BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE40040.1 rpal2 ABE40040.1 GIB00345CH01 "Pyruvate
dehydrogenase (lipoamide)"
         (344 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3exeE [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             305   2e-85
3exeC [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             305   2e-85
3exeA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             305   2e-85
2ozlA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT ALPHA               303   5e-85
3exfC [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             303   5e-85
3exfA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             303   5e-85
3exhC [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             297   4e-83
3exhA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             294   3e-82
3exgE [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             269   1e-74
3exgW [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             268   2e-74
3exgG [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             268   2e-74
3exgU [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             267   3e-74
3exgK [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             265   1e-73
3exgI [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             264   3e-73
3exgA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             262   1e-72
3exg3 [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             261   2e-72
3exgS [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             259   6e-72
1ni4A [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA             252   1e-69
3exg1 [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             250   4e-69
3exgO [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             243   8e-67
3exhE [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             240   4e-66
3exiA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             232   1e-63
1umdC [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT                 125   2e-31
1umdA [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT                 125   2e-31
2bffA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT            120   8e-30
1u5bA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           119   2e-29
1wciA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT            118   3e-29
1olxA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           118   3e-29
2beuA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT            118   3e-29
1olsA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           117   4e-29
1x7zA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           117   5e-29
1dtwA [c.36.1] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE           116   1e-28
2j9fA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT            115   2e-28
1w85G [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA             111   3e-27
1w85C [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA             111   3e-27
3dvaA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             110   5e-27
1v1mA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           108   3e-26
2bfeA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT            106   9e-26
2bfbA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT            106   1e-25
1x7xA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           105   2e-25
1x7wA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           105   2e-25
1w85A [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA             105   2e-25
1v16A [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           105   2e-25
1oluA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           105   2e-25
2bfdA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT            104   4e-25
2bfcA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT            103   6e-25
1um9C [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT                 103   7e-25
1v11A [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT           103   1e-24
3dvaE [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             103   1e-24
1um9A [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT                 102   1e-24
3dv0C [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT             100   5e-24
3dv0G [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT              99   2e-23
3dv0A [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT              98   3e-23
3dv0E [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT              97   5e-23
1w88A [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA              96   1e-22
1w88C [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA              96   2e-22
1w85E [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA              91   4e-21
1v1rA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT            91   7e-21
2bp7A [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT             90   9e-21
1w88G [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA              82   2e-18
1w88E [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA              71   4e-15
1qs0A [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA-SUBUNIT            69   2e-14

>3exeE [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 361

 Score =  305 bits (780), Expect = 2e-85
 Identities = 171/327 (52%), Positives = 224/327 (68%), Gaps = 8/327 (2%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 20  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 77

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 78  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 135

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 136 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 195

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NRY MGTSV R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 196 NRYGMGTSVERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 253

Query: 259 EMQTYRYRGHSMSDP-AKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEV 316
           E+QTYRY GHSMSDP   YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EV
Sbjct: 254 ELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEV 313

Query: 317 RKIVNEAADFAQNDPEPDPSELYTDVY 343
           RK + +AA FA  DPEP   EL   +Y
Sbjct: 314 RKEIEDAAQFATADPEPPLEELGYHIY 340


>3exeC [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 362

 Score =  305 bits (780), Expect = 2e-85
 Identities = 171/327 (52%), Positives = 224/327 (68%), Gaps = 8/327 (2%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NRY MGTSV R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NRYGMGTSVERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 254

Query: 259 EMQTYRYRGHSMSDP-AKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEV 316
           E+QTYRY GHSMSDP   YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EV
Sbjct: 255 ELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEV 314

Query: 317 RKIVNEAADFAQNDPEPDPSELYTDVY 343
           RK + +AA FA  DPEP   EL   +Y
Sbjct: 315 RKEIEDAAQFATADPEPPLEELGYHIY 341


>3exeA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 363

 Score =  305 bits (780), Expect = 2e-85
 Identities = 171/327 (52%), Positives = 224/327 (68%), Gaps = 8/327 (2%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 22  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 79

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 80  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 137

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 138 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 197

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NRY MGTSV R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 198 NRYGMGTSVERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 255

Query: 259 EMQTYRYRGHSMSDP-AKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEV 316
           E+QTYRY GHSMSDP   YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EV
Sbjct: 256 ELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEV 315

Query: 317 RKIVNEAADFAQNDPEPDPSELYTDVY 343
           RK + +AA FA  DPEP   EL   +Y
Sbjct: 316 RKEIEDAAQFATADPEPPLEELGYHIY 342


>2ozlA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT ALPHA
          Length = 362

 Score =  303 bits (776), Expect = 5e-85
 Identities = 170/327 (51%), Positives = 223/327 (68%), Gaps = 8/327 (2%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NRY MGTSV R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NRYGMGTSVERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 254

Query: 259 EMQTYRYRGHSMSDP-AKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEV 316
           E+QTYRY GH MSDP   YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EV
Sbjct: 255 ELQTYRYHGHEMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEV 314

Query: 317 RKIVNEAADFAQNDPEPDPSELYTDVY 343
           RK + +AA FA  DPEP   EL   +Y
Sbjct: 315 RKEIEDAAQFATADPEPPLEELGYHIY 341


