BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE38351.1 rpal2 ABE38351.1 GIB00345CH01 "glycoside hydrolase,
family 5"
         (440 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

GUN1_ACIC1 RecName: Full=Endoglucanase E1;         EC=3.2.1.4;Al...   158   1e-40
GUN_PAEPO RecName: Full=Endoglucanase;         EC=3.2.1.4;AltNam...   128   8e-32
GUNB_CALSA RecName: Full=Endoglucanase/exoglucanase B;Includes: ...   103   4e-24
GUNG_CLOTH RecName: Full=Endoglucanase G;         EC=3.2.1.4;Alt...    91   2e-20
GUND_CELFI RecName: Full=Endoglucanase D;         EC=3.2.1.4;Alt...    88   1e-19
GUNB_CLOTH RecName: Full=Endoglucanase B;         EC=3.2.1.4;Alt...    70   3e-14
GUNA_XANCP RecName: Full=Major extracellular endoglucanase;     ...    54   3e-09
GUN3_BACSU RecName: Full=Endoglucanase;         EC=3.2.1.4;AltNa...    40   5e-05
GUNC_PSEFL RecName: Full=Endoglucanase C;         EC=3.2.1.4;Alt...    36   7e-04
GUNA_PAEBA RecName: Full=Endoglucanase A;         EC=3.2.1.4;Alt...    36   7e-04
GUN2_BACSU RecName: Full=Endoglucanase;         EC=3.2.1.4;AltNa...    36   7e-04
GUN1_BACSU RecName: Full=Endoglucanase;         EC=3.2.1.4;AltNa...    36   7e-04

>GUN1_ACIC1 RecName: Full=Endoglucanase E1;       
           EC=3.2.1.4;AltName: Full=Endo-1,4-beta-glucanase
           E1;AltName: Full=Cellulase E1;AltName:
           Full=Endocellulase E1;
          Length = 562

 Score =  158 bits (399), Expect = 1e-40
 Identities = 114/392 (29%), Positives = 176/392 (44%), Gaps = 69/392 (17%)

Query: 36  YLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKTVLDSIVAAGFNAVRI 95
           Y  TSG +I+DA+  PVRIA I W G E        G+W   Y+++LD I + G+N +R+
Sbjct: 46  YWHTSGREILDANNVPVRIAGINWFGFE-TCNYVVHGLWSRDYRSMLDQIKSLGYNTIRL 104

Query: 96  PWTDIGLNAPLNGYSDRLGWINITLNPELLASST-PNSQGRYQY------VTTLVAFQRI 148
           P++D                       ++L   T PNS   YQ       +T+L    +I
Sbjct: 105 PYSD-----------------------DILKPGTMPNSINFYQMNQDLQGLTSLQVMDKI 141

Query: 149 VDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLV 208
           V YA +IGL++I + H     +GQ  + LW+                V+  T+  +   +
Sbjct: 142 VAYAGQIGLRIILDRH-RPDCSGQ--SALWYT-------------SSVSEATWISDLQAL 185

Query: 209 ARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPT-DIKAMCEDVGSAIQDVSPGVLIICE 267
           A+ +  NPTV+G+DLHNEP+       WG G P+ D +   E  G+A+  V+P +LI  E
Sbjct: 186 AQRYKGNPTVVGFDLHNEPHDPA---CWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVE 242

Query: 268 GPETYKPPPASSGMDPRHXXXXXXXXXXXXXXVKLKIANKLVYSIHEYPDEISDTKRWGL 327
           G ++Y       G + +               V L + N+LVYS H+Y   +     +  
Sbjct: 243 GVQSYNGDSYWWGGNLQ---------GAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSD 293

Query: 328 PEVGKGFIDRMNFTWGYLVRDNIAPVWIGEMGASLRTPETREWARNLIDYMNGKYGQEGG 387
           P          N  WGYL   NIAPVW+GE G +L++   + W + L+ Y+         
Sbjct: 294 PTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKTLVQYLR-------- 345

Query: 388 PTFSGDQQPVSGSWWLIGPSNDPPFG-LQTEW 418
           PT          ++W   P +    G L+ +W
Sbjct: 346 PTAQYGADSFQWTFWSWNPDSGDTGGILKDDW 377


