BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE38755.1 rpal2 ABE38755.1 GIB00345CH01 "ABC transporter
related"
         (253 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BRAF_PSEAE RecName: Full=High-affinity branched-chain amino acid...   250   8e-69
LIVG_SALTY RecName: Full=High-affinity branched-chain amino acid...   230   1e-62
LIVG_SALTI RecName: Full=High-affinity branched-chain amino acid...   230   1e-62
LIVG_SHIFL RecName: Full=High-affinity branched-chain amino acid...   229   3e-62
LIVG_ECOLI RecName: Full=High-affinity branched-chain amino acid...   229   3e-62
LIVG_ECO57 RecName: Full=High-affinity branched-chain amino acid...   229   3e-62
LIVG_ARCFU RecName: Full=Probable branched-chain amino acid tran...   151   7e-39
RBSA1_THEMA RecName: Full=Ribose import ATP-binding protein rbsA...   137   1e-34
LIVG_METJA RecName: Full=Probable branched-chain amino acid tran...   135   4e-34
LPTB_HAEIN RecName: Full=Lipopolysaccharide export system ATP-bi...   130   1e-32
RBSA2_PASMU RecName: Full=Ribose import ATP-binding protein rbsA...   128   5e-32
METN1_BURPS RecName: Full=Methionine import ATP-binding protein ...   128   6e-32
METN1_BURP1 RecName: Full=Methionine import ATP-binding protein ...   128   6e-32
METN1_BURMA RecName: Full=Methionine import ATP-binding protein ...   128   6e-32
RBSA2_THEMA RecName: Full=Ribose import ATP-binding protein rbsA...   125   3e-31
LPTB_SHIFL RecName: Full=Lipopolysaccharide export system ATP-bi...   125   3e-31
LPTB_ECOLI RecName: Full=Lipopolysaccharide export system ATP-bi...   125   3e-31
LPTB_ECOL6 RecName: Full=Lipopolysaccharide export system ATP-bi...   125   3e-31
LPTB_ECO57 RecName: Full=Lipopolysaccharide export system ATP-bi...   125   3e-31
RBSA_BACLD RecName: Full=Ribose import ATP-binding protein rbsA;...   125   4e-31
METN_BURTA RecName: Full=Methionine import ATP-binding protein m...   124   7e-31
METN_BRUSU RecName: Full=Methionine import ATP-binding protein m...   124   9e-31
METN_BRUME RecName: Full=Methionine import ATP-binding protein m...   124   9e-31
METN_BRUAB RecName: Full=Methionine import ATP-binding protein m...   124   9e-31
METN_BRUA2 RecName: Full=Methionine import ATP-binding protein m...   124   9e-31
METN_BACSU RecName: Full=Methionine import ATP-binding protein m...   124   9e-31
YUFO_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...   124   1e-30
RBSA_BACSK RecName: Full=Ribose import ATP-binding protein rbsA;...   124   1e-30
Y3926_AZOC5 RecName: Full=Probable ABC transporter ATP-binding p...   123   2e-30
RBSA_ANAVT RecName: Full=Ribose import ATP-binding protein rbsA;...   123   2e-30
NODI_RHIEC RecName: Full=Nod factor export ATP-binding protein I...   123   2e-30
METN1_BURCH RecName: Full=Methionine import ATP-binding protein ...   122   3e-30
METN1_BURCA RecName: Full=Methionine import ATP-binding protein ...   122   3e-30
POTA_FUSNN RecName: Full=Spermidine/putrescine import ATP-bindin...   122   3e-30
RBSA_YERPS RecName: Full=Ribose import ATP-binding protein rbsA;...   122   4e-30
RBSA_YERPN RecName: Full=Ribose import ATP-binding protein rbsA;...   122   4e-30
RBSA_YERPE RecName: Full=Ribose import ATP-binding protein rbsA;...   122   4e-30
RBSA_YERPA RecName: Full=Ribose import ATP-binding protein rbsA;...   122   4e-30
RBSA_LACC3 RecName: Full=Ribose import ATP-binding protein rbsA;...   121   6e-30
METN_LEIXX RecName: Full=Methionine import ATP-binding protein m...   121   6e-30
METN_BORPE RecName: Full=Methionine import ATP-binding protein m...   121   6e-30
METN_BORPA RecName: Full=Methionine import ATP-binding protein m...   121   6e-30
METN_BORBR RecName: Full=Methionine import ATP-binding protein m...   121   6e-30
METN1_BURCM RecName: Full=Methionine import ATP-binding protein ...   121   6e-30
METN1_BACSK RecName: Full=Methionine import ATP-binding protein ...   121   6e-30
YTFR_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...   121   8e-30
YTFR_ECO57 RecName: Full=Uncharacterized ABC transporter ATP-bin...   121   8e-30
RBSA_HAHCH RecName: Full=Ribose import ATP-binding protein rbsA;...   120   1e-29
RBSA_BACSU RecName: Full=Ribose import ATP-binding protein rbsA;...   120   1e-29
RBSA1_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA...   120   1e-29
METN3_OCEIH RecName: Full=Methionine import ATP-binding protein ...   120   1e-29
METN_PROAC RecName: Full=Methionine import ATP-binding protein m...   120   1e-29
POTA_OENOB RecName: Full=Spermidine/putrescine import ATP-bindin...   120   2e-29
POTA_MYCMS RecName: Full=Spermidine/putrescine import ATP-bindin...   120   2e-29
METN1_BURS3 RecName: Full=Methionine import ATP-binding protein ...   120   2e-29
POTA_MYCCT RecName: Full=Spermidine/putrescine import ATP-bindin...   119   2e-29
PHNC_THIDA RecName: Full=Phosphonates import ATP-binding protein...   119   2e-29
METN2_LACPL RecName: Full=Methionine import ATP-binding protein ...   119   2e-29
RBSA2_STRCO RecName: Full=Ribose import ATP-binding protein rbsA...   119   3e-29
METN1_BURXL RecName: Full=Methionine import ATP-binding protein ...   119   3e-29
RBSA_SILST RecName: Full=Ribose import ATP-binding protein rbsA;...   119   4e-29
CBIO_METTH RecName: Full=Putative cobalt import ATP-binding prot...   119   4e-29
RBSA3_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA...   118   5e-29
RBSA1_BURCM RecName: Full=Ribose import ATP-binding protein rbsA...   118   5e-29
PHNC1_RHOP2 RecName: Full=Phosphonates import ATP-binding protei...   118   5e-29
XYLG_HAES1 RecName: Full=Xylose import ATP-binding protein xylG;...   118   6e-29
METN_XYLFA RecName: Full=Methionine import ATP-binding protein m...   118   6e-29
METN_RALSO RecName: Full=Methionine import ATP-binding protein m...   118   6e-29
METN2_ERWCT RecName: Full=Methionine import ATP-binding protein ...   118   6e-29
RGMG_THETN RecName: Full=Putative ribose/galactose/methyl galact...   117   8e-29
RGMG2_BURS3 RecName: Full=Putative ribose/galactose/methyl galac...   117   8e-29
METN_XYLFT RecName: Full=Methionine import ATP-binding protein m...   117   8e-29
LPTB_THIFE RecName: Full=Lipopolysaccharide export system ATP-bi...   117   8e-29
RGMG_BURXL RecName: Full=Putative ribose/galactose/methyl galact...   117   1e-28
RGMG2_BURCM RecName: Full=Putative ribose/galactose/methyl galac...   117   1e-28
METN_STRPD RecName: Full=Methionine import ATP-binding protein m...   117   1e-28
CYSA_BRUSU RecName: Full=Sulfate/thiosulfate import ATP-binding ...   117   1e-28
CYSA_BRUME RecName: Full=Sulfate/thiosulfate import ATP-binding ...   117   1e-28
RBSA1_BURCH RecName: Full=Ribose import ATP-binding protein rbsA...   117   1e-28
RBSA1_BURCA RecName: Full=Ribose import ATP-binding protein rbsA...   117   1e-28
NODI_RHIS3 RecName: Full=Nod factor export ATP-binding protein I...   117   1e-28
METN_STRPM RecName: Full=Methionine import ATP-binding protein m...   117   1e-28
METN_STRPC RecName: Full=Methionine import ATP-binding protein m...   117   1e-28
METN_STRPB RecName: Full=Methionine import ATP-binding protein m...   117   1e-28
METN_STRP6 RecName: Full=Methionine import ATP-binding protein m...   117   1e-28
METN_STRP1 RecName: Full=Methionine import ATP-binding protein m...   117   1e-28
METN_STRP3 RecName: Full=Methionine import ATP-binding protein m...   116   2e-28
METN_RALEH RecName: Full=Methionine import ATP-binding protein m...   116   2e-28
METN_BRAJA RecName: Full=Methionine import ATP-binding protein m...   116   2e-28
METN2_BACCZ RecName: Full=Methionine import ATP-binding protein ...   116   2e-28
RGMG1_BURCH RecName: Full=Putative ribose/galactose/methyl galac...   116   2e-28
RGMG1_BURCA RecName: Full=Putative ribose/galactose/methyl galac...   116   2e-28
RBSA2_BURTA RecName: Full=Ribose import ATP-binding protein rbsA...   116   2e-28
METN_STRP8 RecName: Full=Methionine import ATP-binding protein m...   116   2e-28
METN_COREF RecName: Full=Methionine import ATP-binding protein m...   116   2e-28
RBSA_PSEPK RecName: Full=Ribose import ATP-binding protein rbsA;...   115   3e-28
RBSA2_RHIEC RecName: Full=Ribose import ATP-binding protein rbsA...   115   3e-28
RBSA2_ECO57 RecName: Full=Ribose import ATP-binding protein rbsA...   115   3e-28
METN_RHOFD RecName: Full=Methionine import ATP-binding protein m...   115   3e-28
METN_BORA1 RecName: Full=Methionine import ATP-binding protein m...   115   3e-28
METN2_OCEIH RecName: Full=Methionine import ATP-binding protein ...   115   3e-28
METN2_BACC1 RecName: Full=Methionine import ATP-binding protein ...   115   3e-28
RBSA1_STRAW RecName: Full=Ribose import ATP-binding protein rbsA...   115   4e-28
POTA_STRPF RecName: Full=Spermidine/putrescine import ATP-bindin...   115   4e-28
POTA_STRPD RecName: Full=Spermidine/putrescine import ATP-bindin...   115   4e-28
POTA_STRPC RecName: Full=Spermidine/putrescine import ATP-bindin...   115   4e-28
POTA_STRPB RecName: Full=Spermidine/putrescine import ATP-bindin...   115   4e-28
POTA_LISMF RecName: Full=Spermidine/putrescine import ATP-bindin...   115   4e-28
METN_LACBA RecName: Full=Methionine import ATP-binding protein m...   115   4e-28
METN_CORGL RecName: Full=Methionine import ATP-binding protein m...   115   4e-28
METN2_BACAN RecName: Full=Methionine import ATP-binding protein ...   115   4e-28
METN1_BACHK RecName: Full=Methionine import ATP-binding protein ...   115   4e-28
DRRA_STRPE RecName: Full=Daunorubicin resistance ATP-binding pro...   115   4e-28
CYSA2_AGRT5 RecName: Full=Sulfate/thiosulfate import ATP-binding...   115   4e-28
XYLG_YERPS RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
XYLG_YERPN RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
XYLG_YERPE RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
XYLG_YERPA RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
XYLG_SHIF8 RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
XYLG_SHIBS RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
XYLG_ECOUT RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
XYLG_ECOL6 RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
XYLG_ECOL5 RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
XYLG_ECO57 RecName: Full=Xylose import ATP-binding protein xylG;...   115   5e-28
POTA_STRPM RecName: Full=Spermidine/putrescine import ATP-bindin...   115   5e-28
POTA_STRP6 RecName: Full=Spermidine/putrescine import ATP-bindin...   115   5e-28
POTA_STRP3 RecName: Full=Spermidine/putrescine import ATP-bindin...   115   5e-28
POTA_LAWIP RecName: Full=Spermidine/putrescine import ATP-bindin...   115   5e-28
METN_BIFLO RecName: Full=Methionine import ATP-binding protein m...   115   5e-28
CYSA_RHILO RecName: Full=Sulfate/thiosulfate import ATP-binding ...   115   5e-28
CYSA2_RHIME RecName: Full=Sulfate/thiosulfate import ATP-binding...   115   5e-28
ARAG_MANSM RecName: Full=Arabinose import ATP-binding protein ar...   115   5e-28
