++ VE    +   VA   +VL+         GR+V 
Sbjct: 755 TGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDIGPGAGEDGGRLVA 811

Query: 216 EGPASELKHNA 226
           +G  +E+   A
Sbjct: 812 QGTPAEVAQAA 822



 Score = 36.6 bits (83), Expect = 8e-05
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 15/101 (14%)

Query: 135 SLSGGEQQMLAIGRALMAR--PKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           +LS GE Q L +   L +     + +LDEPS GL P   E +   ++ +   G ++ VVE
Sbjct: 372 TLSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVE 431

Query: 193 QNTVLALSVADRAYVL---------ETGRIVLEGPASELKH 224
            +    L V  RA  L         + G I+  GP   LKH
Sbjct: 432 HD----LDVIRRADWLVDVGPEAGEKGGEILYSGPPEGLKH 468


>2vf8A [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 806

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 20/131 (15%)

Query: 113 ADLDRTFELFPRLKE------RRKQLGWSLSGGEQQMLAIGRALMARPK---LLLLDEPS 163
           AD    F     L+E      R  Q    LSGGE Q + +   L    +   + +LDEP+
Sbjct: 666 ADESAIFRALDTLREVGLGYLRLGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPT 725

Query: 164 LGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET--------GRIVL 215
            GL P   E +  ++  + ++G T++ VE    +   VA   +VL+         GR+V 
Sbjct: 726 TGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDIGPGAGEDGGRLVA 782

Query: 216 EGPASELKHNA 226
           +G  +E+   A
Sbjct: 783 QGTPAEVAQAA 793



 Score = 36.6 bits (83), Expect = 8e-05
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 15/101 (14%)

Query: 135 SLSGGEQQMLAIGRALMAR--PKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           +LS GE Q L +   L +     + +LDEPS GL P   E +   ++ +   G ++ VVE
Sbjct: 368 TLSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVE 427

Query: 193 QNTVLALSVADRAYVL---------ETGRIVLEGPASELKH 224
            +    L V  RA  L         + G I+  GP   LKH
Sbjct: 428 HD----LDVIRRADWLVDVGPEAGEKGGEILYSGPPEGLKH 464


>2vf7C [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 814

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 20/131 (15%)

Query: 113 ADLDRTFELFPRLKE------RRKQLGWSLSGGEQQMLAIGRALMARPK---LLLLDEPS 163
           AD    F     L+E      R  Q    LSGGE Q + +   L    +   + +LDEP+
Sbjct: 674 ADESAIFRALDTLREVGLGYLRLGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPT 733

Query: 164 LGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET--------GRIVL 215
            GL P   E +  ++  + ++G T++ VE    +   VA   +VL+         GR+V 
Sbjct: 734 TGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDIGPGAGEDGGRLVA 790

Query: 216 EGPASELKHNA 226
           +G  +E+   A
Sbjct: 791 QGTPAEVAQAA 801



 Score = 36.6 bits (83), Expect = 8e-05
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 15/101 (14%)

Query: 135 SLSGGEQQMLAIGRALMAR--PKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           +LS GE Q L +   L +     + +LDEPS GL P   E +   ++ +   G ++ VVE
Sbjct: 370 TLSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVE 429

Query: 193 QNTVLALSVADRAYVL---------ETGRIVLEGPASELKH 224
            +    L V  RA  L         + G I+  GP   LKH
Sbjct: 430 HD----LDVIRRADWLVDVGPEAGEKGGEILYSGPPEGLKH 466


>2vf7B [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 813

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 20/131 (15%)

Query: 113 ADLDRTFELFPRLKE------RRKQLGWSLSGGEQQMLAIGRALMARPK---LLLLDEPS 163
           AD    F     L+E      R  Q    LSGGE Q + +   L    +   + +LDEP+
Sbjct: 673 ADESAIFRALDTLREVGLGYLRLGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPT 732

Query: 164 LGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET--------GRIVL 215
            GL P   E +  ++  + ++G T++ VE    +   VA   +VL+         GR+V 
Sbjct: 733 TGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDIGPGAGEDGGRLVA 789

Query: 216 EGPASELKHNA 226
           +G  +E+   A
Sbjct: 790 QGTPAEVAQAA 800



 Score = 36.6 bits (83), Expect = 8e-05
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 15/101 (14%)

Query: 135 SLSGGEQQMLAIGRALMAR--PKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           +LS GE Q L +   L +     + +LDEPS GL P   E +   ++ +   G ++ VVE
Sbjct: 372 TLSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVE 431

Query: 193 QNTVLALSVADRAYVL---------ETGRIVLEGPASELKH 224
            +    L V  RA  L         + G I+  GP   LKH
Sbjct: 432 HD----LDVIRRADWLVDVGPEAGEKGGEILYSGPPEGLKH 468


>2vf7A [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 815

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 20/131 (15%)

Query: 113 ADLDRTFELFPRLKE------RRKQLGWSLSGGEQQMLAIGRALMARPK---LLLLDEPS 163
           AD    F     L+E      R  Q    LSGGE Q + +   L    +   + +LDEP+
Sbjct: 675 ADESAIFRALDTLREVGLGYLRLGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPT 734

Query: 164 LGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET--------GRIVL 215
            GL P   E +  ++  + ++G T++ VE    +   VA   +VL+         GR+V 
Sbjct: 735 TGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDIGPGAGEDGGRLVA 791

Query: 216 EGPASELKHNA 226
           +G  +E+   A
Sbjct: 792 QGTPAEVAQAA 802



 Score = 36.6 bits (83), Expect = 8e-05
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 15/101 (14%)

Query: 135 SLSGGEQQMLAIGRALMAR--PKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVE 192
           +LS GE Q L +   L +     + +LDEPS GL P   E +   ++ +   G ++ VVE
Sbjct: 369 TLSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVE 428

Query: 193 QNTVLALSVADRAYVL---------ETGRIVLEGPASELKH 224
            +    L V  RA  L         + G I+  GP   LKH
Sbjct: 429 HD----LDVIRRADWLVDVGPEAGEKGGEILYSGPPEGLKH 465


>2ix3A [x.x.x] ELONGATION FACTOR 3
          Length = 972

 Score = 38.5 bits (88), Expect = 2e-05
 Identities = 45/206 (21%), Positives = 81/206 (39%), Gaps = 35/206 (16%)

Query: 4   CN-DLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG 62
           CN +  +A+G  + L    L++       + G NG GK+TL+  I+        + Q++G
Sbjct: 431 CNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA--------NGQVDG 482

Query: 63  VSISEWSTDRRVAKGISQAPEGRRIFP-----GLTVEENLSLASVSWRRWGESIAADLDR 117
               E      V   I        +       G+  +E +    + +    E IA  +  
Sbjct: 483 FPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEMIAMPIS- 541

Query: 118 TFELFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYER 177
                            +LSGG +  LA+ RA++    +LLLDEP+  L       V   
Sbjct: 542 -----------------ALSGGWKMKLALARAVLRNADILLLDEPTNHLD---TVNVAWL 581

Query: 178 VKLISESGLTILVVEQNTVLALSVAD 203
           V  ++  G+T + +  ++V   +V +
Sbjct: 582 VNYLNTCGITSITISHDSVFLDNVCE 607



 Score = 33.5 bits (75), Expect = 6e-04
 Identities = 13/39 (33%), Positives = 26/39 (66%)

Query: 20  VTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDI 58
           +  + +    +A+IG NGAGK+TL++ ++G    +SG++
Sbjct: 686 INFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 724


>2iwhB [x.x.x] ELONGATION FACTOR 3A
          Length = 980

 Score = 38.5 bits (88), Expect = 2e-05
 Identities = 45/206 (21%), Positives = 81/206 (39%), Gaps = 35/206 (16%)

Query: 4   CN-DLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEG 62
           CN +  +A+G  + L    L++       + G NG GK+TL+  I+        + Q++G
Sbjct: 435 CNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA--------NGQVDG 486

Query: 63  VSISEWSTDRRVAKGISQAPEGRRIFP-----GLTVEENLSLASVSWRRWGESIAADLDR 117
               E      V   I        +       G+  +E +    + +    E IA  +  
Sbjct: 487 FPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEMIAMPIS- 545

Query: 118 TFELFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYER 177
                            +LSGG +  LA+ RA++    +LLLDEP+  L       V   
Sbjct: 546 -----------------ALSGGWKMKLALARAVLRNADILLLDEPTNHLD---TVNVAWL 585

Query: 178 VKLISESGLTILVVEQNTVLALSVAD 203
           V  ++  G+T + +  ++V   +V +
Sbjct: 586 VNYLNTCGITSITISHDSVFLDNVCE 611



 Score = 33.5 bits (75), Expect = 6e-04
 Identities = 13/39 (33%), Positives = 26/39 (66%)

Query: 20  VTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDI 58
           +  + +    +A+IG NGAGK+TL++ ++G    +SG++
Sbjct: 690 INFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 728


>2fa9A [x.x.x] GTP-BINDING PROTEIN SAR1B
          Length = 169

 Score = 33.9 bits (76), Expect = 5e-04
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 17 LQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWSTDRRVAK 76
          LQ + L   TG+ V L G + AGKTTLLH +    + +S ++ + G++ + +   RRV K
Sbjct: 4  LQFLGLYKKTGKLVFL-GLDNAGKTTLLHML----KPTSEELTIAGMTFTTFDLGRRVWK 58

Query: 77 GISQAPEG 84
              A  G
Sbjct: 59 NYLPAING 66


>2ix8A [x.x.x] ELONGATION FACTOR 3A
          Length = 953

 Score = 33.5 bits (75), Expect = 6e-04
 Identities = 13/39 (33%), Positives = 26/39 (66%)

Query: 20  VTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDI 58
           +  + +    +A+IG NGAGK+TL++ ++G    +SG++
Sbjct: 673 INFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 711


>2iw3B [x.x.x] ELONGATION FACTOR 3A
          Length = 958

 Score = 33.5 bits (75), Expect = 6e-04
 Identities = 13/39 (33%), Positives = 26/39 (66%)

Query: 20  VTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDI 58
           +  + +    +A+IG NGAGK+TL++ ++G    +SG++
Sbjct: 677 INFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 715


>2iw3A [x.x.x] ELONGATION FACTOR 3A
          Length = 950

 Score = 33.5 bits (75), Expect = 6e-04
 Identities = 13/39 (33%), Positives = 26/39 (66%)

Query: 20  VTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDI 58
           +  + +    +A+IG NGAGK+TL++ ++G    +SG++
Sbjct: 673 INFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 711


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.325    0.138    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 864,146,812
Number of extensions: 33371670
Number of successful extensions: 85548
Number of sequences better than 1.0e-03: 1717
Number of HSP's gapped: 83481
Number of HSP's successfully gapped: 2482
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)