>GUN_PAEPO RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:
           Full=Endo-1,4-beta-glucanase;AltName: Full=Cellulase;
          Length = 397

 Score =  128 bits (322), Expect = 8e-32
 Identities = 97/348 (27%), Positives = 156/348 (44%), Gaps = 48/348 (13%)

Query: 35  GYLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKTVLDSIVAAGFNAVR 94
           GY  T G++IVD SG+      + W G E P      G+W  S   +LD +   G+N +R
Sbjct: 37  GYYHTQGNKIVDESGKEAAFNGLNWFGLETP-NYTLHGLWSRSMDDMLDQVKKEGYNLIR 95

Query: 95  IPWTDIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYVTTLVAFQRIVDYAQE 154
           +P+++      L   S R   I+   NP+L+             +  +    ++++ A +
Sbjct: 96  LPYSN-----QLFDSSSRPDSIDYHKNPDLVG------------LNPIQIMDKLIEKAGQ 138

Query: 155 IGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVARTFAN 214
            G+++I + H   G+ GQ    LW+               +     +  +W ++A  + N
Sbjct: 139 RGIQIILDRH-RPGSGGQSE--LWYT-------------SQYPESRWISDWKMLADRYKN 182

Query: 215 NPTVIGYDLHNEPNGDRGHITWG-GGGPTDIKAMCEDVGSAIQDVSPGVLIICEGPETYK 273
           NPTVIG DLHNEP+   G  +WG G   TD +   +  G+AI  V+P  LI+ EG +   
Sbjct: 183 NPTVIGADLHNEPH---GQASWGTGNASTDWRLAAQRAGNAILSVNPNWLILVEGVD--- 236

Query: 274 PPPASSGMDPRHXXXXXXXXXXXXXXVKLKIANKLVYSIHEYPDEISDTKRWGLPEVGKG 333
                 G + ++              V L + N++VYS H+Y   +S    +  P     
Sbjct: 237 --HNVQGNNSQYWWGGNLTGVANYPVV-LDVPNRVVYSPHDYGPGVSSQPWFNDPAFPSN 293

Query: 334 FIDRMNFTWGYLVRDNIAPVWIGEMG---ASLRTPETREWARNLIDYM 378
                + TWGY+ + NIAPV +GE G     L  PE + W   L+ Y+
Sbjct: 294 LPAIWDQTWGYISKQNIAPVLVGEFGGRNVDLSCPEGK-WQNALVHYI 340


>GUNB_CALSA RecName: Full=Endoglucanase/exoglucanase B;Includes:
           RecName: Full=Endoglucanase;           EC=3.2.1.4;
           AltName: Full=Endo-1,4-beta-glucanase;
          Length = 1039

 Score =  103 bits (256), Expect = 4e-24
 Identities = 97/358 (27%), Positives = 146/358 (40%), Gaps = 46/358 (12%)

Query: 36  YLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKTVLDSIVAAGFNAVRI 95
           +L  SG++IVD  GRPV +  I W G          G+W  + K  L  I   GFN +R+
Sbjct: 629 WLYVSGNKIVDKDGRPVWLTGINWFGYNTGTNVF-DGVWSCNLKDTLAEIANRGFNLLRV 687

Query: 96  PWT-DIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYVTTLVAFQRIVDYAQE 154
           P + ++ LN     Y      IN  +NPEL        +G+     +L  F  +V   +E
Sbjct: 688 PISAELILNWSQGIYPKPN--INYYVNPEL--------EGK----NSLEVFDIVVQTCKE 733

Query: 155 IGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVARTFAN 214
           +GLK++ + H+ +  A      +W+D              + T E F +    +   + N
Sbjct: 734 VGLKIMLDIHSIKTDAMGHIYPVWYD-------------EKFTPEDFYKACEWITNRYKN 780

Query: 215 NPTVIGYDLHNEPNG----DRGHITWGGGGPTDI---KAMCEDVGSAIQDVSPGVLIICE 267
           + T+I +DL NEP+G    D     W     TDI   K   E               + E
Sbjct: 781 DDTIIAFDLKNEPHGKPWQDTTFAKWDNS--TDINNWKYAAETCAKRXXXXXXXXXXVIE 838