YFIL_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...   114   7e-28
RGMG_RHOFD RecName: Full=Putative ribose/galactose/methyl galact...   114   7e-28
NODI_RHIL3 RecName: Full=Nod factor export ATP-binding protein I...   114   7e-28
XYLG_SHIFL RecName: Full=Xylose import ATP-binding protein xylG;...   114   9e-28
XYLG_HAEIN RecName: Full=Xylose import ATP-binding protein xylG;...   114   9e-28
POTA_OCEIH RecName: Full=Spermidine/putrescine import ATP-bindin...   114   9e-28
POTA_LACGA RecName: Full=Spermidine/putrescine import ATP-bindin...   114   9e-28
POTA_BACCR RecName: Full=Spermidine/putrescine import ATP-bindin...   114   9e-28
PHNC2_SYNJB RecName: Full=Phosphonates import ATP-binding protei...   114   9e-28
METN_STRPF RecName: Full=Methionine import ATP-binding protein m...   114   9e-28
METN_HAES1 RecName: Full=Methionine import ATP-binding protein m...   114   9e-28
METN_HAEI8 RecName: Full=Methionine import ATP-binding protein m...   114   9e-28
METN2_STAAW RecName: Full=Methionine import ATP-binding protein ...   114   9e-28
METN2_STAAS RecName: Full=Methionine import ATP-binding protein ...   114   9e-28
METN2_STAAC RecName: Full=Methionine import ATP-binding protein ...   114   9e-28
METN2_STAA8 RecName: Full=Methionine import ATP-binding protein ...   114   9e-28
METN2_STAA3 RecName: Full=Methionine import ATP-binding protein ...   114   9e-28
CBIO_METMJ RecName: Full=Cobalt import ATP-binding protein cbiO;...   114   9e-28
ARAG_YERPS RecName: Full=Arabinose import ATP-binding protein ar...   114   9e-28
ARAG_YERPN RecName: Full=Arabinose import ATP-binding protein ar...   114   9e-28
ARAG_YERPE RecName: Full=Arabinose import ATP-binding protein ar...   114   9e-28
ARAG_YERPA RecName: Full=Arabinose import ATP-binding protein ar...   114   9e-28
RBSA_CORGL RecName: Full=Ribose import ATP-binding protein rbsA;...   114   1e-27
POTA_STRP8 RecName: Full=Spermidine/putrescine import ATP-bindin...   114   1e-27
POTA_STRP1 RecName: Full=Spermidine/putrescine import ATP-bindin...   114   1e-27
POTA_PASMU RecName: Full=Spermidine/putrescine import ATP-bindin...   114   1e-27
POTA_LISMO RecName: Full=Spermidine/putrescine import ATP-bindin...   114   1e-27
POTA_LACJO RecName: Full=Spermidine/putrescine import ATP-bindin...   114   1e-27
POTA_BACHK RecName: Full=Spermidine/putrescine import ATP-bindin...   114   1e-27
POTA_BACCZ RecName: Full=Spermidine/putrescine import ATP-bindin...   114   1e-27
POTA_BACC1 RecName: Full=Spermidine/putrescine import ATP-bindin...   114   1e-27
POTA_BACAH RecName: Full=Spermidine/putrescine import ATP-bindin...   114   1e-27
PHNC2_NATPD RecName: Full=Phosphonates import ATP-binding protei...   114   1e-27
METN_CAMJR RecName: Full=Methionine import ATP-binding protein m...   114   1e-27
METN_CAMJE RecName: Full=Methionine import ATP-binding protein m...   114   1e-27
METN2_BACLD RecName: Full=Methionine import ATP-binding protein ...   114   1e-27
METN1_LISIN RecName: Full=Methionine import ATP-binding protein ...   114   1e-27
CBIO1_METHJ RecName: Full=Cobalt import ATP-binding protein cbiO...   114   1e-27
POTA_SPICI RecName: Full=Spermidine/putrescine import ATP-bindin...   113   2e-27
POTA_DESDG RecName: Full=Spermidine/putrescine import ATP-bindin...   113   2e-27
METN_HAEIN RecName: Full=Methionine import ATP-binding protein m...   113   2e-27
METN2_YERPE RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
METN2_YERPA RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
METN2_STAAN RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
METN2_STAAM RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
METN2_STAAB RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
METN1_YERPS RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
METN1_YERPN RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
GLNQ_BACST RecName: Full=Glutamine transport ATP-binding protein...   113   2e-27
Y5533_VIBVU RecName: Full=Putative ABC transporter ATP-binding p...   113   2e-27
Y1078_HAEIN RecName: Full=Probable amino-acid ABC transporter AT...   113   2e-27
METN_LACS1 RecName: Full=Methionine import ATP-binding protein m...   113   2e-27
METN3_BACSK RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
METN2_STAAR RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
METN2_BACCR RecName: Full=Methionine import ATP-binding protein ...   113   2e-27
Y1583_CLOPE RecName: Full=Putative ABC transporter ATP-binding p...   112   3e-27
XYLG_ECOLI RecName: Full=Xylose import ATP-binding protein xylG;...   112   3e-27
POTA_BACAN RecName: Full=Spermidine/putrescine import ATP-bindin...   112   3e-27
PHNC2_HALWD RecName: Full=Phosphonates import ATP-binding protei...   112   3e-27
MGLA_CLOPS RecName: Full=Galactose/methyl galactoside import ATP...   112   3e-27
METN_MYCSS RecName: Full=Methionine import ATP-binding protein m...   112   3e-27
METN1_PSEPF RecName: Full=Methionine import ATP-binding protein ...   112   3e-27
CYSA_PSESM RecName: Full=Sulfate/thiosulfate import ATP-binding ...   112   3e-27
Y1368_CLOAB RecName: Full=Putative ABC transporter ATP-binding p...   112   4e-27
RBSA3_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA...   112   4e-27
RBSA1_BURS3 RecName: Full=Ribose import ATP-binding protein rbsA...   112   4e-27
POTA_LACC3 RecName: Full=Spermidine/putrescine import ATP-bindin...   112   4e-27
PHNC_CHRSD RecName: Full=Phosphonates import ATP-binding protein...   112   4e-27
PHNC_ALCFA RecName: Full=Phosphonates import ATP-binding protein...   112   4e-27
NODI2_RHIME RecName: Full=Nod factor export ATP-binding protein ...   112   4e-27
METN_PARUW RecName: Full=Methionine import ATP-binding protein m...   112   4e-27
METN_MANSM RecName: Full=Methionine import ATP-binding protein m...   112   4e-27
METN_LACC3 RecName: Full=Methionine import ATP-binding protein m...   112   4e-27
METN1_STAAC RecName: Full=Methionine import ATP-binding protein ...   112   4e-27
METN1_STAA8 RecName: Full=Methionine import ATP-binding protein ...   112   4e-27
METN1_STAA3 RecName: Full=Methionine import ATP-binding protein ...   112   4e-27
METN1_PSE14 RecName: Full=Methionine import ATP-binding protein ...   112   4e-27
METN1_LISMO RecName: Full=Methionine import ATP-binding protein ...   112   4e-27
METN1_LISMF RecName: Full=Methionine import ATP-binding protein ...   112   4e-27
ALSA_ECOLI RecName: Full=D-allose import ATP-binding protein als...   112   4e-27
Y4347_VIBVY RecName: Full=Putative ABC transporter ATP-binding p...   112   5e-27
RGMG_GEOKA RecName: Full=Putative ribose/galactose/methyl galact...   112   5e-27
RBSA_OCEIH RecName: Full=Ribose import ATP-binding protein rbsA;...   112   5e-27
POTA_THEMA RecName: Full=Spermidine/putrescine import ATP-bindin...   112   5e-27
PHNC2_HALMA RecName: Full=Phosphonates import ATP-binding protei...   112   5e-27
OPUBA_BACSU RecName: Full=Choline transport ATP-binding protein ...   112   5e-27
NODI_RHISN RecName: Full=Nod factor export ATP-binding protein I...   112   5e-27
NODI_RHILV RecName: Full=Nod factor export ATP-binding protein I...   112   5e-27
METN1_STAAW RecName: Full=Methionine import ATP-binding protein ...   112   5e-27
METN1_STAAS RecName: Full=Methionine import ATP-binding protein ...   112   5e-27
RBSA2_BURS3 RecName: Full=Ribose import ATP-binding protein rbsA...   111   6e-27
POTA_LACDA RecName: Full=Spermidine/putrescine import ATP-bindin...   111   6e-27
METN1_PSEU2 RecName: Full=Methionine import ATP-binding protein ...   111   6e-27
METN1_PSEAB RecName: Full=Methionine import ATP-binding protein ...   111   6e-27
METN1_BACC1 RecName: Full=Methionine import ATP-binding protein ...   111   6e-27
RGMG1_AGRT5 RecName: Full=Putative ribose/galactose/methyl galac...   111   8e-27
RBSA_GEOKA RecName: Full=Ribose import ATP-binding protein rbsA;...   111   8e-27
RBSA_CLOPS RecName: Full=Ribose import ATP-binding protein rbsA;...   111   8e-27
RBSA_CLOP1 RecName: Full=Ribose import ATP-binding protein rbsA;...   111   8e-27
POTA_MARAV RecName: Full=Spermidine/putrescine import ATP-bindin...   111   8e-27
METN_RALEJ RecName: Full=Methionine import ATP-binding protein m...   111   8e-27
METN_MYXXD RecName: Full=Methionine import ATP-binding protein m...   111   8e-27
METN2_PSESM RecName: Full=Methionine import ATP-binding protein ...   111   8e-27
FBPC_ECOLI RecName: Full=Fe(3+) ions import ATP-binding protein ...   111   8e-27
FBPC_ECO57 RecName: Full=Fe(3+) ions import ATP-binding protein ...   111   8e-27
XYLG_ERWCT RecName: Full=Xylose import ATP-binding protein xylG;...   110   1e-26
UGPC2_RHIEC RecName: Full=sn-glycerol-3-phosphate import ATP-bin...   110   1e-26
RBSA_CLOPE RecName: Full=Ribose import ATP-binding protein rbsA;...   110   1e-26
RBSA_BACCR RecName: Full=Ribose import ATP-binding protein rbsA;...   110   1e-26
RBSA_BACC1 RecName: Full=Ribose import ATP-binding protein rbsA;...   110   1e-26
POTA_TREPA RecName: Full=Spermidine/putrescine import ATP-bindin...   110   1e-26
POTA_CLOPE RecName: Full=Spermidine/putrescine import ATP-bindin...   110   1e-26
POTA_CLOP1 RecName: Full=Spermidine/putrescine import ATP-bindin...   110   1e-26
MGLA_CLOPE RecName: Full=Galactose/methyl galactoside import ATP...   110   1e-26
MGLA_CLOP1 RecName: Full=Galactose/methyl galactoside import ATP...   110   1e-26
METN_CLOTE RecName: Full=Methionine import ATP-binding protein m...   110   1e-26
RBSA_RHOSR RecName: Full=Ribose import ATP-binding protein rbsA;...   110   1e-26
POTA_LACS1 RecName: Full=Spermidine/putrescine import ATP-bindin...   110   1e-26
POTA_HAEDU RecName: Full=Spermidine/putrescine import ATP-bindin...   110   1e-26
METN_RHOPB RecName: Full=Methionine import ATP-binding protein m...   110   1e-26
METN4_OCEIH RecName: Full=Methionine import ATP-binding protein ...   110   1e-26
METN2_ENTFA RecName: Full=Methionine import ATP-binding protein ...   110   1e-26
METN1_SALTY RecName: Full=Methionine import ATP-binding protein ...   110   1e-26
METN1_SALCH RecName: Full=Methionine import ATP-binding protein ...   110   1e-26
CYSA_ERWCT RecName: Full=Sulfate/thiosulfate import ATP-binding ...   110   1e-26
XYLG_GEOKA RecName: Full=Xylose import ATP-binding protein xylG;...   110   2e-26
RGMG_HAHCH RecName: Full=Putative ribose/galactose/methyl galact...   110   2e-26
RGMG1_BURS3 RecName: Full=Putative ribose/galactose/methyl galac...   110   2e-26
RBSA_BACHK RecName: Full=Ribose import ATP-binding protein rbsA;...   110   2e-26
RBSA_BACCZ RecName: Full=Ribose import ATP-binding protein rbsA;...   110   2e-26
RBSA_BACAN RecName: Full=Ribose import ATP-binding protein rbsA;...   110   2e-26
POTA_MESFL RecName: Full=Spermidine/putrescine import ATP-bindin...   110   2e-26
POTA_LACBA RecName: Full=Spermidine/putrescine import ATP-bindin...   110   2e-26
NODI1_RHIME RecName: Full=Nod factor export ATP-binding protein ...   110   2e-26