>3exfC [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 363

 Score =  303 bits (776), Expect = 5e-85
 Identities = 170/327 (51%), Positives = 224/327 (68%), Gaps = 8/327 (2%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 22  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 79

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 80  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 137

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 138 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 197

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NRY MGT+V R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 198 NRYGMGTAVERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 255

Query: 259 EMQTYRYRGHSMSDP-AKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEV 316
           E+QTYRY GHSMSDP   YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EV
Sbjct: 256 ELQTYRYHGHSMSDPGVAYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEV 315

Query: 317 RKIVNEAADFAQNDPEPDPSELYTDVY 343
           RK + +AA FA  DPEP   EL   +Y
Sbjct: 316 RKEIEDAAQFATADPEPPLEELGYHIY 342


>3exfA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 362

 Score =  303 bits (776), Expect = 5e-85
 Identities = 170/327 (51%), Positives = 224/327 (68%), Gaps = 8/327 (2%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NRY MGT+V R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NRYGMGTAVERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 254

Query: 259 EMQTYRYRGHSMSDP-AKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEV 316
           E+QTYRY GHSMSDP   YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EV
Sbjct: 255 ELQTYRYHGHSMSDPGVAYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEV 314

Query: 317 RKIVNEAADFAQNDPEPDPSELYTDVY 343
           RK + +AA FA  DPEP   EL   +Y
Sbjct: 315 RKEIEDAAQFATADPEPPLEELGYHIY 341


>3exhC [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 361

 Score =  297 bits (760), Expect = 4e-83
 Identities = 169/327 (51%), Positives = 223/327 (68%), Gaps = 9/327 (2%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NRY MGT+V R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NRYGMGTAVERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 254

Query: 259 EMQTYRYRGHSMSDP-AKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEV 316
           E+QTYRY GH MSDP   YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EV
Sbjct: 255 ELQTYRYHGH-MSDPGVAYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEV 313

Query: 317 RKIVNEAADFAQNDPEPDPSELYTDVY 343
           RK + +AA FA  DPEP   EL   +Y
Sbjct: 314 RKEIEDAAQFATADPEPPLEELGYHIY 340


>3exhA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 359

 Score =  294 bits (752), Expect = 3e-82
 Identities = 168/327 (51%), Positives = 221/327 (67%), Gaps = 11/327 (3%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NRY MG    R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NRYGMG---ERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 251

Query: 259 EMQTYRYRGHSMSDP-AKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEV 316
           E+QTYRY GHSMSDP   YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EV
Sbjct: 252 ELQTYRYHGHSMSDPGVAYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEV 311

Query: 317 RKIVNEAADFAQNDPEPDPSELYTDVY 343
           RK + +AA FA  DPEP   EL   +Y
Sbjct: 312 RKEIEDAAQFATADPEPPLEELGYHIY 338


>3exgE [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 349

 Score =  269 bits (687), Expect = 1e-74
 Identities = 160/327 (48%), Positives = 213/327 (65%), Gaps = 21/327 (6%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR        R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NR--------RAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 246

Query: 259 EMQTYRYRGHSMSDP-AKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEV 316
           E+QTYRY      DP   YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EV
Sbjct: 247 ELQTYRYH-----DPGVAYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEV 301

Query: 317 RKIVNEAADFAQNDPEPDPSELYTDVY 343
           RK + +AA FA  DPEP   EL   +Y
Sbjct: 302 RKEIEDAAQFATADPEPPLEELGYHIY 328


>3exgW [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 345

 Score =  268 bits (684), Expect = 2e-74
 Identities = 158/326 (48%), Positives = 211/326 (64%), Gaps = 23/326 (7%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR        R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NR--------RAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 246

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTYRY          YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 247 ELQTYRYHA--------YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 298

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 299 KEIEDAAQFATADPEPPLEELGYHIY 324


>3exgG [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 346

 Score =  268 bits (684), Expect = 2e-74
 Identities = 158/326 (48%), Positives = 211/326 (64%), Gaps = 22/326 (6%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR        R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NR--------RAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 246

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTYRY          YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 247 ELQTYRYH-------VAYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 299

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 300 KEIEDAAQFATADPEPPLEELGYHIY 325


>3exgU [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 348

 Score =  267 bits (683), Expect = 3e-74
 Identities = 158/326 (48%), Positives = 211/326 (64%), Gaps = 20/326 (6%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR        R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NR--------RAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 246

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTYRY          YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 247 ELQTYRYH-----PGVAYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 301

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 302 KEIEDAAQFATADPEPPLEELGYHIY 327


>3exgK [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 347

 Score =  265 bits (677), Expect = 1e-73
 Identities = 157/326 (48%), Positives = 210/326 (64%), Gaps = 21/326 (6%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           N         R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 N---------RAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 245

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTYRY          YRTREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 246 ELQTYRYH-----PGVAYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 300

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 301 KEIEDAAQFATADPEPPLEELGYHIY 326


>3exgI [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 344

 Score =  264 bits (674), Expect = 3e-73
 Identities = 157/326 (48%), Positives = 210/326 (64%), Gaps = 24/326 (7%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR      V R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NR------VERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 248

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTYR           Y TREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 249 ELQTYR-----------YHTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 297