Query: 268 GPETYKPPPAS----SGMDPRHXXXXXXXXXXXXXXVKL-KIANKLVYSIHEYPDEISDT 322
           G E Y     +    S  D                 + L K  NK+VYS H+Y   +   
Sbjct: 839 GIEAYPKDDVTWTSKSSSDYYSTWWGGNLRGVRKYPINLGKYQNKVVYSPHDYGPSVYQ- 897

Query: 323 KRWGLPEVGKGFI--DRMNFTWGYLVRDNIAPVWIGEMGASLRTPETREWARNLIDYM 378
           + W  P   K  +  D     W Y++ +NIAP+ IGE G  L   +  +W + L DY+
Sbjct: 898 QPWFYPGFTKESLLQDCWRPNWAYIMEENIAPLLIGEWGGHLDGADNEKWMKYLRDYI 955


>GUNG_CLOTH RecName: Full=Endoglucanase G;       
           EC=3.2.1.4;AltName: Full=Endo-1,4-beta-glucanase G;     
              Short=EgG;AltName: Full=Cellulase G;
          Length = 566

 Score = 90.9 bits (224), Expect = 2e-20
 Identities = 103/409 (25%), Positives = 164/409 (40%), Gaps = 58/409 (14%)

Query: 36  YLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKTVLDSIVAAGFNAVRI 95
           +L   G++I D  G  V +    W G          G W    KT+L SI   G N +RI
Sbjct: 44  WLHCKGNKIYDMYGNEVWLTGANWFGFNCSENCF-HGAW-YDVKTILTSIADRGINLLRI 101

Query: 96  PWTDIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYV-TTLVAFQRIVDYAQE 154
           P +   L + + G  + +  +  + NP     +          V  ++  F  I+ Y +E
Sbjct: 102 PISTELLYSWMIGKPNPVSSVTASNNPPYHVVNPDFYDPETDDVKNSMEIFDIIMGYCKE 161

Query: 155 IGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVARTFAN 214
           +G+KV+ + H+           LW+  G  T +T G+V  ++  +T    WL  A  + N
Sbjct: 162 LGIKVMIDIHSPDANNSGHNYELWY--GKET-STCGVVTTKMWIDTLV--WL--ADKYKN 214

Query: 215 NPTVIGYDLHNEPNGDRGHIT--------WGGG-GPTDIKAMCEDVGSAIQDVSPGVLII 265
           + T+I +DL NEP+G RG+          W       + K   E    AI +V+P VLI+
Sbjct: 215 DDTIIAFDLKNEPHGKRGYTAEVPKLLAKWDNSTDENNWKYAAETCAKAILEVNPKVLIV 274

Query: 266 CEGPE---------TYKPPP---ASSGMDPRH-XXXXXXXXXXXXXXVKL-KIANKLVYS 311
            EG E         TY  P    A+    P +               + L  + +++VYS
Sbjct: 275 IEGVEQYPKTEKGYTYDTPDIWGATGDASPWYSAWWGGNLRGVKDYPIDLGPLNSQIVYS 334

Query: 312 IHEYPDEISDTKRWGLPEVGKGFI------DRMNFTWGYLVRDNIAPVWIGEMGASLRTP 365
            H+Y   +     +  P   K F       D    TW Y+    IAP+ IGE G  +   
Sbjct: 335 PHDYGPSV-----YAQPWFEKDFTMQTLLDDYWYDTWAYIHDQGIAPILIGEWGGHMDGG 389

Query: 366 ETREWARNLIDYMNGKYGQEGGPTFSGDQQPVSGSWWLIGPSNDPPFGL 414
           + ++W   L DY+               Q  +  ++W I P++    GL
Sbjct: 390 KNQKWMTLLRDYI--------------VQNRIHHTFWCINPNSGDTGGL 424


>GUND_CELFI RecName: Full=Endoglucanase D;       
           EC=3.2.1.4;AltName: Full=Endo-1,4-beta-glucanase
           D;AltName: Full=Cellulase D;Flags: Precursor;
          Length = 747

 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 92/392 (23%), Positives = 159/392 (40%), Gaps = 56/392 (14%)