METN_PASMU RecName: Full=Methionine import ATP-binding protein m...   110   2e-26
LSRA_PHOTE RecName: Full=Autoinducer 2 import ATP-binding protei...   110   2e-26
Y382_RHIME RecName: Full=Uncharacterized ABC transporter ATP-bin...   109   2e-26
XYLG_THEP3 RecName: Full=Xylose import ATP-binding protein xylG;...   109   2e-26
RGMG2_AGRT5 RecName: Full=Putative ribose/galactose/methyl galac...   109   2e-26
POTA_GEOKA RecName: Full=Spermidine/putrescine import ATP-bindin...   109   2e-26
METN_STRMU RecName: Full=Methionine import ATP-binding protein m...   109   2e-26
METN_RHORT RecName: Full=Methionine import ATP-binding protein m...   109   2e-26
METN_RALME RecName: Full=Methionine import ATP-binding protein m...   109   2e-26
METN_CORJK RecName: Full=Methionine import ATP-binding protein m...   109   2e-26
METN3_ERWCT RecName: Full=Methionine import ATP-binding protein ...   109   2e-26
METN2_STAES RecName: Full=Methionine import ATP-binding protein ...   109   2e-26
METN1_STAEQ RecName: Full=Methionine import ATP-binding protein ...   109   2e-26
METN1_STAAR RecName: Full=Methionine import ATP-binding protein ...   109   2e-26
METN1_SALPA RecName: Full=Methionine import ATP-binding protein ...   109   2e-26
CYSA2_SHEON RecName: Full=Sulfate/thiosulfate import ATP-binding...   109   2e-26
CBIO_METMP RecName: Full=Cobalt import ATP-binding protein cbiO;...   109   2e-26
RGMG_PSEF5 RecName: Full=Putative ribose/galactose/methyl galact...   109   3e-26
RGMG1_RHIME RecName: Full=Putative ribose/galactose/methyl galac...   109   3e-26
RBSA2_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA...   109   3e-26
POTA_LEUMM RecName: Full=Spermidine/putrescine import ATP-bindin...   109   3e-26
POTA_LACDB RecName: Full=Spermidine/putrescine import ATP-bindin...   109   3e-26
POTA_LACAC RecName: Full=Spermidine/putrescine import ATP-bindin...   109   3e-26
MGLA_CLOTE RecName: Full=Galactose/methyl galactoside import ATP...   109   3e-26
METN_XANC5 RecName: Full=Methionine import ATP-binding protein m...   109   3e-26
METN_LEGPL RecName: Full=Methionine import ATP-binding protein m...   109   3e-26
METN1_LACPL RecName: Full=Methionine import ATP-binding protein ...   109   3e-26
METN1_BACLD RecName: Full=Methionine import ATP-binding protein ...   109   3e-26
WTPC_PYRKO RecName: Full=Molybdate/tungstate import ATP-binding ...   108   4e-26
RGMG3_BURCM RecName: Full=Putative ribose/galactose/methyl galac...   108   4e-26
RGMG3_AGRT5 RecName: Full=Putative ribose/galactose/methyl galac...   108   4e-26
POTA_LEGPA RecName: Full=Spermidine/putrescine import ATP-bindin...   108   4e-26
METN_XANCP RecName: Full=Methionine import ATP-binding protein m...   108   4e-26
METN_XANC8 RecName: Full=Methionine import ATP-binding protein m...   108   4e-26
METN_XANAC RecName: Full=Methionine import ATP-binding protein m...   108   4e-26
METN_LEGPH RecName: Full=Methionine import ATP-binding protein m...   108   4e-26
METN1_STAAN RecName: Full=Methionine import ATP-binding protein ...   108   4e-26
METN1_STAAM RecName: Full=Methionine import ATP-binding protein ...   108   4e-26
METN1_PSEAE RecName: Full=Methionine import ATP-binding protein ...   108   4e-26
METN1_BACAN RecName: Full=Methionine import ATP-binding protein ...   108   4e-26
MACB_SYNFM RecName: Full=Macrolide export ATP-binding/permease p...   108   4e-26
FBPC_PHOLL RecName: Full=Fe(3+) ions import ATP-binding protein ...   108   4e-26
BRAG_PSEAE RecName: Full=High-affinity branched-chain amino acid...   108   4e-26
Y133_METTH RecName: Full=Putative ABC transporter ATP-binding pr...   108   5e-26
RBSA_VIBCH RecName: Full=Ribose import ATP-binding protein rbsA;...   108   5e-26
POTA_LEGPH RecName: Full=Spermidine/putrescine import ATP-bindin...   108   5e-26
POTA_CLOPS RecName: Full=Spermidine/putrescine import ATP-bindin...   108   5e-26
MGLA_TREDE RecName: Full=Galactose/methyl galactoside import ATP...   108   5e-26
METN_HAEDU RecName: Full=Methionine import ATP-binding protein m...   108   5e-26
METN_COXBU RecName: Full=Methionine import ATP-binding protein m...   108   5e-26
METN2_PSEE4 RecName: Full=Methionine import ATP-binding protein ...   108   5e-26
LSRA_YERPS RecName: Full=Autoinducer 2 import ATP-binding protei...   108   5e-26
LSRA_YERPB RecName: Full=Autoinducer 2 import ATP-binding protei...   108   5e-26
FBPC_FUSNN RecName: Full=Fe(3+) ions import ATP-binding protein ...   108   5e-26
CYSA_BURCE RecName: Full=Sulfate/thiosulfate import ATP-binding ...   108   5e-26
UGPC2_AGRT5 RecName: Full=sn-glycerol-3-phosphate import ATP-bin...   108   7e-26
RBSA_STRA1 RecName: Full=Ribose import ATP-binding protein rbsA;...   108   7e-26
NODI_BURPS RecName: Full=Nod factor export ATP-binding protein I...   108   7e-26
NODI_BURP1 RecName: Full=Nod factor export ATP-binding protein I...   108   7e-26
NODI_BURMA RecName: Full=Nod factor export ATP-binding protein I...   108   7e-26
METN_XANOM RecName: Full=Methionine import ATP-binding protein m...   108   7e-26
METN_SYNWW RecName: Full=Methionine import ATP-binding protein m...   108   7e-26
METN1_SALTI RecName: Full=Methionine import ATP-binding protein ...   108   7e-26
METN1_RHOPA RecName: Full=Methionine import ATP-binding protein ...   108   7e-26
FBPC_BRUAB RecName: Full=Fe(3+) ions import ATP-binding protein ...   108   7e-26
FBPC_BRUA2 RecName: Full=Fe(3+) ions import ATP-binding protein ...   108   7e-26
UGPC1_RHIL3 RecName: Full=sn-glycerol-3-phosphate import ATP-bin...   107   9e-26
RGMG2_RHIEC RecName: Full=Putative ribose/galactose/methyl galac...   107   9e-26
RBSA_SHIDS RecName: Full=Ribose import ATP-binding protein rbsA;...   107   9e-26
RBSA2_RHIME RecName: Full=Ribose import ATP-binding protein rbsA...   107   9e-26
RBSA2_BURP1 RecName: Full=Ribose import ATP-binding protein rbsA...   107   9e-26
POTA_HAES1 RecName: Full=Spermidine/putrescine import ATP-bindin...   107   9e-26
PHNC_LACPL RecName: Full=Phosphonates import ATP-binding protein...   107   9e-26
METN_SHISS RecName: Full=Methionine import ATP-binding protein m...   107   9e-26
METN_SHIDS RecName: Full=Methionine import ATP-binding protein m...   107   9e-26
METN_SHIBS RecName: Full=Methionine import ATP-binding protein m...   107   9e-26
METN_ECOUT RecName: Full=Methionine import ATP-binding protein m...   107   9e-26
METN_ECOL6 RecName: Full=Methionine import ATP-binding protein m...   107   9e-26
METN_ECOL5 RecName: Full=Methionine import ATP-binding protein m...   107   9e-26
METN_ECO57 RecName: Full=Methionine import ATP-binding protein m...   107   9e-26
METN2_YERPS RecName: Full=Methionine import ATP-binding protein ...   107   9e-26
METN2_SALPA RecName: Full=Methionine import ATP-binding protein ...   107   9e-26
METN2_BACHK RecName: Full=Methionine import ATP-binding protein ...   107   9e-26
METN1_STAAB RecName: Full=Methionine import ATP-binding protein ...   107   9e-26
METN1_RHOSR RecName: Full=Methionine import ATP-binding protein ...   107   9e-26
METN1_BACCZ RecName: Full=Methionine import ATP-binding protein ...   107   9e-26
CBIO_METJA RecName: Full=Putative cobalt import ATP-binding prot...   107   9e-26
RBSA_THETN RecName: Full=Ribose import ATP-binding protein rbsA;...   107   1e-25
POTA_LISW6 RecName: Full=Spermidine/putrescine import ATP-bindin...   107   1e-25
PHNC1_RHOPB RecName: Full=Phosphonates import ATP-binding protei...   107   1e-25
MGLA1_PHOPR RecName: Full=Galactose/methyl galactoside import AT...   107   1e-25
METN_ECOLI RecName: Full=Methionine import ATP-binding protein m...   107   1e-25
METN_DESHY RecName: Full=Methionine import ATP-binding protein m...   107   1e-25
METN_BACHD RecName: Full=Methionine import ATP-binding protein m...   107   1e-25
METN2_BACSK RecName: Full=Methionine import ATP-binding protein ...   107   1e-25
LSRA_YERPY RecName: Full=Autoinducer 2 import ATP-binding protei...   107   1e-25
RGMG_RHIL3 RecName: Full=Putative ribose/galactose/methyl galact...   107   1e-25
RBSA_STRA3 RecName: Full=Ribose import ATP-binding protein rbsA;...   107   1e-25
RBSA_BURPS RecName: Full=Ribose import ATP-binding protein rbsA;...   107   1e-25
POTA_MANSM RecName: Full=Spermidine/putrescine import ATP-bindin...   107   1e-25
POTA_LEGPL RecName: Full=Spermidine/putrescine import ATP-bindin...   107   1e-25
PHNC_THICR RecName: Full=Phosphonates import ATP-binding protein...   107   1e-25
PHNC3_ANASP RecName: Full=Phosphonates import ATP-binding protei...   107   1e-25
PHNC1_ROSDO RecName: Full=Phosphonates import ATP-binding protei...   107   1e-25
METN_XANOR RecName: Full=Methionine import ATP-binding protein m...   107   1e-25
METN3_BACCZ RecName: Full=Methionine import ATP-binding protein ...   107   1e-25
METN3_BACAN RecName: Full=Methionine import ATP-binding protein ...   107   1e-25
METN2_LISIN RecName: Full=Methionine import ATP-binding protein ...   107   1e-25
FBPC1_ERWCT RecName: Full=Fe(3+) ions import ATP-binding protein...   107   1e-25
CYSA_BACC1 RecName: Full=Sulfate/thiosulfate import ATP-binding ...   107   1e-25
ARAG_RHIEC RecName: Full=Arabinose import ATP-binding protein ar...   107   1e-25
WTPC_PYRHO RecName: Full=Molybdate/tungstate import ATP-binding ...   106   2e-25
UGPC_PARDP RecName: Full=sn-glycerol-3-phosphate import ATP-bind...   106   2e-25
UGPC1_AGRT5 RecName: Full=sn-glycerol-3-phosphate import ATP-bin...   106   2e-25
RGMG1_RHIEC RecName: Full=Putative ribose/galactose/methyl galac...   106   2e-25
RBSA_STRA5 RecName: Full=Ribose import ATP-binding protein rbsA;...   106   2e-25
RBSA3_RHIEC RecName: Full=Ribose import ATP-binding protein rbsA...   106   2e-25
POTG_ECOLI RecName: Full=Putrescine transport ATP-binding protei...   106   2e-25
POTA_VIBCH RecName: Full=Spermidine/putrescine import ATP-bindin...   106   2e-25
POTA_STRR6 RecName: Full=Spermidine/putrescine import ATP-bindin...   106   2e-25
POTA_STRPN RecName: Full=Spermidine/putrescine import ATP-bindin...   106   2e-25
POTA_STRP2 RecName: Full=Spermidine/putrescine import ATP-bindin...   106   2e-25
POTA_LISIN RecName: Full=Spermidine/putrescine import ATP-bindin...   106   2e-25
METN_SHIFL RecName: Full=Methionine import ATP-binding protein m...   106   2e-25
METN_SHIF8 RecName: Full=Methionine import ATP-binding protein m...   106   2e-25
METN2_LISMF RecName: Full=Methionine import ATP-binding protein ...   106   2e-25
METN1_PSEPK RecName: Full=Methionine import ATP-binding protein ...   106   2e-25
LSRA_YERP3 RecName: Full=Autoinducer 2 import ATP-binding protei...   106   2e-25
GLNQ_ECOLI RecName: Full=Glutamine transport ATP-binding protein...   106   2e-25
ZNUC_PSEPK RecName: Full=Zinc import ATP-binding protein znuC;  ...   106   3e-25
TCYC_BACSU RecName: Full=L-cystine import ATP-binding protein tc...   106   3e-25
OPPF_STRMU RecName: Full=Oligopeptide transport ATP-binding prot...   106   3e-25