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 298 KEIEDAAQFATADPEPPLEELGYHIY 323


>3exgA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 342

 Score =  262 bits (669), Expect = 1e-72
 Identities = 156/326 (47%), Positives = 209/326 (64%), Gaps = 26/326 (7%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR        R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NR--------RAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 246

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTYR           Y TREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 247 ELQTYR-----------YHTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 295

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 296 KEIEDAAQFATADPEPPLEELGYHIY 321


>3exg3 [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 342

 Score =  261 bits (668), Expect = 2e-72
 Identities = 156/326 (47%), Positives = 209/326 (64%), Gaps = 26/326 (7%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR        R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NR-------ERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 247

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTYRY            TREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 248 ELQTYRY------------TREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 295

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 296 KEIEDAAQFATADPEPPLEELGYHIY 321


>3exgS [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 340

 Score =  259 bits (663), Expect = 6e-72
 Identities = 155/326 (47%), Positives = 208/326 (63%), Gaps = 27/326 (8%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 20  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 77

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 78  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 135

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 136 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 195

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           N         R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 196 N---------RAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 244

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTYR           Y TREE+ ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 245 ELQTYR-----------YHTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 293

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 294 KEIEDAAQFATADPEPPLEELGYHIY 319


>1ni4A [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
          Length = 350

 Score =  252 bits (644), Expect = 1e-69
 Identities = 160/325 (49%), Positives = 209/325 (64%), Gaps = 16/325 (4%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R  +   R E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRQTV---RRELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 75

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT              +     K+FYGG+
Sbjct: 76  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSHYA----KNFYGGN 131

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++N A LWKLP +++ EN
Sbjct: 132 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYN-AALWKLPCIFICEN 190

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NRY  GTSV R++A TD+ KRG    IPG +VDG D+  V+ A   A A+CR+G GP IL
Sbjct: 191 NRYG-GTSVERAAASTDYYKRGDF--IPGLRVDG-DILCVREATRFAAAYCRSGKGP-IL 245

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRK 318
           E+QTYRY GHS      YRTREE+ ++R+  DPI  ++ R+  +  + ++LK+ID EVRK
Sbjct: 246 ELQTYRYHGHSSDPGVSYRTREEIQEVRSKSDPI-LLKDRVNSNLASVEELKEIDVEVRK 304

Query: 319 IVNEAADFAQNDPEPDPSELYTDVY 343
            + +AA FA  DPEP   EL   +Y
Sbjct: 305 EIEDAAQFATADPEPPLEELGYHIY 329


>3exg1 [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 335

 Score =  250 bits (639), Expect = 4e-69
 Identities = 152/326 (46%), Positives = 204/326 (62%), Gaps = 33/326 (10%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR        R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NR--------RAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 246

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTYRY                  ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 247 ELQTYRY------------------EVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 288

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 289 KEIEDAAQFATADPEPPLEELGYHIY 314


>3exgO [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 332

 Score =  243 bits (619), Expect = 8e-67
 Identities = 149/326 (45%), Positives = 201/326 (61%), Gaps = 36/326 (11%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           N         R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 N---------RAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 245

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTY                    ++R+  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 246 ELQTY--------------------EVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 285

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 286 KEIEDAAQFATADPEPPLEELGYHIY 311


>3exhE [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 331

 Score =  240 bits (613), Expect = 4e-66
 Identities = 149/326 (45%), Positives = 199/326 (61%), Gaps = 37/326 (11%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 21  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 78

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT YR HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 79  GINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 136

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 137 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 196

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR        R++A TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 197 NR-------ERAAASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 247

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTY                       +  DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 248 ELQTY-----------------------SKSDPIMLLKDRMVNSNLASVEELKEIDVEVR 284

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 285 KEIEDAAQFATADPEPPLEELGYHIY 310


>3exiA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 332

 Score =  232 bits (591), Expect = 1e-63
 Identities = 146/326 (44%), Positives = 194/326 (59%), Gaps = 45/326 (13%)

Query: 19  GPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQM 78
           GP  + V   T+E  L  +R M  +RR E KA QLY    I GFCHL  GQEA  VG++ 
Sbjct: 30  GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEA 87

Query: 79  ALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGH 138
            +   D +IT +R HG      +  + ++AELT             MHM++  K+FYGG+
Sbjct: 88  GINPTDHLITAFRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGN 145

Query: 139 GIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIEN 198
           GIVGAQV LG GIA A +Y     VCL  +GDGA+NQGQ++E++NMA LWKLP +++ EN
Sbjct: 146 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICEN 205

Query: 199 NRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYIL 258
           NR             TD+ KRG    IPG +VDGMD+  V+ A   A A+CR+G GP ++
Sbjct: 206 NR-------------TDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILM 250

Query: 259 EMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTE-DDLKKIDAEVR 317
           E+QTY                          DPI  ++ R++ S++   ++LK+ID EVR
Sbjct: 251 ELQTY-------------------------SDPIMLLKDRMVNSNLASVEELKEIDVEVR 285

Query: 318 KIVNEAADFAQNDPEPDPSELYTDVY 343
           K + +AA FA  DPEP   EL   +Y
Sbjct: 286 KEIEDAAQFATADPEPPLEELGYHIY 311


>1umdC [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
          Length = 361