Query: 36  YLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKTVLDSIVAAGFNAVRI 95
           +L   G+ IVD++G+   ++ + W G          G+W  +   +   +   G N VR+
Sbjct: 45  WLHVEGNTIVDSTGKEAILSGVNWFGFNASERVF-HGLWSGNITQITQQMAQRGINVVRV 103

Query: 96  PWTDIGLNAPLNGYSDRLGWINIT-LNPELLASSTPNSQGRYQYVTTLVAFQRIVDYAQE 154
           P +   L          L W   T L P +   + P  +G+     +L  F+  +   Q+
Sbjct: 104 PVSTQLL----------LEWKAGTFLKPNVNTYANPELEGK----NSLQIFEYWLTLCQK 149

Query: 155 IGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVARTFAN 214
            G+KV  + H+ +         +W+              G +T E   + W   A  + +
Sbjct: 150 YGIKVFLDVHSAEADNSGHVYNMWWK-------------GDITTEDVYEGWEWAATRWKD 196

Query: 215 NPTVIGYDLHNEPNGDRG---HITWGGGGPTD-IKAMCEDVGSAIQDVSPGVLIICEGPE 270
           + T++G D+ NEP+G +G      W G    D  K   E     I  ++P  L+  EG E
Sbjct: 197 DDTIVGADIKNEPHGTQGSTERAKWDGTTDKDNFKHFAETASKKILAINPNWLVFVEGVE 256

Query: 271 TY-KP--PPASSGM-DPRHXXXXXXXXXXXXXXVKLKI-ANKLVYSIHEYPDEISDTKRW 325
            Y KP  P  S+G+ D                 + L    ++LVYS H+Y   + D K W
Sbjct: 257 IYPKPGVPWTSTGLTDYYGTWWGGNLRGVRDHPIDLGAHQDQLVYSPHDYGPLVFDQK-W 315

Query: 326 GLPEVGKGFI--DRMNFTWGYLVRDNIAPVWIGEMGASL-RTPETREWARNLIDYMNGKY 382
              +  K  +  D     W ++  ++IAP+ IGE G  L + P   +W   L D +    
Sbjct: 316 FQKDFDKASLTADVWGPNWLFIHDEDIAPLLIGEWGGRLGQDPRQDKWMAALRDLV---- 371

Query: 383 GQEGGPTFSGDQQPVSGSWWLIGPSNDPPFGL 414
                      ++ +S ++W++ P++    GL
Sbjct: 372 ----------AERRLSQTFWVLNPNSGDTGGL 393


>GUNB_CLOTH RecName: Full=Endoglucanase B;       
           EC=3.2.1.4;AltName: Full=Endo-1,4-beta-glucanase B;     
              Short=EgB;AltName: Full=Cellulase B;
          Length = 563

 Score = 70.5 bits (171), Expect = 3e-14
 Identities = 91/365 (24%), Positives = 141/365 (38%), Gaps = 81/365 (22%)

Query: 36  YLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKTVLDS----------- 84
           +L   G+ IVD  G  V I    W G            +    + +LDS           
Sbjct: 41  WLHVEGTNIVDKYGNKVWITGANWFG------------FNCRERMLLDSYHSDIIADIEL 88

Query: 85  IVAAGFNAVRIPWTDIGLNAPLNGYSDRLGWINITLNPELLAS-STPNSQGRYQYVTTLV 143
           +   G N VR+P     L A          W      P    S + P   G   Y     
Sbjct: 89  VADKGINVVRMPIATDLLYA----------WSQGIYPPSTDTSYNNPALAGLNSYEL--- 135

Query: 144 AFQRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQ 203
            F  +++  + +G+KVI + H+ +         LW++               +T E FK+
Sbjct: 136 -FNFMLENFKRVGIKVILDVHSPETDNQGHNYPLWYNT-------------TITEEIFKK 181

Query: 204 NWLLVARTFANNPTVIGYDLHNEPNGDRGHIT-------WGGGG-PTDIKAMCEDVGSAI 255
            W+ VA  + N+ T+IG+DL NEP+ + G +        W     P + K + E+   AI
Sbjct: 182 AWVWVAERYKNDDTIIGFDLKNEPHTNTGTMKIKAQSAIWDDSNHPNNWKRVAEETALAI 241