METN_STRT1 RecName: Full=Methionine import ATP-binding protein m...   106   3e-25
METN_FUSNN RecName: Full=Methionine import ATP-binding protein m...   106   3e-25
METN2_LISMO RecName: Full=Methionine import ATP-binding protein ...   106   3e-25
METN1_BACCR RecName: Full=Methionine import ATP-binding protein ...   106   3e-25
ZNUC_HALHL RecName: Full=Zinc import ATP-binding protein znuC;  ...   105   3e-25
YXEO_BACSU RecName: Full=Probable amino-acid import ATP-binding ...   105   3e-25
UGPC_RHIME RecName: Full=sn-glycerol-3-phosphate import ATP-bind...   105   3e-25
RBSA_VIBVU RecName: Full=Ribose import ATP-binding protein rbsA;...   105   3e-25
PSTB1_THETN RecName: Full=Phosphate import ATP-binding protein p...   105   3e-25
POTA_VIBVY RecName: Full=Spermidine/putrescine import ATP-bindin...   105   3e-25
POTA_VIBVU RecName: Full=Spermidine/putrescine import ATP-bindin...   105   3e-25
PHNC_WOLSU RecName: Full=Phosphonates import ATP-binding protein...   105   3e-25
NODI_BURXL RecName: Full=Nod factor export ATP-binding protein I...   105   3e-25
NASD_KLEOX RecName: Full=Nitrate transport protein nasD;              105   3e-25
METN_SYMTH RecName: Full=Methionine import ATP-binding protein m...   105   3e-25
METN_STRT2 RecName: Full=Methionine import ATP-binding protein m...   105   3e-25
METN_STAHJ RecName: Full=Methionine import ATP-binding protein m...   105   3e-25
METN_POLSJ RecName: Full=Methionine import ATP-binding protein m...   105   3e-25
METN2_SALTY RecName: Full=Methionine import ATP-binding protein ...   105   3e-25
METN1_ENTFA RecName: Full=Methionine import ATP-binding protein ...   105   3e-25
FBPC_BRUSU RecName: Full=Fe(3+) ions import ATP-binding protein ...   105   3e-25
ARAG_ERWCT RecName: Full=Arabinose import ATP-binding protein ar...   105   3e-25
RGMG_PSEU2 RecName: Full=Putative ribose/galactose/methyl galact...   105   4e-25
RGMG_BACHD RecName: Full=Putative ribose/galactose/methyl galact...   105   4e-25
RBSA_VIBVY RecName: Full=Ribose import ATP-binding protein rbsA;...   105   4e-25
RBSA3_RHIME RecName: Full=Ribose import ATP-binding protein rbsA...   105   4e-25
POTA_LACPL RecName: Full=Spermidine/putrescine import ATP-bindin...   105   4e-25
POTA_HAHCH RecName: Full=Spermidine/putrescine import ATP-bindin...   105   4e-25
PHNC_RHIEC RecName: Full=Phosphonates import ATP-binding protein...   105   4e-25
PHNC1_RHOP5 RecName: Full=Phosphonates import ATP-binding protei...   105   4e-25
PHNC1_ANASP RecName: Full=Phosphonates import ATP-binding protei...   105   4e-25
NODI_RHIGA RecName: Full=Nod factor export ATP-binding protein I...   105   4e-25
METN3_BACC1 RecName: Full=Methionine import ATP-binding protein ...   105   4e-25
METN2_SALTI RecName: Full=Methionine import ATP-binding protein ...   105   4e-25
LSRA_YERPP RecName: Full=Autoinducer 2 import ATP-binding protei...   105   4e-25
LSRA_YERPN RecName: Full=Autoinducer 2 import ATP-binding protei...   105   4e-25
LSRA_YERPG RecName: Full=Autoinducer 2 import ATP-binding protei...   105   4e-25
LSRA_YERPE RecName: Full=Autoinducer 2 import ATP-binding protei...   105   4e-25
LSRA_YERPA RecName: Full=Autoinducer 2 import ATP-binding protei...   105   4e-25
LSRA_YERE8 RecName: Full=Autoinducer 2 import ATP-binding protei...   105   4e-25
GLNQ_BACSU RecName: Full=Glutamine transport ATP-binding protein...   105   4e-25
CYSA_MYCTU RecName: Full=Sulfate/thiosulfate import ATP-binding ...   105   4e-25
CYSA_MYCBO RecName: Full=Sulfate/thiosulfate import ATP-binding ...   105   4e-25
CMPD_SYNY3 RecName: Full=Bicarbonate transport ATP-binding prote...   105   4e-25
ARTM_BACSU RecName: Full=Arginine transport ATP-binding protein ...   105   4e-25
WTPC_PYRFU RecName: Full=Molybdate/tungstate import ATP-binding ...   105   6e-25
POTA_STRA5 RecName: Full=Spermidine/putrescine import ATP-bindin...   105   6e-25
POTA_STRA3 RecName: Full=Spermidine/putrescine import ATP-bindin...   105   6e-25
POTA_STRA1 RecName: Full=Spermidine/putrescine import ATP-bindin...   105   6e-25
POTA_DESVH RecName: Full=Spermidine/putrescine import ATP-bindin...   105   6e-25
METN_VIBCH RecName: Full=Methionine import ATP-binding protein m...   105   6e-25
METN_RHOP5 RecName: Full=Methionine import ATP-binding protein m...   105   6e-25
METN_CLOAB RecName: Full=Methionine import ATP-binding protein m...   105   6e-25
METN_CARHZ RecName: Full=Methionine import ATP-binding protein m...   105   6e-25
METN3_BACCR RecName: Full=Methionine import ATP-binding protein ...   105   6e-25
METN2_YERPN RecName: Full=Methionine import ATP-binding protein ...   105   6e-25
METN2_SALCH RecName: Full=Methionine import ATP-binding protein ...   105   6e-25
METN1_YERPE RecName: Full=Methionine import ATP-binding protein ...   105   6e-25
METN1_YERPA RecName: Full=Methionine import ATP-binding protein ...   105   6e-25
FBPC_RHILO RecName: Full=Fe(3+) ions import ATP-binding protein ...   105   6e-25
FBPC_BRUME RecName: Full=Fe(3+) ions import ATP-binding protein ...   105   6e-25
CYSA_METCA RecName: Full=Sulfate/thiosulfate import ATP-binding ...   105   6e-25
ARAG_RHIL3 RecName: Full=Arabinose import ATP-binding protein ar...   105   6e-25
Y1508_METJA RecName: Full=Uncharacterized ABC transporter ATP-bi...   104   7e-25
UGPC_SILPO RecName: Full=sn-glycerol-3-phosphate import ATP-bind...   104   7e-25
UGPC_RHOS4 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...   104   7e-25
RGMG2_RHIME RecName: Full=Putative ribose/galactose/methyl galac...   104   7e-25
RBSA_VIBF1 RecName: Full=Ribose import ATP-binding protein rbsA;...   104   7e-25
RBSA_HAEI8 RecName: Full=Ribose import ATP-binding protein rbsA;...   104   7e-25
PHNC2_OCEIH RecName: Full=Phosphonates import ATP-binding protei...   104   7e-25
NODI_RALME RecName: Full=Nod factor export ATP-binding protein I...   104   7e-25
METN_LEUMM RecName: Full=Methionine import ATP-binding protein m...   104   7e-25
METN2_PSEAE RecName: Full=Methionine import ATP-binding protein ...   104   7e-25
METN2_PSEAB RecName: Full=Methionine import ATP-binding protein ...   104   7e-25
CYSA_BURPS RecName: Full=Sulfate/thiosulfate import ATP-binding ...   104   7e-25
CYSA_BURMA RecName: Full=Sulfate/thiosulfate import ATP-binding ...   104   7e-25
CBIO1_BACC1 RecName: Full=Cobalt import ATP-binding protein cbiO...   104   7e-25
ARAG_SHISS RecName: Full=Arabinose import ATP-binding protein ar...   104   7e-25
ARAG_SHIDS RecName: Full=Arabinose import ATP-binding protein ar...   104   7e-25
ARAG_SHIBS RecName: Full=Arabinose import ATP-binding protein ar...   104   7e-25
ARAG_ECOLI RecName: Full=Arabinose import ATP-binding protein ar...   104   7e-25
ARAG_ECOL6 RecName: Full=Arabinose import ATP-binding protein ar...   104   7e-25
ARAG_ECO57 RecName: Full=Arabinose import ATP-binding protein ar...   104   7e-25
Y873_METJA RecName: Full=Uncharacterized ABC transporter ATP-bin...   104   1e-24
RGMG3_BURCH RecName: Full=Putative ribose/galactose/methyl galac...   104   1e-24
RGMG3_BURCA RecName: Full=Putative ribose/galactose/methyl galac...   104   1e-24
RBSA_MESSB RecName: Full=Ribose import ATP-binding protein rbsA;...   104   1e-24
RBSA_HAEIN RecName: Full=Ribose import ATP-binding protein rbsA;...   104   1e-24
RBSA1_STRCO RecName: Full=Ribose import ATP-binding protein rbsA...   104   1e-24
POTA_VIBF1 RecName: Full=Spermidine/putrescine import ATP-bindin...   104   1e-24
POTA_NITEU RecName: Full=Spermidine/putrescine import ATP-bindin...   104   1e-24
POTA_NITEC RecName: Full=Spermidine/putrescine import ATP-bindin...   104   1e-24
POTA_ACTAC RecName: Full=Spermidine/putrescine import ATP-bindin...   104   1e-24
METN_RHOPS RecName: Full=Methionine import ATP-binding protein m...   104   1e-24
METN_RHIEC RecName: Full=Methionine import ATP-binding protein m...   104   1e-24
METN_LACLA RecName: Full=Methionine import ATP-binding protein m...   104   1e-24
METN1_PSEF5 RecName: Full=Methionine import ATP-binding protein ...   104   1e-24
ARAG_SHIFL RecName: Full=Arabinose import ATP-binding protein ar...   104   1e-24
ARAG_ECOUT RecName: Full=Arabinose import ATP-binding protein ar...   104   1e-24
ARAG_ECOL5 RecName: Full=Arabinose import ATP-binding protein ar...   104   1e-24
UGPC_SILST RecName: Full=sn-glycerol-3-phosphate import ATP-bind...   103   1e-24
RGMG_PSESM RecName: Full=Putative ribose/galactose/methyl galact...   103   1e-24
RBSA_VIBPA RecName: Full=Ribose import ATP-binding protein rbsA;...   103   1e-24
RBSA_CHRVO RecName: Full=Ribose import ATP-binding protein rbsA;...   103   1e-24
RBSA2_BURCM RecName: Full=Ribose import ATP-binding protein rbsA...   103   1e-24
PSTB_TROWT RecName: Full=Phosphate import ATP-binding protein ps...   103   1e-24
POTA_STRMU RecName: Full=Spermidine/putrescine import ATP-bindin...   103   1e-24
METN_RHIL3 RecName: Full=Methionine import ATP-binding protein m...   103   1e-24
METN_LACLM RecName: Full=Methionine import ATP-binding protein m...   103   1e-24
CYSA_PSEPK RecName: Full=Sulfate/thiosulfate import ATP-binding ...   103   1e-24
CYSA_MANSM RecName: Full=Sulfate/thiosulfate import ATP-binding ...   103   1e-24
ARAG_PSEPF RecName: Full=Arabinose import ATP-binding protein ar...   103   1e-24
RGMG2_BURCH RecName: Full=Putative ribose/galactose/methyl galac...   103   2e-24
RGMG2_BURCA RecName: Full=Putative ribose/galactose/methyl galac...   103   2e-24
RBSA_LACLA RecName: Full=Ribose import ATP-binding protein rbsA;...   103   2e-24
PROV_ECOLI RecName: Full=Glycine betaine/L-proline transport ATP...   103   2e-24
POTA_STRTD RecName: Full=Spermidine/putrescine import ATP-bindin...   103   2e-24
POTA_STRT2 RecName: Full=Spermidine/putrescine import ATP-bindin...   103   2e-24
POTA_STRT1 RecName: Full=Spermidine/putrescine import ATP-bindin...   103   2e-24
POTA_RHILO RecName: Full=Spermidine/putrescine import ATP-bindin...   103   2e-24
POTA_MYCVP RecName: Full=Spermidine/putrescine import ATP-bindin...   103   2e-24
PHNC1_SILST RecName: Full=Phosphonates import ATP-binding protei...   103   2e-24
METN_VIBPA RecName: Full=Methionine import ATP-binding protein m...   103   2e-24
METN_SODGM RecName: Full=Methionine import ATP-binding protein m...   103   2e-24
LSRA_ENT38 RecName: Full=Autoinducer 2 import ATP-binding protei...   103   2e-24
PROV_SALTY RecName: Full=Glycine betaine/L-proline transport ATP...   103   2e-24
POTA_LACSS RecName: Full=Spermidine/putrescine import ATP-bindin...   103   2e-24
POTA_HAEIN RecName: Full=Spermidine/putrescine import ATP-bindin...   103   2e-24
POTA_HAEI8 RecName: Full=Spermidine/putrescine import ATP-bindin...   103   2e-24
NODI_RALSO RecName: Full=Nod factor export ATP-binding protein I...   103   2e-24
METN_PHOPR RecName: Full=Methionine import ATP-binding protein m...   103   2e-24
METN2_OENOB RecName: Full=Methionine import ATP-binding protein ...   103   2e-24
CYSA_NEIMA RecName: Full=Sulfate/thiosulfate import ATP-binding ...   103   2e-24