 Score =  125 bits (313), Expect = 2e-31
 Identities = 87/275 (31%), Positives = 128/275 (46%), Gaps = 4/275 (1%)

Query: 27  DFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREG-DQ 85
           D   E+    +RDML  R  +E+   L   G    F     G EA  V +  A+R G D 
Sbjct: 27  DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHEAAQVAIAHAIRPGFDW 85

Query: 86  VITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQV 145
           V   YRDHG  LA  +  K ++ ++               H  S   +F+     + + V
Sbjct: 86  VFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASPIASHV 145

Query: 146 SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGT 205
               G A + +    G V +  FGDGA+++G  Y   N A +   P V++ ENN YA+  
Sbjct: 146 PPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFYAISV 205

Query: 206 SVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRY 265
                +     + +  +F IPG  VDGMDV A      +AV   R G GP ++E++ YRY
Sbjct: 206 DYRHQTHSPTIADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRY 265

Query: 266 RGHSMS-DPAKYRTREEVDKIRNDQDPIEQVRQRL 299
             HS + D ++YR +EEV   R  +DPI + R+ L
Sbjct: 266 GPHSSADDDSRYRPKEEVAFWRK-KDPIPRFRRFL 299


>1umdA [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
          Length = 362

 Score =  125 bits (313), Expect = 2e-31
 Identities = 87/275 (31%), Positives = 128/275 (46%), Gaps = 4/275 (1%)

Query: 27  DFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREG-DQ 85
           D   E+    +RDML  R  +E+   L   G    F     G EA  V +  A+R G D 
Sbjct: 27  DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHEAAQVAIAHAIRPGFDW 85

Query: 86  VITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQV 145
           V   YRDHG  LA  +  K ++ ++               H  S   +F+     + + V
Sbjct: 86  VFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASPIASHV 145

Query: 146 SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGT 205
               G A + +    G V +  FGDGA+++G  Y   N A +   P V++ ENN YA+  
Sbjct: 146 PPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFYAISV 205

Query: 206 SVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRY 265
                +     + +  +F IPG  VDGMDV A      +AV   R G GP ++E++ YRY
Sbjct: 206 DYRHQTHSPTIADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRY 265

Query: 266 RGHSMS-DPAKYRTREEVDKIRNDQDPIEQVRQRL 299
             HS + D ++YR +EEV   R  +DPI + R+ L
Sbjct: 266 GPHSSADDDSRYRPKEEVAFWRK-KDPIPRFRRFL 299


>2bffA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 392

 Score =  120 bits (300), Expect = 8e-30
 Identities = 88/324 (27%), Positives = 143/324 (44%), Gaps = 6/324 (1%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAK-YRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIV 320
           YR   HS SD +  YR   EV        PI ++R  LL     +++ +K    + R+ V
Sbjct: 281 YRIGHHSTSDDSSAYR---EVGYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKV 337

Query: 321 NEAADFAQNDPEPDPSELYTDVYR 344
            EA + A+  P+P+P+ L++DVY+
Sbjct: 338 MEAFEQAERKPKPNPNLLFSDVYQ 361


>1u5bA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 391

 Score =  119 bits (297), Expect = 2e-29
 Identities = 86/323 (26%), Positives = 141/323 (43%), Gaps = 5/323 (1%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR   HS SD +        DK      PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRIGHHSTSDDSSAYRVNYWDK---QDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 337

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 338 EAFEQAERKPKPNPNLLFSDVYQ 360


>1wciA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 388

 Score =  118 bits (295), Expect = 3e-29
 Identities = 85/323 (26%), Positives = 142/323 (43%), Gaps = 8/323 (2%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR   HS SD +     ++ D       PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRIGHHSTSDDSSAYRWDKQD------HPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 334

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 335 EAFEQAERKPKPNPNLLFSDVYQ 357


>1olxA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 391

 Score =  118 bits (295), Expect = 3e-29
 Identities = 87/323 (26%), Positives = 142/323 (43%), Gaps = 6/323 (1%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 43  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 101

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 102 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 161

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 162 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 221

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 222 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 281

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR   HS SD +    R   DK      PI ++R  LL     +++ +K    + R+ V 
Sbjct: 282 YRIGHHSTSDDSS-AYRNYWDK---QDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 337

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 338 EAFEQAERKPKPNPNLLFSDVYQ 360


>2beuA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 390

 Score =  118 bits (295), Expect = 3e-29
 Identities = 87/323 (26%), Positives = 142/323 (43%), Gaps = 6/323 (1%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR   HS SD +    R   DK      PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRIGHHSTSDDSS-AYRNYWDK---QDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 336

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 337 EAFEQAERKPKPNPNLLFSDVYQ 359


>1olsA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 386

 Score =  117 bits (294), Expect = 4e-29
 Identities = 86/323 (26%), Positives = 143/323 (44%), Gaps = 10/323 (3%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR   H  SD + YR  ++ D       PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRIGHH--SDDSSYRYWDKQD------HPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 332

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 333 EAFEQAERKPKPNPNLLFSDVYQ 355


>1x7zA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 391

 Score =  117 bits (293), Expect = 5e-29
 Identities = 85/323 (26%), Positives = 140/323 (43%), Gaps = 5/323 (1%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR   H  SD +        DK      PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRIGHHDTSDDSSAYRVNYWDK---QDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 337