Query: 256 QDVSPGVLIICEG-----------PETYKPPPASSGMDPRHXXXXXXXXXXXXXXVKL-K 303
            +V P VLI  EG            ET+   P +                     + L K
Sbjct: 242 LEVHPNVLIFVEGVEMYPKDGIWDDETFDTSPWTXXXXXXXXXXXXXLRGVKDYPINLGK 301

Query: 304 IANKLVYSIHEYPDEISDTKRW-------GLPEVGKGFIDRMNF--TWGYLVRDNIAPVW 354
             ++LVYS H+Y   + + + W          E  K  +    +   W Y++ + I+P+ 
Sbjct: 302 YQSQLVYSPHDYGPIVYE-QDWFKGDFITANDEQAKRILYEQCWRDNWAYIMEEGISPLL 360

Query: 355 IGEMG 359
           +GE G
Sbjct: 361 LGEWG 365


>GUNA_XANCP RecName: Full=Major extracellular endoglucanase;        
           EC=3.2.1.4;AltName:
           Full=Endo-1,4-beta-glucanase;AltName: Full=Cellulase;
          Length = 484

 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 57/233 (24%), Positives = 92/233 (39%), Gaps = 36/233 (15%)

Query: 36  YLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKTVLDSIVAAGFNAVRI 95
           Y   +  QIVD SG+ V++  +   G E        G+W  ++K ++  +   GFNAVR+
Sbjct: 26  YSINNSRQIVDDSGKVVQLKGVNVFGFETG-NHVMHGLWARNWKDMIVQMQGLGFNAVRL 84

Query: 96  PWTDIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYVTTLVAFQRIVDYAQEI 155
           P+    L +     S     I+ + N +L            Q +T+L    +++      
Sbjct: 85  PFCPATLRSDTMPAS-----IDYSRNADL------------QGLTSLQILDKVIAEFNAR 127

Query: 156 GLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVARTFANN 215
           G+ V+ +HHT       +   LW+              G  T   +  +   VA  + N 
Sbjct: 128 GMYVLLDHHTPDCAGISE---LWY-------------TGSYTEAQWLADLRFVANRYKNV 171

Query: 216 PTVIGYDLHNEPNGDRGHITWGGGGPTDIKAMCEDVGSAIQDVSPGVLIICEG 268
           P V+G DL NEP+              D     E   +A+  V+P  LI  EG
Sbjct: 172 PYVLGLDLKNEPH--XXXXXXXXXXXXDWNKAAERGSAAVLAVAPKWLIAVEG 222


>GUN3_BACSU RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:
           Full=Endo-1,4-beta-glucanase;AltName:
           Full=Carboxymethyl-cellulase;
          Length = 499

 Score = 39.7 bits (91), Expect = 5e-05
 Identities = 64/246 (26%), Positives = 94/246 (38%), Gaps = 74/246 (30%)

Query: 24  PAGRGGYLLP---NGYLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAPSGIWRVSYKT 80
           PA   G   P   NG LS  G+Q+V+  G+ V++  I  +G +          W   Y  
Sbjct: 26  PASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ----------WYGEYVN 75

Query: 81  VLDSIVAAGFNAVRIPWTDIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYVT 140
             DS+       +R  W      A +  Y+   G I+   NP     S  N         
Sbjct: 76  K-DSL-----KWLRDDWGITVFRAAM--YTADGGIID---NP-----SVKNKM------- 112

Query: 141 TLVAFQRIVDYAQEIGLKVIFNHHT-NQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAE 199
                +  V+ A+E+G+ VI + H  N G   Q +                        E
Sbjct: 113 -----KEAVEAAKELGIYVIIDWHILNDGNPNQNKEK--------------------AKE 147

Query: 200 TFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKAMCEDVGSAIQDVS 259
            FK+    ++  + N P VI Y++ NEPNGD   + W      DIK   E+V S I+   
Sbjct: 148 FFKE----MSSLYGNTPNVI-YEIANEPNGD---VNW----KRDIKPYAEEVISVIRKND 195