CYSA_BACCR RecName: Full=Sulfate/thiosulfate import ATP-binding ...   103   2e-24
ARTP_HAEIN RecName: Full=Arginine transport ATP-binding protein ...   103   2e-24
YVFR_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...   102   3e-24
Y258_MYCPN RecName: Full=Putative carbohydrate transport ATP-bin...   102   3e-24
Y2240_PHOPR RecName: Full=Putative ABC transporter ATP-binding p...   102   3e-24
TCYN_BACSU RecName: Full=L-cystine import ATP-binding protein tc...   102   3e-24
PHNC_DESVH RecName: Full=Phosphonates import ATP-binding protein...   102   3e-24
METN_PHOLL RecName: Full=Methionine import ATP-binding protein m...   102   3e-24
METN_LACLS RecName: Full=Methionine import ATP-binding protein m...   102   3e-24
METN_LACJO RecName: Full=Methionine import ATP-binding protein m...   102   3e-24
METN2_PSEPF RecName: Full=Methionine import ATP-binding protein ...   102   3e-24
METN1_ERWCT RecName: Full=Methionine import ATP-binding protein ...   102   3e-24
LSRA_KLEP7 RecName: Full=Autoinducer 2 import ATP-binding protei...   102   3e-24
HMUV_RHOPB RecName: Full=Hemin import ATP-binding protein hmuV; ...   102   3e-24
CYSA_PSEAE RecName: Full=Sulfate/thiosulfate import ATP-binding ...   102   3e-24
CYSA_NEIMB RecName: Full=Sulfate/thiosulfate import ATP-binding ...   102   3e-24
CYSA_LEPIN RecName: Full=Sulfate/thiosulfate import ATP-binding ...   102   3e-24
CYSA_LEPIC RecName: Full=Sulfate/thiosulfate import ATP-binding ...   102   3e-24
CYSA_CUCSA RecName: Full=Sulfate/thiosulfate import ATP-binding ...   102   3e-24
Y3016_METMA RecName: Full=Putative ABC transporter ATP-binding p...   102   4e-24
Y1747_METAC RecName: Full=Putative ABC transporter ATP-binding p...   102   4e-24
POTA_LACLA RecName: Full=Spermidine/putrescine import ATP-bindin...   102   4e-24
PHNC_RHIL3 RecName: Full=Phosphonates import ATP-binding protein...   102   4e-24
METN_VIBF1 RecName: Full=Methionine import ATP-binding protein m...   102   4e-24
MALK_VIBCH RecName: Full=Maltose/maltodextrin import ATP-binding...   102   4e-24
CBIO1_BACLD RecName: Full=Cobalt import ATP-binding protein cbiO...   102   4e-24
CBIO1_BACHK RecName: Full=Cobalt import ATP-binding protein cbiO...   102   4e-24
CBIO1_BACCR RecName: Full=Cobalt import ATP-binding protein cbiO...   102   4e-24
CBIO1_BACAN RecName: Full=Cobalt import ATP-binding protein cbiO...   102   4e-24
CBIO1_BACAH RecName: Full=Cobalt import ATP-binding protein cbiO...   102   4e-24
ZNUC_PSESM RecName: Full=Zinc import ATP-binding protein znuC;  ...   102   5e-24
ZNUC_PSE14 RecName: Full=Zinc import ATP-binding protein znuC;  ...   102   5e-24
Y5482_VIBPA RecName: Full=Putative ABC transporter ATP-binding p...   102   5e-24
UGPC_CHRVO RecName: Full=sn-glycerol-3-phosphate import ATP-bind...   102   5e-24
RBSA2_RHILO RecName: Full=Ribose import ATP-binding protein rbsA...   102   5e-24
POTA_LACLS RecName: Full=Spermidine/putrescine import ATP-bindin...   102   5e-24
POTA_ANAVT RecName: Full=Spermidine/putrescine import ATP-bindin...   102   5e-24
POTA_ANASP RecName: Full=Spermidine/putrescine import ATP-bindin...   102   5e-24
PHNC_RHIME RecName: Full=Phosphonates import ATP-binding protein...   102   5e-24
PHNC_HYPNA RecName: Full=Phosphonates import ATP-binding protein...   102   5e-24
NODI_BURTA RecName: Full=Nod factor export ATP-binding protein I...   102   5e-24
METN_CORDI RecName: Full=Methionine import ATP-binding protein m...   102   5e-24
METN_CHRSD RecName: Full=Methionine import ATP-binding protein m...   102   5e-24
FBPC_AGRT5 RecName: Full=Fe(3+) ions import ATP-binding protein ...   102   5e-24
CYSA1_AGRT5 RecName: Full=Sulfate/thiosulfate import ATP-binding...   102   5e-24
CBIO_METST RecName: Full=Cobalt import ATP-binding protein cbiO;...   102   5e-24
ARAG_CHRSD RecName: Full=Arabinose import ATP-binding protein ar...   102   5e-24
Y1281_GEOSL RecName: Full=Putative ABC transporter ATP-binding p...   101   6e-24
MGLA_TREPA RecName: Full=Galactose/methyl galactoside import ATP...   101   6e-24
METN1_OCEIH RecName: Full=Methionine import ATP-binding protein ...   101   6e-24
LIVF_METJA RecName: Full=Probable branched-chain amino acid tran...   101   6e-24
CYSA_SHIFL RecName: Full=Sulfate/thiosulfate import ATP-binding ...   101   6e-24
CYSA_ECOLI RecName: Full=Sulfate/thiosulfate import ATP-binding ...   101   6e-24
CYSA_ECOL6 RecName: Full=Sulfate/thiosulfate import ATP-binding ...   101   6e-24
CYSA_ECO57 RecName: Full=Sulfate/thiosulfate import ATP-binding ...   101   6e-24
ARAG_RHIME RecName: Full=Arabinose import ATP-binding protein ar...   101   6e-24
ARAG_BACHD RecName: Full=L-arabinose transport ATP-binding prote...   101   6e-24
ZNUC_ROSDO RecName: Full=Zinc import ATP-binding protein znuC;  ...   101   8e-24
XYLG_MOOTA RecName: Full=Xylose import ATP-binding protein xylG;...   101   8e-24
UGPC_RHOS1 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...   101   8e-24
RBSA_PHOPR RecName: Full=Ribose import ATP-binding protein rbsA;...   101   8e-24
POTA_VIBPA RecName: Full=Spermidine/putrescine import ATP-bindin...   101   8e-24
POTA_TRIEI RecName: Full=Spermidine/putrescine import ATP-bindin...   101   8e-24
FBPC_PSEPF RecName: Full=Fe(3+) ions import ATP-binding protein ...   101   8e-24
CYSA_SALTY RecName: Full=Sulfate/thiosulfate import ATP-binding ...   101   8e-24
CYSA_SALTI RecName: Full=Sulfate/thiosulfate import ATP-binding ...   101   8e-24
CBIO1_BACCZ RecName: Full=Cobalt import ATP-binding protein cbiO...   101   8e-24
Y068_PYRFU RecName: Full=Putative ABC transporter ATP-binding pr...   100   1e-23
Y020_ONYPE RecName: Full=Putative ABC transporter ATP-binding pr...   100   1e-23
RBSA_RHOS4 RecName: Full=Ribose import ATP-binding protein rbsA;...   100   1e-23
PSTB_TROW8 RecName: Full=Phosphate import ATP-binding protein ps...   100   1e-23
PHNC_HALSA RecName: Full=Phosphonates import ATP-binding protein...   100   1e-23
METN2_BURXL RecName: Full=Methionine import ATP-binding protein ...   100   1e-23
CYSA_YERPS RecName: Full=Sulfate/thiosulfate import ATP-binding ...   100   1e-23
CYSA_NITEU RecName: Full=Sulfate/thiosulfate import ATP-binding ...   100   1e-23
CYSA_ACIAD RecName: Full=Sulfate/thiosulfate import ATP-binding ...   100   1e-23
CYSA1_RHIME RecName: Full=Sulfate/thiosulfate import ATP-binding...   100   1e-23
Y3745_BRUSU RecName: Full=Putative ATP-binding protein BRA0745; ...   100   1e-23
Y2993_BRUA2 RecName: Full=Putative ATP-binding protein BAB2_0493...   100   1e-23
Y2787_BRUAB RecName: Full=Putative ATP-binding protein BruAb2_04...   100   1e-23
Y149_LACPL RecName: Full=Putative ABC transporter ATP-binding pr...   100   1e-23
UGPC_RALEH RecName: Full=sn-glycerol-3-phosphate import ATP-bind...   100   1e-23
RGMG1_BURCM RecName: Full=Putative ribose/galactose/methyl galac...   100   1e-23
RBSA_LACLS RecName: Full=Ribose import ATP-binding protein rbsA;...   100   1e-23
RBSA_BACHD RecName: Full=Ribose import ATP-binding protein rbsA;...   100   1e-23
PSTB_PYRAE RecName: Full=Phosphate import ATP-binding protein ps...   100   1e-23
PHNC_CAUCR RecName: Full=Phosphonates import ATP-binding protein...   100   1e-23
PHNC2_BACHD RecName: Full=Phosphonates import ATP-binding protei...   100   1e-23
METN_FRATO RecName: Full=Methionine import ATP-binding protein m...   100   1e-23
METN_FRATH RecName: Full=Methionine import ATP-binding protein m...   100   1e-23
METN2_RHOSR RecName: Full=Methionine import ATP-binding protein ...   100   1e-23
MALK_VIBPA RecName: Full=Maltose/maltodextrin import ATP-binding...   100   1e-23
HMUV_RHOP2 RecName: Full=Hemin import ATP-binding protein hmuV; ...   100   1e-23
FBPC1_HAEIN RecName: Full=Fe(3+) ions import ATP-binding protein...   100   1e-23
CYSA_YERPE RecName: Full=Sulfate/thiosulfate import ATP-binding ...   100   1e-23
CBIO3_OENOB RecName: Full=Cobalt import ATP-binding protein cbiO...   100   1e-23
ARAG_VIBPA RecName: Full=Arabinose import ATP-binding protein ar...   100   1e-23
UGPC3_AGRT5 RecName: Full=sn-glycerol-3-phosphate import ATP-bin...   100   2e-23
RBSA1_RHILO RecName: Full=Ribose import ATP-binding protein rbsA...   100   2e-23
MGLA_YERPS RecName: Full=Galactose/methyl galactoside import ATP...   100   2e-23
MGLA_YERPN RecName: Full=Galactose/methyl galactoside import ATP...   100   2e-23
MGLA_YERPE RecName: Full=Galactose/methyl galactoside import ATP...   100   2e-23
MGLA_YERPA RecName: Full=Galactose/methyl galactoside import ATP...   100   2e-23
METN_VIBVY RecName: Full=Methionine import ATP-binding protein m...   100   2e-23
METN_VIBVU RecName: Full=Methionine import ATP-binding protein m...   100   2e-23
LIVF_SALTY RecName: Full=High-affinity branched-chain amino acid...   100   2e-23
LIVF_SALTI RecName: Full=High-affinity branched-chain amino acid...   100   2e-23
FBPC_PASMU RecName: Full=Fe(3+) ions import ATP-binding protein ...   100   2e-23
CYSA_VIBCH RecName: Full=Sulfate/thiosulfate import ATP-binding ...   100   2e-23
Y132_PYRHO RecName: Full=Putative ABC transporter ATP-binding pr...   100   2e-23
PHNC_SYNSC RecName: Full=Phosphonates import ATP-binding protein...   100   2e-23
NODI_RHILO RecName: Full=Nod factor export ATP-binding protein I...   100   2e-23
MGLA_FUSNN RecName: Full=Galactose/methyl galactoside import ATP...   100   2e-23
METN_WOLSU RecName: Full=Methionine import ATP-binding protein m...   100   2e-23
METN_AGRT5 RecName: Full=Methionine import ATP-binding protein m...   100   2e-23
METN2_PSE14 RecName: Full=Methionine import ATP-binding protein ...   100   2e-23
FBPC_MANSM RecName: Full=Fe(3+) ions import ATP-binding protein ...   100   2e-23
FBPC_HAES1 RecName: Full=Fe(3+) ions import ATP-binding protein ...   100   2e-23
ARAG2_BURCM RecName: Full=Arabinose import ATP-binding protein a...   100   2e-23
ZNUC_PSEU2 RecName: Full=Zinc import ATP-binding protein znuC;  ...    99   3e-23
YECC_ECOLI RecName: Full=Uncharacterized amino-acid ABC transpor...    99   3e-23
Y887_METMA RecName: Full=Putative ABC transporter ATP-binding pr...    99   3e-23
Y4020_METAC RecName: Full=Putative ABC transporter ATP-binding p...    99   3e-23
XYLG_PSEPF RecName: Full=Xylose import ATP-binding protein xylG;...    99   3e-23
RGMG_RALSO RecName: Full=Putative ribose/galactose/methyl galact...    99   3e-23
RBSA_ROSDO RecName: Full=Ribose import ATP-binding protein rbsA;...    99   3e-23
RBSA_ECOUT RecName: Full=Ribose import ATP-binding protein rbsA;...    99   3e-23
RBSA_ECOLI RecName: Full=Ribose import ATP-binding protein rbsA;...    99   3e-23
RBSA_ECOL5 RecName: Full=Ribose import ATP-binding protein rbsA;...    99   3e-23
POTA_ACIC1 RecName: Full=Spermidine/putrescine import ATP-bindin...    99   3e-23
METN_ERWPY RecName: Full=Methionine import ATP-binding protein m...    99   3e-23
LSRA_SHIFL RecName: Full=Autoinducer 2 import ATP-binding protei...    99   3e-23