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 338 EAFEQAERKPKPNPNLLFSDVYQ 360


>1dtwA [c.36.1] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
          Length = 382

 Score =  116 bits (290), Expect = 1e-28
 Identities = 86/324 (26%), Positives = 141/324 (43%), Gaps = 15/324 (4%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 41  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 99

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 100 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 159

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 160 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 219

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 220 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 279

Query: 263 YRYRGHSMSDPAK-YRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIV 320
           YR   HS SD +  YR             PI ++R  LL     +++ +K    + R+ V
Sbjct: 280 YRIGHHSTSDDSSAYR------------HPISRLRHYLLSQGWWDEEQEKAWRKQSRRKV 327

Query: 321 NEAADFAQNDPEPDPSELYTDVYR 344
            EA + A+  P+P+P+ L++DVY+
Sbjct: 328 MEAFEQAERKPKPNPNLLFSDVYQ 351


>2j9fA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 383

 Score =  115 bits (288), Expect = 2e-28
 Identities = 86/323 (26%), Positives = 140/323 (43%), Gaps = 13/323 (4%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR   HS SD          D    D  PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRIGHHSTSD----------DSSAYDH-PISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 329

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 330 EAFEQAERKPKPNPNLLFSDVYQ 352


>1w85G [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
          Length = 364

 Score =  111 bits (278), Expect = 3e-27
 Identities = 81/288 (28%), Positives = 130/288 (45%), Gaps = 35/288 (12%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 34  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 92

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 93  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 132

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 133 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 192

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A+ T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 193 FVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 252

Query: 254 GPYILEMQTYRYRGHSMS--DPAKYRTREEVDKIRNDQDPIEQVRQRL 299
           GP ++E   +RY  H+MS  DP +YR++ E++     +DP+ + R+ L
Sbjct: 253 GPTLIETLCFRYGPHTMSGDDPTRYRSK-ELENEWAKKDPLVRFRKFL 299


>1w85C [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
          Length = 365

 Score =  111 bits (278), Expect = 3e-27
 Identities = 81/288 (28%), Positives = 130/288 (45%), Gaps = 35/288 (12%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 35  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 93

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 94  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 133

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 134 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 193

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A+ T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 194 FVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 253

Query: 254 GPYILEMQTYRYRGHSMS--DPAKYRTREEVDKIRNDQDPIEQVRQRL 299
           GP ++E   +RY  H+MS  DP +YR++ E++     +DP+ + R+ L
Sbjct: 254 GPTLIETLCFRYGPHTMSGDDPTRYRSK-ELENEWAKKDPLVRFRKFL 300


>3dvaA [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 365

 Score =  110 bits (276), Expect = 5e-27
 Identities = 81/288 (28%), Positives = 129/288 (44%), Gaps = 35/288 (12%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 35  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 93

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 94  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 133

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 134 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 193

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A  T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 194 FVVQNNRFAASTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 253

Query: 254 GPYILEMQTYRYRGHSMS--DPAKYRTREEVDKIRNDQDPIEQVRQRL 299
           GP ++E   +RY  H+MS  DP +YR++ E++     +DP+ + R+ L
Sbjct: 254 GPTLIETLCFRYGPHTMSGDDPTRYRSK-ELENEWAKKDPLVRFRKFL 300


>1v1mA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 372

 Score =  108 bits (269), Expect = 3e-26
 Identities = 81/323 (25%), Positives = 135/323 (41%), Gaps = 24/323 (7%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR   H                      PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRIGDH----------------------PISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 318

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 319 EAFEQAERKPKPNPNLLFSDVYQ 341


>2bfeA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 375

 Score =  106 bits (265), Expect = 9e-26
 Identities = 82/323 (25%), Positives = 136/323 (42%), Gaps = 21/323 (6%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V    R+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGAAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR  GHS                     PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRI-GHS------------------TDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 321

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 322 EAFEQAERKPKPNPNLLFSDVYQ 344


>2bfbA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 370

 Score =  106 bits (264), Expect = 1e-25
 Identities = 80/323 (24%), Positives = 134/323 (41%), Gaps = 26/323 (8%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGAYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR                          PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YR------------------------DHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 316

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 317 EAFEQAERKPKPNPNLLFSDVYQ 339


>1x7xA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 370

 Score =  105 bits (262), Expect = 2e-25
 Identities = 80/323 (24%), Positives = 134/323 (41%), Gaps = 26/323 (8%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR                          PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YR------------------------DHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 316

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 317 EAFEQAERKPKPNPNLLFSDVYQ 339


>1x7wA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 369

 Score =  105 bits (262), Expect = 2e-25
 Identities = 80/323 (24%), Positives = 134/323 (41%), Gaps = 26/323 (8%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 41  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 99

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 100 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 159

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 160 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 219

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 220 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 279

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR                          PI ++R  LL     +++ +K    + R+ V 
Sbjct: 280 YR------------------------DHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 315

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 316 EAFEQAERKPKPNPNLLFSDVYQ 338


>1w85A [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
          Length = 358

 Score =  105 bits (262), Expect = 2e-25
 Identities = 79/286 (27%), Positives = 123/286 (43%), Gaps = 37/286 (12%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 35  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 93