Query: 260 PGVLII 265
           P  +II
Sbjct: 196 PDNIII 201


>GUNC_PSEFL RecName: Full=Endoglucanase C;       
           EC=3.2.1.4;AltName: Full=Endo-1,4-beta-glucanase C;     
              Short=EGC;AltName: Full=Cellulase C;
          Length = 748

 Score = 35.8 bits (81), Expect = 7e-04
 Identities = 31/95 (32%), Positives = 39/95 (41%), Gaps = 26/95 (27%)

Query: 202 KQNWLLVARTFANNPT------VIGYDLHNEPNGDRGHITWGGGGPTDIKAMCEDVGSAI 255
           KQ WL   R  A          +IG D+ NEP       TW      + K M E+   AI
Sbjct: 473 KQKWLANLREIAGLSAKLGVSNLIGIDVFNEPYD----YTWA-----EWKGMVEEAYQAI 523

Query: 256 QDVSPGVLIICEG-----------PETYKPPPASS 279
            +V+P +LII EG           P+T  P P  S
Sbjct: 524 NEVNPNMLIIVEGISANANTQDGTPDTSVPVPHGS 558


>GUNA_PAEBA RecName: Full=Endoglucanase A;       
           EC=3.2.1.4;AltName: Full=Endo-1,4-beta-D-glucanase
           A;AltName: Full=Cellulase A;Flags: Precursor;
          Length = 400

 Score = 35.8 bits (81), Expect = 7e-04
 Identities = 32/132 (24%), Positives = 48/132 (36%), Gaps = 34/132 (25%)

Query: 102 LNAPLNGYSDRLGWINITLNPELLAS--------------------STPNSQGRYQYVTT 141
           L A +NG  +   W N T+ PEL+                      S PN      ++  
Sbjct: 57  LEATVNGTPNETSWGNPTITPELIKKVKAAGFKTIRIPVSYLNYIGSAPNYTVNASWLNR 116

Query: 142 LVAFQRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETF 201
           +   Q++VDYA   GL V+ N H   G       G W  +     N        V  + +
Sbjct: 117 I---QQVVDYAYNEGLYVVINMH---GDGFHSIPGSWLHVNSSNQN--------VIRDKY 162

Query: 202 KQNWLLVARTFA 213
           ++ W  VA  F+
Sbjct: 163 QKVWQQVATRFS 174


>GUN2_BACSU RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:
           Full=Endo-1,4-beta-glucanase;AltName:
           Full=Carboxymethyl-cellulase;
          Length = 499

 Score = 35.8 bits (81), Expect = 7e-04
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 16/88 (18%)

Query: 178 WFDLGPGTDNTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWG 237
           W  L  G  N +         E  K+ +  ++  + N P VI Y++ NEPNGD   + W 
Sbjct: 130 WHILNDGNPNQN--------KEKAKEFFKEMSSLYGNTPNVI-YEIANEPNGD---VNW- 176

Query: 238 GGGPTDIKAMCEDVGSAIQDVSPGVLII 265
                DIK   E+V S I+   P  +II
Sbjct: 177 ---KRDIKPYAEEVISVIRKNDPDNIII 201


>GUN1_BACSU RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:
           Full=Endo-1,4-beta-glucanase;AltName:
           Full=Cellulase;Flags: Precursor;
          Length = 499

 Score = 35.8 bits (81), Expect = 7e-04
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 16/88 (18%)

Query: 178 WFDLGPGTDNTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWG 237
           W  L  G  N +         E  K+ +  ++  + N P VI Y++ NEPNGD   + W 
Sbjct: 130 WHILNDGNPNQN--------KEKAKEFFKEMSSLYGNTPNVI-YEIANEPNGD---VNW- 176

Query: 238 GGGPTDIKAMCEDVGSAIQDVSPGVLII 265
                DIK   E+V S I+   P  +II
Sbjct: 177 ---KRDIKPYAEEVISVIRKNDPDNIII 201


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.319    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,767,576,749
Number of extensions: 386992233
Number of successful extensions: 1034055
Number of sequences better than 1.0e-03: 18752
Number of HSP's gapped: 994309
Number of HSP's successfully gapped: 44160
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)