LSRA_PHOLU RecName: Full=Autoinducer 2 import ATP-binding protei...    99   3e-23
LSRA_ECOHS RecName: Full=Autoinducer 2 import ATP-binding protei...    99   3e-23
LSRA_ECO57 RecName: Full=Autoinducer 2 import ATP-binding protei...    99   3e-23
LACK_RHIRD RecName: Full=Lactose transport ATP-binding protein l...    99   3e-23
CBIO2_CLONN RecName: Full=Cobalt import ATP-binding protein cbiO...    99   3e-23
YCLP_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    99   4e-23
YCBN_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    99   4e-23
Y2641_BACAN RecName: Full=Putative ABC transporter ATP-binding p...    99   4e-23
UGPC_VIBVY RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    99   4e-23
UGPC_VIBVU RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    99   4e-23
UGPC_RHOP5 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    99   4e-23
TAUB_YERPS RecName: Full=Taurine import ATP-binding protein tauB...    99   4e-23
TAUB_YERPN RecName: Full=Taurine import ATP-binding protein tauB...    99   4e-23
TAUB_YERPE RecName: Full=Taurine import ATP-binding protein tauB...    99   4e-23
TAUB_YERPA RecName: Full=Taurine import ATP-binding protein tauB...    99   4e-23
RBSA_SALCH RecName: Full=Ribose import ATP-binding protein rbsA;...    99   4e-23
RBSA_ERWCT RecName: Full=Ribose import ATP-binding protein rbsA;...    99   4e-23
RBSA2_BURCH RecName: Full=Ribose import ATP-binding protein rbsA...    99   4e-23
RBSA2_BURCA RecName: Full=Ribose import ATP-binding protein rbsA...    99   4e-23
POTA_STRSV RecName: Full=Spermidine/putrescine import ATP-bindin...    99   4e-23
POTA_PHOPR RecName: Full=Spermidine/putrescine import ATP-bindin...    99   4e-23
PHNC2_TRIEI RecName: Full=Phosphonates import ATP-binding protei...    99   4e-23
METN_LACGA RecName: Full=Methionine import ATP-binding protein m...    99   4e-23
METN_GEOKA RecName: Full=Methionine import ATP-binding protein m...    99   4e-23
METN1_OENOB RecName: Full=Methionine import ATP-binding protein ...    99   4e-23
LSRA_ECOLC RecName: Full=Autoinducer 2 import ATP-binding protei...    99   4e-23
CYSA_MESVI RecName: Full=Probable sulfate/thiosulfate import ATP...    99   4e-23
Y352_THEMA RecName: Full=Uncharacterized ABC transporter ATP-bin...    99   5e-23
UGPC_RHILO RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    99   5e-23
RBSA1_RHIME RecName: Full=Ribose import ATP-binding protein rbsA...    99   5e-23
METN_THEFY RecName: Full=Methionine import ATP-binding protein m...    99   5e-23
METN_FRATT RecName: Full=Methionine import ATP-binding protein m...    99   5e-23
MALK_SALTY RecName: Full=Maltose/maltodextrin import ATP-binding...    99   5e-23
MALK_SALTI RecName: Full=Maltose/maltodextrin import ATP-binding...    99   5e-23
MALK_SALCH RecName: Full=Maltose/maltodextrin import ATP-binding...    99   5e-23
CYSA_VIBVU RecName: Full=Sulfate/thiosulfate import ATP-binding ...    99   5e-23
ARAG_BURXL RecName: Full=Arabinose import ATP-binding protein ar...    99   5e-23
ARAG2_BURTA RecName: Full=Arabinose import ATP-binding protein a...    99   5e-23
Y2153_ENTFA RecName: Full=Putative ABC transporter ATP-binding p...    98   7e-23
XYLG_BURXL RecName: Full=Xylose import ATP-binding protein xylG;...    98   7e-23
XYLG_BURCH RecName: Full=Xylose import ATP-binding protein xylG;...    98   7e-23
XYLG_BURCA RecName: Full=Xylose import ATP-binding protein xylG;...    98   7e-23
UGPC_RHOPA RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    98   7e-23
UGPC_BURMA RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    98   7e-23
TAUB_JANSC RecName: Full=Taurine import ATP-binding protein tauB...    98   7e-23
RBSA_SALTY RecName: Full=Ribose import ATP-binding protein rbsA;...    98   7e-23
RBSA_SALTI RecName: Full=Ribose import ATP-binding protein rbsA;...    98   7e-23
RBSA_PHOLL RecName: Full=Ribose import ATP-binding protein rbsA;...    98   7e-23
RBSA_JANSC RecName: Full=Ribose import ATP-binding protein rbsA;...    98   7e-23
RBSA_BURXL RecName: Full=Ribose import ATP-binding protein rbsA;...    98   7e-23
NODI_BRAJA RecName: Full=Nod factor export ATP-binding protein I...    98   7e-23
MNTA_SYNY3 RecName: Full=Manganese transport system ATP-binding ...    98   7e-23
MGLA_SHISS RecName: Full=Galactose/methyl galactoside import ATP...    98   7e-23
MGLA_SHIFL RecName: Full=Galactose/methyl galactoside import ATP...    98   7e-23
MGLA_ECOLI RecName: Full=Galactose/methyl galactoside import ATP...    98   7e-23
MGLA_ECOL6 RecName: Full=Galactose/methyl galactoside import ATP...    98   7e-23
MGLA_ECOL5 RecName: Full=Galactose/methyl galactoside import ATP...    98   7e-23
MGLA_ECO57 RecName: Full=Galactose/methyl galactoside import ATP...    98   7e-23
METN_LEGPA RecName: Full=Methionine import ATP-binding protein m...    98   7e-23
MACB_SALCH RecName: Full=Macrolide export ATP-binding/permease p...    98   7e-23
LSRA_SHIF8 RecName: Full=Autoinducer 2 import ATP-binding protei...    98   7e-23
LSRA_ECO24 RecName: Full=Putative autoinducer 2 import ATP-bindi...    98   7e-23
CMPC_SYNP6 RecName: Full=Bicarbonate transport ATP-binding prote...    98   7e-23
CMPC_SYNE7 RecName: Full=Bicarbonate transport ATP-binding prote...    98   7e-23
Y2424_BACHK RecName: Full=Putative ABC transporter ATP-binding p...    98   9e-23
UGPC_RALME RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    98   9e-23
UGPC_RALEJ RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    98   9e-23
RBSA_SHISS RecName: Full=Ribose import ATP-binding protein rbsA;...    98   9e-23
RBSA_ECOL6 RecName: Full=Ribose import ATP-binding protein rbsA;...    98   9e-23
PSTB_DEIRA RecName: Full=Phosphate import ATP-binding protein ps...    98   9e-23
POTA_THEFY RecName: Full=Spermidine/putrescine import ATP-bindin...    98   9e-23
POTA_ERWCT RecName: Full=Spermidine/putrescine import ATP-bindin...    98   9e-23
PHNC_MARMM RecName: Full=Phosphonates import ATP-binding protein...    98   9e-23
NRTC_SYNY3 RecName: Full=Nitrate transport ATP-binding protein n...    98   9e-23
NODI_BURS3 RecName: Full=Nod factor export ATP-binding protein I...    98   9e-23
MGLA_SHIF8 RecName: Full=Galactose/methyl galactoside import ATP...    98   9e-23
MGLA_ECOUT RecName: Full=Galactose/methyl galactoside import ATP...    98   9e-23
MGLA2_PHOPR RecName: Full=Galactose/methyl galactoside import AT...    98   9e-23
METN_HELAH RecName: Full=Methionine import ATP-binding protein m...    98   9e-23
LSRA_PHOLL RecName: Full=Autoinducer 2 import ATP-binding protei...    98   9e-23
CYSA_BORBR RecName: Full=Sulfate/thiosulfate import ATP-binding ...    98   9e-23
CYSA1_SHEON RecName: Full=Sulfate/thiosulfate import ATP-binding...    98   9e-23
CBIO1_STAES RecName: Full=Cobalt import ATP-binding protein cbiO...    98   9e-23
CBIO1_STAEQ RecName: Full=Cobalt import ATP-binding protein cbiO...    98   9e-23
APPF_BACSU RecName: Full=Oligopeptide transport ATP-binding prot...    98   9e-23
ZNUC_PSEAE RecName: Full=Zinc import ATP-binding protein znuC;  ...    97   1e-22
ZNUC_PSEAB RecName: Full=Zinc import ATP-binding protein znuC;  ...    97   1e-22
UGPC_PSYIN RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    97   1e-22
UGPC_BURPS RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    97   1e-22
UGPC_BURP1 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    97   1e-22
TAUB_ECOL6 RecName: Full=Taurine import ATP-binding protein tauB...    97   1e-22
RGMG_PSE14 RecName: Full=Putative ribose/galactose/methyl galact...    97   1e-22
PHNC_LACC3 RecName: Full=Phosphonates import ATP-binding protein...    97   1e-22
PHNC3_BACHD RecName: Full=Phosphonates import ATP-binding protei...    97   1e-22
OPUCA_BACSU RecName: Full=Glycine betaine/carnitine/choline tran...    97   1e-22
METN_CAUCR RecName: Full=Methionine import ATP-binding protein m...    97   1e-22
METN3_PSEF5 RecName: Full=Methionine import ATP-binding protein ...    97   1e-22
MACB_RHOBA RecName: Full=Macrolide export ATP-binding/permease p...    97   1e-22
MACB_CHLTE RecName: Full=Macrolide export ATP-binding/permease p...    97   1e-22
LSRA_ECOSM RecName: Full=Autoinducer 2 import ATP-binding protei...    97   1e-22
LIVF_ECOLI RecName: Full=High-affinity branched-chain amino acid...    97   1e-22
CYSA_MYCPA RecName: Full=Sulfate/thiosulfate import ATP-binding ...    97   1e-22
CYSA_BORPE RecName: Full=Sulfate/thiosulfate import ATP-binding ...    97   1e-22
CYSA_BORPA RecName: Full=Sulfate/thiosulfate import ATP-binding ...    97   1e-22
CYSA_BACHD RecName: Full=Sulfate/thiosulfate import ATP-binding ...    97   1e-22
CYSA1_CHRVO RecName: Full=Sulfate/thiosulfate import ATP-binding...    97   1e-22
CBIO2_MYCCT RecName: Full=Cobalt import ATP-binding protein cbiO...    97   1e-22
ARAG_PSEU2 RecName: Full=Arabinose import ATP-binding protein ar...    97   1e-22
ZNUC_BRUAB RecName: Full=Zinc import ATP-binding protein znuC;  ...    97   2e-22
ZNUC_BRUA2 RecName: Full=Zinc import ATP-binding protein znuC;  ...    97   2e-22
YEHX_ECOLI RecName: Full=Putative osmoprotectant uptake system A...    97   2e-22
TAUB_SHISS RecName: Full=Taurine import ATP-binding protein tauB...    97   2e-22
TAUB_SHIFL RecName: Full=Taurine import ATP-binding protein tauB...    97   2e-22
TAUB_ECOLI RecName: Full=Taurine import ATP-binding protein tauB...    97   2e-22
RBSA1_ECO57 RecName: Full=Ribose import ATP-binding protein rbsA...    97   2e-22
PSTB_PYRFU RecName: Full=Phosphate import ATP-binding protein ps...    97   2e-22
OPPF_STRP6 RecName: Full=Oligopeptide transport ATP-binding prot...    97   2e-22
OPPF_STRP3 RecName: Full=Oligopeptide transport ATP-binding prot...    97   2e-22
OPPF_STRP1 RecName: Full=Oligopeptide transport ATP-binding prot...    97   2e-22
METN_RHOS4 RecName: Full=Methionine import ATP-binding protein m...    97   2e-22
METN_FRAT1 RecName: Full=Methionine import ATP-binding protein m...    97   2e-22
MALK_SHISS RecName: Full=Maltose/maltodextrin import ATP-binding...    97   2e-22
MALK_SHIFL RecName: Full=Maltose/maltodextrin import ATP-binding...    97   2e-22
MALK_SALPA RecName: Full=Maltose/maltodextrin import ATP-binding...    97   2e-22
MALK_ECOUT RecName: Full=Maltose/maltodextrin import ATP-binding...    97   2e-22
MALK_ECOLI RecName: Full=Maltose/maltodextrin import ATP-binding...    97   2e-22
MALK_ECOL6 RecName: Full=Maltose/maltodextrin import ATP-binding...    97   2e-22
MALK_ECOL5 RecName: Full=Maltose/maltodextrin import ATP-binding...    97   2e-22
MALK_ECO57 RecName: Full=Maltose/maltodextrin import ATP-binding...    97   2e-22
MACB_BDEBA RecName: Full=Macrolide export ATP-binding/permease p...    97   2e-22
CYSA_PHOLL RecName: Full=Sulfate/thiosulfate import ATP-binding ...    97   2e-22
ARAG1_BURCH RecName: Full=Arabinose import ATP-binding protein a...    97   2e-22
ARAG1_BURCA RecName: Full=Arabinose import ATP-binding protein a...    97   2e-22