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 94  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 133

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 134 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 193

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A+ T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 194 FVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 253

Query: 254 GPYILEMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRL 299
           GP ++E   +RY  H+MS  +K    E   K     DP+ + R+ L
Sbjct: 254 GPTLIETLCFRYGPHTMSGDSKELENEWAKK-----DPLVRFRKFL 294


>1v16A [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 371

 Score =  105 bits (262), Expect = 2e-25
 Identities = 80/323 (24%), Positives = 134/323 (41%), Gaps = 25/323 (7%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR                          PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRI-----------------------DHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 317

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 318 EAFEQAERKPKPNPNLLFSDVYQ 340


>1oluA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 366

 Score =  105 bits (262), Expect = 2e-25
 Identities = 80/323 (24%), Positives = 134/323 (41%), Gaps = 26/323 (8%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 38  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 96

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 97  TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 156

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 157 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 216

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 217 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 276

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR                          PI ++R  LL     +++ +K    + R+ V 
Sbjct: 277 YR------------------------DHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 312

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 313 EAFEQAERKPKPNPNLLFSDVYQ 335


>2bfdA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 374

 Score =  104 bits (259), Expect = 4e-25
 Identities = 80/323 (24%), Positives = 135/323 (41%), Gaps = 22/323 (6%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V    R+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR                    I +   PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YR--------------------IGSTDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 320

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 321 EAFEQAERKPKPNPNLLFSDVYQ 343


>2bfcA [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 371

 Score =  103 bits (258), Expect = 6e-25
 Identities = 79/323 (24%), Positives = 134/323 (41%), Gaps = 25/323 (7%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 42  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 100

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   +R+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 101 TDLVFGQFREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 160

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 161 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 220

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 221 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 280

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           YR                          PI ++R  LL     +++ +K    + R+ V 
Sbjct: 281 YRI-----------------------DHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 317

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 318 EAFEQAERKPKPNPNLLFSDVYQ 340


>1um9C [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
          Length = 335

 Score =  103 bits (257), Expect = 7e-25
 Identities = 75/250 (30%), Positives = 109/250 (43%), Gaps = 15/250 (6%)

Query: 27  DFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREG-DQ 85
           D   E+    +RDML  R  +E+   L   G    F     G EA  V +  A+R G D 
Sbjct: 26  DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHEAAQVAIAHAIRPGFDW 84

Query: 86  VITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQV 145
           V   YRDHG  LA  +  K ++ ++               H  S   +F+     + + V
Sbjct: 85  VFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASPIASHV 144

Query: 146 SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGT 205
               G A + +    G V +  FGDGA+++G  Y   N A +   P V++ ENN   +  
Sbjct: 145 PPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFPTI-- 202

Query: 206 SVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRY 265
                      + +  +F IPG  VDGMDV A      +AV   R G GP ++E++ YRY
Sbjct: 203 -----------ADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRY 251

Query: 266 RGHSMSDPAK 275
             HS +D  K
Sbjct: 252 GPHSSADDRK 261


>1v11A [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 370

 Score =  103 bits (256), Expect = 1e-24
 Identities = 79/323 (24%), Positives = 133/323 (41%), Gaps = 25/323 (7%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 41  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 99

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 100 TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 159

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN YA
Sbjct: 160 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYA 219

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
           + T  +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 220 ISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 279

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           Y                           PI ++R  LL     +++ +K    + R+ V 
Sbjct: 280 YAI-----------------------DHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 316

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 317 EAFEQAERKPKPNPNLLFSDVYQ 339


>3dvaE [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 354

 Score =  103 bits (256), Expect = 1e-24
 Identities = 73/273 (26%), Positives = 118/273 (43%), Gaps = 32/273 (11%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 35  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 93

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 94  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 133

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 134 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 193

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A  T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 194 FVVQNNRFAASTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 253

Query: 254 GPYILEMQTYRYRGHSMSDPAKYRTREEVDKIR 286
           GP ++E   +RY  H+MS   ++  ++ + + R
Sbjct: 254 GPTLIETLCFRYGPHTMSGDNEWAKKDPLVRFR 286


>1um9A [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
          Length = 331

 Score =  102 bits (255), Expect = 1e-24
 Identities = 74/248 (29%), Positives = 107/248 (43%), Gaps = 15/248 (6%)

Query: 27  DFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREG-DQ 85
           D   E+    +RDML  R  +E+   L   G    F     G EA  V +  A+R G D 
Sbjct: 27  DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHEAAQVAIAHAIRPGFDW 85

Query: 86  VITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQV 145
           V   YRDHG  LA  +  K ++ ++               H  S   +F+     + + V
Sbjct: 86  VFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASPIASHV 145

Query: 146 SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGT 205
               G A + +    G V +  FGDGA+++G  Y   N A +   P V++ ENN   +  
Sbjct: 146 PPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFPTI-- 203

Query: 206 SVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRY 265
                      + +  +F IPG  VDGMDV A      +AV   R G GP ++E++ YRY
Sbjct: 204 -----------ADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRY 252

Query: 266 RGHSMSDP 273
             H   DP
Sbjct: 253 GPHRKKDP 260


>3dv0C [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 351

 Score =  100 bits (250), Expect = 5e-24
 Identities = 72/262 (27%), Positives = 114/262 (43%), Gaps = 32/262 (12%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 35  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 93