ZNUC_ALHEH RecName: Full=Zinc import ATP-binding protein znuC;  ...    97   2e-22
Y4TH_RHISN RecName: Full=Probable amino-acid ABC transporter ATP...    97   2e-22
TAUB_SHIBS RecName: Full=Taurine import ATP-binding protein tauB...    97   2e-22
TAUB_BURCH RecName: Full=Taurine import ATP-binding protein tauB...    97   2e-22
TAUB_BURCA RecName: Full=Taurine import ATP-binding protein tauB...    97   2e-22
RBSA_DEIGD RecName: Full=Ribose import ATP-binding protein rbsA;...    97   2e-22
PTXA_PSEST RecName: Full=Phosphite import ATP-binding protein px...    97   2e-22
PSTB_BACFR RecName: Full=Phosphate import ATP-binding protein ps...    97   2e-22
PSTB_BACFN RecName: Full=Phosphate import ATP-binding protein ps...    97   2e-22
PHNC_TREDE RecName: Full=Phosphonates import ATP-binding protein...    97   2e-22
PHNC2_RHOPA RecName: Full=Phosphonates import ATP-binding protei...    97   2e-22
MGLA_SODGM RecName: Full=Galactose/methyl galactoside import ATP...    97   2e-22
METN_STRA3 RecName: Full=Methionine import ATP-binding protein m...    97   2e-22
MALK_SHIF8 RecName: Full=Maltose/maltodextrin import ATP-binding...    97   2e-22
LOLD_BACFR RecName: Full=Lipoprotein-releasing system ATP-bindin...    97   2e-22
FBPC_VIBCH RecName: Full=Fe(3+) ions import ATP-binding protein ...    97   2e-22
ARAG2_BURS3 RecName: Full=Arabinose import ATP-binding protein a...    97   2e-22
ARAG2_BURCH RecName: Full=Arabinose import ATP-binding protein a...    97   2e-22
ARAG2_BURCA RecName: Full=Arabinose import ATP-binding protein a...    97   2e-22
ARAG1_BURCM RecName: Full=Arabinose import ATP-binding protein a...    97   2e-22
UGPC_RHOPS RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    96   3e-22
UGPC_BARQU RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    96   3e-22
UGPC2_RHIL3 RecName: Full=sn-glycerol-3-phosphate import ATP-bin...    96   3e-22
TAUB_ECOUT RecName: Full=Taurine import ATP-binding protein tauB...    96   3e-22
TAUB_ECOL5 RecName: Full=Taurine import ATP-binding protein tauB...    96   3e-22
RBSA1_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA...    96   3e-22
POTA_MYCSS RecName: Full=Spermidine/putrescine import ATP-bindin...    96   3e-22
POTA_MYCSK RecName: Full=Spermidine/putrescine import ATP-bindin...    96   3e-22
PHNC2_RHOP5 RecName: Full=Phosphonates import ATP-binding protei...    96   3e-22
PHNC2_RHOP2 RecName: Full=Phosphonates import ATP-binding protei...    96   3e-22
MGLA_SHIBS RecName: Full=Galactose/methyl galactoside import ATP...    96   3e-22
METN_STRPN RecName: Full=Methionine import ATP-binding protein m...    96   3e-22
METN_STRA5 RecName: Full=Methionine import ATP-binding protein m...    96   3e-22
METN_STRA1 RecName: Full=Methionine import ATP-binding protein m...    96   3e-22
METN_HELHP RecName: Full=Methionine import ATP-binding protein m...    96   3e-22
METN2_PSEU2 RecName: Full=Methionine import ATP-binding protein ...    96   3e-22
LOLD_GEOMG RecName: Full=Lipoprotein-releasing system ATP-bindin...    96   3e-22
LOLD_BACTN RecName: Full=Lipoprotein-releasing system ATP-bindin...    96   3e-22
LOLD_BACFN RecName: Full=Lipoprotein-releasing system ATP-bindin...    96   3e-22
HTXD_PSEST RecName: Full=Hypophosphite import ATP-binding protei...    96   3e-22
GLTL_ECOLI RecName: Full=Glutamate/aspartate transport ATP-bindi...    96   3e-22
GLTL_ECO57 RecName: Full=Glutamate/aspartate transport ATP-bindi...    96   3e-22
CBIO2_MYCPN RecName: Full=Cobalt import ATP-binding protein cbiO...    96   3e-22
CBIO1_THETN RecName: Full=Cobalt import ATP-binding protein cbiO...    96   3e-22
AGLK_RHIME RecName: Full=Alpha-glucoside transport ATP-binding p...    96   3e-22
ABCH2_DICDI RecName: Full=ABC transporter H family member 2;           96   3e-22
ZNUC_ANAMM RecName: Full=Zinc import ATP-binding protein znuC;  ...    96   3e-22
ZNUC_AERHH RecName: Full=Zinc import ATP-binding protein znuC;  ...    96   3e-22
Y391_CHLTE RecName: Full=Putative ABC transporter ATP-binding pr...    96   3e-22
XYLG_BURCM RecName: Full=Xylose import ATP-binding protein xylG;...    96   3e-22
UGPC_RHOP2 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    96   3e-22
TAUB_SHIF8 RecName: Full=Taurine import ATP-binding protein tauB...    96   3e-22
RBSA_RHOBA RecName: Full=Ribose import ATP-binding protein rbsA;...    96   3e-22
RBSA1_RHIEC RecName: Full=Ribose import ATP-binding protein rbsA...    96   3e-22
POTA_BACFR RecName: Full=Spermidine/putrescine import ATP-bindin...    96   3e-22
POTA_BACFN RecName: Full=Spermidine/putrescine import ATP-bindin...    96   3e-22
OPPF_BACSU RecName: Full=Oligopeptide transport ATP-binding prot...    96   3e-22
METN_STRR6 RecName: Full=Methionine import ATP-binding protein m...    96   3e-22
METN2_ACIAD RecName: Full=Methionine import ATP-binding protein ...    96   3e-22
MACB_NEIG1 RecName: Full=Macrolide export ATP-binding/permease p...    96   3e-22
CYSA_ANASP RecName: Full=Sulfate/thiosulfate import ATP-binding ...    96   3e-22
ARAG_PSE14 RecName: Full=Arabinose import ATP-binding protein ar...    96   3e-22
ARAG_AZOBR RecName: Full=Arabinose import ATP-binding protein ar...    96   3e-22
Y2655_BACCR RecName: Full=Putative ABC transporter ATP-binding p...    96   4e-22
Y1572_METJA RecName: Full=Putative ABC transporter ATP-binding p...    96   4e-22
XYLG_PSEU2 RecName: Full=Xylose import ATP-binding protein xylG;...    96   4e-22
TAUB_ECO57 RecName: Full=Taurine import ATP-binding protein tauB...    96   4e-22
RBSA_SALPA RecName: Full=Ribose import ATP-binding protein rbsA;...    96   4e-22
PHNC_RHOPS RecName: Full=Phosphonates import ATP-binding protein...    96   4e-22
PHNC1_RHOPA RecName: Full=Phosphonates import ATP-binding protei...    96   4e-22
MGLA_SALTY RecName: Full=Galactose/methyl galactoside import ATP...    96   4e-22
MACB_NEIMA RecName: Full=Macrolide export ATP-binding/permease p...    96   4e-22
MACB_NEIGO RecName: Full=Macrolide export ATP-binding/permease p...    96   4e-22
HMUV_RHOP5 RecName: Full=Hemin import ATP-binding protein hmuV; ...    96   4e-22
FBPC_ACTPL RecName: Full=Fe(3+) ions import ATP-binding protein ...    96   4e-22
CYSA_CAUCR RecName: Full=Sulfate/thiosulfate import ATP-binding ...    96   4e-22
CBIO2_OCEIH RecName: Full=Cobalt import ATP-binding protein cbiO...    96   4e-22
CBIO1_GEOKA RecName: Full=Cobalt import ATP-binding protein cbiO...    96   4e-22
ARAG_RALSO RecName: Full=Arabinose import ATP-binding protein ar...    96   4e-22
ZNUC_RICFE RecName: Full=Zinc import ATP-binding protein znuC;  ...    95   6e-22
ZNUC_BRUSU RecName: Full=Zinc import ATP-binding protein znuC;  ...    95   6e-22
YYBJ_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    95   6e-22
Y394_METAC RecName: Full=Putative ABC transporter ATP-binding pr...    95   6e-22
UGPC3_RHIL3 RecName: Full=sn-glycerol-3-phosphate import ATP-bin...    95   6e-22
THIQ_PHOPR RecName: Full=Thiamine import ATP-binding protein thi...    95   6e-22
RBSA2_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA...    95   6e-22
MGLA_VIBCH RecName: Full=Galactose/methyl galactoside import ATP...    95   6e-22
METN_STRAW RecName: Full=Methionine import ATP-binding protein m...    95   6e-22
MALK_VIBVY RecName: Full=Maltose/maltodextrin import ATP-binding...    95   6e-22
MALK_VIBVU RecName: Full=Maltose/maltodextrin import ATP-binding...    95   6e-22
MACB_NEIMB RecName: Full=Macrolide export ATP-binding/permease p...    95   6e-22
LSRA_ECOLI RecName: Full=Autoinducer 2 import ATP-binding protei...    95   6e-22
LSRA_ECODH RecName: Full=Autoinducer 2 import ATP-binding protei...    95   6e-22
CBIO1_STRR6 RecName: Full=Cobalt import ATP-binding protein cbiO...    95   6e-22
CBIO1_STRPN RecName: Full=Cobalt import ATP-binding protein cbiO...    95   6e-22
CBIO1_STRP2 RecName: Full=Cobalt import ATP-binding protein cbiO...    95   6e-22
ZNUC_RICBR RecName: Full=Zinc import ATP-binding protein znuC;  ...    95   8e-22
ZNUC_JANSC RecName: Full=Zinc import ATP-binding protein znuC;  ...    95   8e-22
POTA_RUBXD RecName: Full=Spermidine/putrescine import ATP-bindin...    95   8e-22
POTA_BACTN RecName: Full=Spermidine/putrescine import ATP-bindin...    95   8e-22
PHNC_YERPS RecName: Full=Phosphonates import ATP-binding protein...    95   8e-22
PHNC_YERPN RecName: Full=Phosphonates import ATP-binding protein...    95   8e-22
PHNC_YERPE RecName: Full=Phosphonates import ATP-binding protein...    95   8e-22
PHNC_YERPA RecName: Full=Phosphonates import ATP-binding protein...    95   8e-22
METN2_RHOPA RecName: Full=Methionine import ATP-binding protein ...    95   8e-22
METN1_PSESM RecName: Full=Methionine import ATP-binding protein ...    95   8e-22
MACB_RHORT RecName: Full=Macrolide export ATP-binding/permease p...    95   8e-22
FBPC_RHIEC RecName: Full=Fe(3+) ions import ATP-binding protein ...    95   8e-22
FBPC_PHOPR RecName: Full=Fe(3+) ions import ATP-binding protein ...    95   8e-22
BCRA_BACLI RecName: Full=Bacitracin transport ATP-binding protei...    95   8e-22
ARAG_PSESM RecName: Full=Arabinose import ATP-binding protein ar...    95   8e-22
AB13I_ARATH RecName: Full=Protein TRIGALACTOSYLDIACYLGLYCEROL 3,...    95   8e-22
Y4TS_RHISN RecName: Full=Probable peptide ABC transporter ATP-bi...    94   1e-21
XYLG_PSE14 RecName: Full=Xylose import ATP-binding protein xylG;...    94   1e-21
UGPC_JANSC RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    94   1e-21
TAUB1_BURXL RecName: Full=Taurine import ATP-binding protein tau...    94   1e-21
PHNC_BRAJA RecName: Full=Phosphonates import ATP-binding protein...    94   1e-21
OPPF_STRP8 RecName: Full=Oligopeptide transport ATP-binding prot...    94   1e-21
MNTB_LISMO RecName: Full=Manganese transport system ATP-binding ...    94   1e-21
LOLD_SHISS RecName: Full=Lipoprotein-releasing system ATP-bindin...    94   1e-21
LOLD_ECOUT RecName: Full=Lipoprotein-releasing system ATP-bindin...    94   1e-21
LOLD_ECOL6 RecName: Full=Lipoprotein-releasing system ATP-bindin...    94   1e-21
LOLD_ECOL5 RecName: Full=Lipoprotein-releasing system ATP-bindin...    94   1e-21
LOLD_CYTH3 RecName: Full=Lipoprotein-releasing system ATP-bindin...    94   1e-21
HISP_SALTY RecName: Full=Histidine transport ATP-binding protein...    94   1e-21
FBPC1_RHIME RecName: Full=Fe(3+) ions import ATP-binding protein...    94   1e-21
CYSA_BRAJA RecName: Full=Sulfate/thiosulfate import ATP-binding ...    94   1e-21
CMPD_SYNP6 RecName: Full=Bicarbonate transport ATP-binding prote...    94   1e-21
CMPD_SYNE7 RecName: Full=Bicarbonate transport ATP-binding prote...    94   1e-21
CBIO1_SYMTH RecName: Full=Cobalt import ATP-binding protein cbiO...    94   1e-21
YPHE_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    94   1e-21
Y043_BIFLO RecName: Full=Putative ABC transporter ATP-binding pr...    94   1e-21