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 94  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 133

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 134 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 193

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A+ T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 194 FVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 253

Query: 254 GPYILEMQTYRYRGHSMSDPAK 275
           GP ++E   +RY  H+ ++ AK
Sbjct: 254 GPTLIETLCFRYGPHTENEWAK 275


>3dv0G [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 352

 Score = 98.6 bits (244), Expect = 2e-23
 Identities = 70/256 (27%), Positives = 110/256 (42%), Gaps = 32/256 (12%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 35  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 93

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 94  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 133

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 134 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 193

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A+ T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 194 FVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 253

Query: 254 GPYILEMQTYRYRGHS 269
           GP ++E   +RY  H+
Sbjct: 254 GPTLIETLCFRYGPHT 269


>3dv0A [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 349

 Score = 98.2 bits (243), Expect = 3e-23
 Identities = 70/255 (27%), Positives = 109/255 (42%), Gaps = 32/255 (12%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 35  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 93

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 94  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 133

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 134 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 193

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A+ T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 194 FVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 253

Query: 254 GPYILEMQTYRYRGH 268
           GP ++E   +RY  H
Sbjct: 254 GPTLIETLCFRYGPH 268


>3dv0E [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
          Length = 344

 Score = 97.4 bits (241), Expect = 5e-23
 Identities = 71/277 (25%), Positives = 117/277 (42%), Gaps = 32/277 (11%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 35  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 93

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 94  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 133

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 134 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 193

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A+ T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 194 FVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 253

Query: 254 GPYILEMQTYRYRGHSMSDPAKYRTREEVDKIRNDQD 290
           GP ++E   +RY         ++R   E   + ++++
Sbjct: 254 GPTLIETLCFRYEWAKKDPLVRFRKFLEAKGLWSEEE 290


>1w88A [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
          Length = 340

 Score = 96.3 bits (238), Expect = 1e-22
 Identities = 68/253 (26%), Positives = 109/253 (43%), Gaps = 32/253 (12%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 34  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 92

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 93  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 132

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  Y+  N A  +K P +
Sbjct: 133 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGNFYQGINFAGAFKAPAI 192

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A+ T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 193 FVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 252

Query: 254 GPYILEMQTYRYR 266
           GP ++E   +RY+
Sbjct: 253 GPTLIETLCFRYK 265


>1w88C [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
          Length = 343

 Score = 95.5 bits (236), Expect = 2e-22
 Identities = 68/252 (26%), Positives = 108/252 (42%), Gaps = 32/252 (12%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 34  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 92

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 93  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 132

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  Y+  N A  +K P +
Sbjct: 133 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGNFYQGINFAGAFKAPAI 192

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A+ T V + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 193 FVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 252

Query: 254 GPYILEMQTYRY 265
           GP ++E   +RY
Sbjct: 253 GPTLIETLCFRY 264


>1w85E [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
          Length = 350

 Score = 91.3 bits (225), Expect = 4e-21
 Identities = 76/286 (26%), Positives = 117/286 (40%), Gaps = 45/286 (15%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 34  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 92

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 93  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 132

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  YE  N A  +K P +
Sbjct: 133 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAI 192

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR        + +     +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 193 FVVQNNR--------KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 244

Query: 254 GPYILEMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRL 299
           GP ++E   +RY  H+MS   K    E   K     DP+ + R+ L
Sbjct: 245 GPTLIETLCFRYGPHTMSGDDKELENEWAKK-----DPLVRFRKFL 285


>1v1rA [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 352

 Score = 90.5 bits (223), Expect = 7e-21
 Identities = 76/323 (23%), Positives = 129/323 (39%), Gaps = 36/323 (11%)

Query: 23  SKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALRE 82
           S+ P   KE+ L  ++ M L+   +    +    G I  +   Y G+E   VG   AL  
Sbjct: 34  SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDN 92

Query: 83  GDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVG 142
            D V   YR+ G ++  +   +  MA+               +H    E+HF      + 
Sbjct: 93  TDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA 152

Query: 143 AQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYA 202
            Q+                   + YFG+GA+++G  +  FN A   + P+++   NN   
Sbjct: 153 TQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN--- 209

Query: 203 MGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQT 262
                +        + RG  + I   +VDG DV AV  A  +A     A N P+++E  T
Sbjct: 210 -----SEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMT 264

Query: 263 YRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKI-DAEVRKIVN 321
           Y                           PI ++R  LL     +++ +K    + R+ V 
Sbjct: 265 YH--------------------------PISRLRHYLLSQGWWDEEQEKAWRKQSRRKVM 298

Query: 322 EAADFAQNDPEPDPSELYTDVYR 344
           EA + A+  P+P+P+ L++DVY+
Sbjct: 299 EAFEQAERKPKPNPNLLFSDVYQ 321


>2bp7A [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
          Length = 407

 Score = 90.1 bits (222), Expect = 9e-21
 Identities = 71/287 (24%), Positives = 122/287 (42%), Gaps = 10/287 (3%)

Query: 67  IGQEAVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMH 126
           +G+EA+  G  +AL   D     YR    ++A ++    ++ +L              + 
Sbjct: 109 LGEEAIGSGQALALNRTDMCFPTYRQQSILMARDVSLVEMICQLLSNERDPLKGRQLPIM 168

Query: 127 MFSMEKHFYGGHGIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAE 186
               E  F+   G +  Q     G A A+  + +  +  A+ GDGA+ +   + +   A 
Sbjct: 169 YSVREAGFFTISGNLATQFVQAVGWAMASAIKGDTKIASAWIGDGATAESDFHTALTFAH 228

Query: 187 LWKLPVVYVIENNRYAMGT-SVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKA 245
           +++ PV+  + NN++A+ T         T F+ RGV   I   +VDG D           
Sbjct: 229 VYRAPVILNVVNNQWAISTFQAIAGGESTTFAGRGVGCGIASLRVDGNDFVXXXXXXXXX 288

Query: 246 VAHCRAGNGPYILEMQTYRYRGHSMS-DPAKYRTREEVDKIRNDQDPIEQVRQRLLG-SD 303
                 G GP ++E  TYR   HS S DP+KYR  ++        DPI +++Q L+    
Sbjct: 289 XXXXXXGLGPSLIEWVTYRAGPHSTSDDPSKYRPADDWSHFPLG-DPIARLKQHLIKIGH 347

Query: 304 MTEDDLKKIDAEVRKIVNEAADFAQ------NDPEPDPSELYTDVYR 344
            +E++ +   AE    V  A   A+      N   P  + ++ DVY+
Sbjct: 348 WSEEEHQATTAEFEAAVIAAQKEAEQYGTLANGHIPSAASMFEDVYK 394


>1w88G [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
          Length = 331

 Score = 82.0 bits (201), Expect = 2e-18
 Identities = 65/246 (26%), Positives = 102/246 (41%), Gaps = 39/246 (15%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 34  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 92

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 93  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 132

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  Y+  N A  +K P +
Sbjct: 133 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGNFYQGINFAGAFKAPAI 192

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+A   + T        +++ V+  IPG QVDGMD  AV AA   A      G 
Sbjct: 193 FVVQNNRFAQTVAKT-------LAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGE 245

Query: 254 GPYILE 259
           GP ++E
Sbjct: 246 GPTLIE 251


>1w88E [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
          Length = 328

 Score = 71.2 bits (173), Expect = 4e-15
 Identities = 62/246 (25%), Positives = 94/246 (38%), Gaps = 42/246 (17%)

Query: 25  VPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQEAVVVGMQMALREGD 84
           +P+ + EQ     R M+  R  ++++  L   G +G +     GQEA  +    AL + D
Sbjct: 34  MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQEASQIASHFALEKED 92

Query: 85  QVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGIVGAQ 144
            ++ GYRD   ++                             +FS   HF+G     G  
Sbjct: 93  FILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIPEGVN 132

Query: 145 V-----------SLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVV 193
           V                     + R   +V + Y GDG ++QG  Y+  N A  +K P +
Sbjct: 133 VLPPXXXXXXXXXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGNFYQGINFAGAFKAPAI 192

Query: 194 YVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGN 253
           +V++NNR+                       IPG QVDGMD  AV AA   A      G 
Sbjct: 193 FVVQNNRF----------XXXXXXXXXXXXGIPGIQVDGMDPLAVYAAVKAARERAINGE 242

Query: 254 GPYILE 259
           GP ++E
Sbjct: 243 GPTLIE 248


>1qs0A [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA-SUBUNIT
          Length = 395

 Score = 69.3 bits (168), Expect = 2e-14
 Identities = 63/237 (26%), Positives = 106/237 (44%), Gaps = 10/237 (4%)

Query: 67  IGQEAVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMH 126
           +G+EA+  G  +AL   D   T YR    +LA ++    +   L+             + 
Sbjct: 104 LGEEAIGSGQALALNRTDCFPT-YRQQS-ILARDVSLVEICQLLSNERDPLKGRQ---LP 158

Query: 127 MFSM-EKHFYGGHGIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMA 185
           ++S+ E  F+   G +  Q     G A A+  + +  +  A+ GDGA+ +   + +   A
Sbjct: 159 IYSVREAGFFTISGNLATQFVQAVGWA-ASAIKGDTKIASAWIGDGATAESDFHTALTFA 217

Query: 186 ELWKLPVVYVIENNRYAMGT-SVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDK 244
            +++ PV+  + NN++A+ T         T F+ RGV   I   +VDG D          
Sbjct: 218 HVYRAPVILNVVNNQWAISTFQAIAGGESTTFAGRGVGCGIASLRVDGNDFVXXXXXXXX 277

Query: 245 AVAHCRAGNGPYILEMQTYRYRGHSMS-DPAKYRTREEVDKIRNDQDPIEQVRQRLL 300
                  G GP ++E  TYR   HS S DP+KYR  ++        DPI +++Q L+
Sbjct: 278 XXXXXXXGLGPSLIEWVTYRAGPHSTSDDPSKYRPADDWSHFPLG-DPIARLKQHLI 333


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.308    0.126    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 951,207,239
Number of extensions: 37848861
Number of successful extensions: 90957
Number of sequences better than 1.0e-03: 1552
Number of HSP's gapped: 88464
Number of HSP's successfully gapped: 1811
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.2 bits)