XYLG_PHOPR RecName: Full=Xylose import ATP-binding protein xylG;...    94   1e-21
XYLG_BURTA RecName: Full=Xylose import ATP-binding protein xylG;...    94   1e-21
UGPC_RHOPB RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    94   1e-21
UGPC_BURTA RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    94   1e-21
TAUB_SHIDS RecName: Full=Taurine import ATP-binding protein tauB...    94   1e-21
TAUB_ROSDO RecName: Full=Taurine import ATP-binding protein tauB...    94   1e-21
TAUB3_BURXL RecName: Full=Taurine import ATP-binding protein tau...    94   1e-21
PSTB_THEMA RecName: Full=Phosphate import ATP-binding protein ps...    94   1e-21
PSTB_COREF RecName: Full=Phosphate import ATP-binding protein ps...    94   1e-21
PHNC_BORPA RecName: Full=Phosphonates import ATP-binding protein...    94   1e-21
PHNC_BORBR RecName: Full=Phosphonates import ATP-binding protein...    94   1e-21
PHNC2_RHOPB RecName: Full=Phosphonates import ATP-binding protei...    94   1e-21
PHNC1_NATPD RecName: Full=Phosphonates import ATP-binding protei...    94   1e-21
OPUAA_BACSU RecName: Full=Glycine betaine transport ATP-binding ...    94   1e-21
MGLA_VIBVY RecName: Full=Galactose/methyl galactoside import ATP...    94   1e-21
MGLA_VIBVU RecName: Full=Galactose/methyl galactoside import ATP...    94   1e-21
MGLA_HAEIN RecName: Full=Galactose/methyl galactoside import ATP...    94   1e-21
MGLA_HAEI8 RecName: Full=Galactose/methyl galactoside import ATP...    94   1e-21
MALK_YERPS RecName: Full=Maltose/maltodextrin import ATP-binding...    94   1e-21
MALK_YERPN RecName: Full=Maltose/maltodextrin import ATP-binding...    94   1e-21
MALK_YERPE RecName: Full=Maltose/maltodextrin import ATP-binding...    94   1e-21
MALK_YERPA RecName: Full=Maltose/maltodextrin import ATP-binding...    94   1e-21
MACB_VIBPA RecName: Full=Macrolide export ATP-binding/permease p...    94   1e-21
MACB_NITEU RecName: Full=Macrolide export ATP-binding/permease p...    94   1e-21
CYSA_XANCP RecName: Full=Sulfate/thiosulfate import ATP-binding ...    94   1e-21
CBIO2_MYCMS RecName: Full=Cobalt import ATP-binding protein cbiO...    94   1e-21
CBIO2_CLOTH RecName: Full=Cobalt import ATP-binding protein cbiO...    94   1e-21
ARAG_BURPS RecName: Full=Arabinose import ATP-binding protein ar...    94   1e-21
ARAG_BURP1 RecName: Full=Arabinose import ATP-binding protein ar...    94   1e-21
YHCH_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    94   2e-21
UGPC_BARHE RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    94   2e-21
RBSA_CLOTE RecName: Full=Ribose import ATP-binding protein rbsA;...    94   2e-21
PSTB_GRABC RecName: Full=Phosphate import ATP-binding protein ps...    94   2e-21
PSTB2_NATPD RecName: Full=Phosphate import ATP-binding protein p...    94   2e-21
POTA_SHISS RecName: Full=Spermidine/putrescine import ATP-bindin...    94   2e-21
POTA_SHIDS RecName: Full=Spermidine/putrescine import ATP-bindin...    94   2e-21
POTA_SHIBS RecName: Full=Spermidine/putrescine import ATP-bindin...    94   2e-21
POTA_ENTFA RecName: Full=Spermidine/putrescine import ATP-bindin...    94   2e-21
OPUAA_LACLA RecName: Full=Glycine betaine transport ATP-binding ...    94   2e-21
MGLA_PASMU RecName: Full=Galactose/methyl galactoside import ATP...    94   2e-21
METN_STRCO RecName: Full=Methionine import ATP-binding protein m...    94   2e-21
METN_BARHE RecName: Full=Methionine import ATP-binding protein m...    94   2e-21
LOLD_SHIDS RecName: Full=Lipoprotein-releasing system ATP-bindin...    94   2e-21
CBIO1_OENOB RecName: Full=Cobalt import ATP-binding protein cbiO...    94   2e-21
CBIO1_MESFL RecName: Full=Cobalt import ATP-binding protein cbiO...    94   2e-21
BZTD_RHOCA RecName: Full=Glutamate/glutamine/aspartate/asparagin...    94   2e-21
ZNUC_YERE8 RecName: Full=Zinc import ATP-binding protein znuC;  ...    93   2e-21
YRBF_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    93   2e-21
YRBF_ECOL6 RecName: Full=Uncharacterized ABC transporter ATP-bin...    93   2e-21
YRBF_ECO57 RecName: Full=Uncharacterized ABC transporter ATP-bin...    93   2e-21
UGPC_ROSDO RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    93   2e-21
UGPC_CHRSD RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    93   2e-21
SSUB3_BACSK RecName: Full=Aliphatic sulfonates import ATP-bindin...    93   2e-21
PSTB1_BACSK RecName: Full=Phosphate import ATP-binding protein p...    93   2e-21
POTA_SILST RecName: Full=Spermidine/putrescine import ATP-bindin...    93   2e-21
POTA_SHIFL RecName: Full=Spermidine/putrescine import ATP-bindin...    93   2e-21
POTA_METCA RecName: Full=Spermidine/putrescine import ATP-bindin...    93   2e-21
POTA_ECOUT RecName: Full=Spermidine/putrescine import ATP-bindin...    93   2e-21
POTA_ECOLI RecName: Full=Spermidine/putrescine import ATP-bindin...    93   2e-21
POTA_ECOL6 RecName: Full=Spermidine/putrescine import ATP-bindin...    93   2e-21
POTA_ECOL5 RecName: Full=Spermidine/putrescine import ATP-bindin...    93   2e-21
POTA_ECOK1 RecName: Full=Spermidine/putrescine import ATP-bindin...    93   2e-21
POTA_ECO57 RecName: Full=Spermidine/putrescine import ATP-bindin...    93   2e-21
METN_STRGR RecName: Full=Methionine import ATP-binding protein m...    93   2e-21
LOLD_SHIBS RecName: Full=Lipoprotein-releasing system ATP-bindin...    93   2e-21
LOLD_ECOLI RecName: Full=Lipoprotein-releasing system ATP-bindin...    93   2e-21
CBIO2_LACJO RecName: Full=Cobalt import ATP-binding protein cbiO...    93   2e-21
YXDL_BACSU RecName: Full=ABC transporter ATP-binding protein yxdL;     93   3e-21
UGPC3_RHIEC RecName: Full=sn-glycerol-3-phosphate import ATP-bin...    93   3e-21
UGPC1_RHIEC RecName: Full=sn-glycerol-3-phosphate import ATP-bin...    93   3e-21
THIQ_SODGM RecName: Full=Thiamine import ATP-binding protein thi...    93   3e-21
POTA_PARUW RecName: Full=Spermidine/putrescine import ATP-bindin...    93   3e-21
METN2_STAEQ RecName: Full=Methionine import ATP-binding protein ...    93   3e-21
METN2_PSEPK RecName: Full=Methionine import ATP-binding protein ...    93   3e-21
LOLD_PSESM RecName: Full=Lipoprotein-releasing system ATP-bindin...    93   3e-21
LOLD_PELCD RecName: Full=Lipoprotein-releasing system ATP-bindin...    93   3e-21
CYSA_SYNE7 RecName: Full=Sulfate/thiosulfate import ATP-binding ...    93   3e-21
CMPC_SYNY3 RecName: Full=Bicarbonate transport ATP-binding prote...    93   3e-21
AMIF_STRPN RecName: Full=Oligopeptide transport ATP-binding prot...    93   3e-21
ZNUC_RICCN RecName: Full=Zinc import ATP-binding protein znuC;  ...    92   4e-21
ZNUC_PHOPR RecName: Full=Zinc import ATP-binding protein znuC;  ...    92   4e-21
YBHF_SHIFL RecName: Full=Uncharacterized ABC transporter ATP-bin...    92   4e-21
YBHF_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    92   4e-21
Y1418_METAC RecName: Full=Putative ABC transporter ATP-binding p...    92   4e-21
UGPC_BRUME RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    92   4e-21
PSTB_PYRAB RecName: Full=Phosphate import ATP-binding protein ps...    92   4e-21
PSTB_BACTN RecName: Full=Phosphate import ATP-binding protein ps...    92   4e-21
PSTB1_HALSA RecName: Full=Phosphate import ATP-binding protein p...    92   4e-21
POTA_SILPO RecName: Full=Spermidine/putrescine import ATP-bindin...    92   4e-21
PHNC_BDEBA RecName: Full=Phosphonates import ATP-binding protein...    92   4e-21
PHNC1_OCEIH RecName: Full=Phosphonates import ATP-binding protei...    92   4e-21
PHNC1_HALWD RecName: Full=Phosphonates import ATP-binding protei...    92   4e-21
MGLA_MANSM RecName: Full=Galactose/methyl galactoside import ATP...    92   4e-21
METN_NOCFA RecName: Full=Methionine import ATP-binding protein m...    92   4e-21
LOLD_SHIFL RecName: Full=Lipoprotein-releasing system ATP-bindin...    92   4e-21
LOLD_NITWN RecName: Full=Lipoprotein-releasing system ATP-bindin...    92   4e-21
HMUV_RHIME RecName: Full=Hemin import ATP-binding protein hmuV; ...    92   4e-21
HMUV_RHILO RecName: Full=Hemin import ATP-binding protein hmuV; ...    92   4e-21
HISP_ECOLI RecName: Full=Histidine transport ATP-binding protein...    92   4e-21
FBPC_SERMA RecName: Full=Fe(3+) ions import ATP-binding protein ...    92   4e-21
DPPF_HAEIN RecName: Full=Dipeptide transport ATP-binding protein...    92   4e-21
CYSA_XANAC RecName: Full=Sulfate/thiosulfate import ATP-binding ...    92   4e-21
CBIO1_LISW6 RecName: Full=Cobalt import ATP-binding protein cbiO...    92   4e-21
CBIO1_ENTFA RecName: Full=Cobalt import ATP-binding protein cbiO...    92   4e-21
ARAG1_BURS3 RecName: Full=Arabinose import ATP-binding protein a...    92   4e-21
YRIBC_METTM RecName: Full=Putative ABC transporter ATP-binding p...    92   5e-21
UGPC_BRUSU RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    92   5e-21
UGPC_BRUAB RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    92   5e-21
UGPC_BRUA2 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    92   5e-21
TAUB_RALEH RecName: Full=Taurine import ATP-binding protein tauB...    92   5e-21
POTA_SHIF8 RecName: Full=Spermidine/putrescine import ATP-bindin...    92   5e-21
POTA_PSYCK RecName: Full=Spermidine/putrescine import ATP-bindin...    92   5e-21
NODI_BURCA RecName: Full=Nod factor export ATP-binding protein I...    92   5e-21
MALK_VIBF1 RecName: Full=Maltose/maltodextrin import ATP-binding...    92   5e-21
HMUV_RHOPS RecName: Full=Hemin import ATP-binding protein hmuV; ...    92   5e-21
GLUA_COREF RecName: Full=Glutamate transport ATP-binding protein...    92   5e-21
FBPC2_RHOSR RecName: Full=Fe(3+) ions import ATP-binding protein...    92   5e-21
CYSA_NOCFA RecName: Full=Sulfate/thiosulfate import ATP-binding ...    92   5e-21
CBIO1_LISIN RecName: Full=Cobalt import ATP-binding protein cbiO...    92   5e-21
ABCA8_DICDI RecName: Full=ABC transporter A family member 8;AltN...    92   5e-21
ZNUC_BRUME RecName: Full=Zinc import ATP-binding protein znuC;  ...    92   6e-21
WTPC_PYRAB RecName: Full=Molybdate/tungstate import ATP-binding ...    92   6e-21
UGPC_BRAJA RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    92   6e-21
TAUB_RALEJ RecName: Full=Taurine import ATP-binding protein tauB...    92   6e-21
SSUB1_BACSK RecName: Full=Aliphatic sulfonates import ATP-bindin...    92   6e-21
RBSA2_STRAW RecName: Full=Ribose import ATP-binding protein rbsA...    92   6e-21
PSTB_STRCO RecName: Full=Phosphate import ATP-binding protein ps...    92   6e-21
PSTB_DEIGD RecName: Full=Phosphate import ATP-binding protein ps...    92   6e-21
PHNC_RHILO RecName: Full=Phosphonates import ATP-binding protein...    92   6e-21
METN_SALEN RecName: Full=Methionine import ATP-binding protein m...    92   6e-21
METN_LACAC RecName: Full=Methionine import ATP-binding protein m...    92   6e-21
MALK_MANSM RecName: Full=Maltose/maltodextrin import ATP-binding...    92   6e-21
MALK_ENTAE RecName: Full=Maltose/maltodextrin import ATP-binding...    92   6e-21
MACB_ALCBS RecName: Full=Macrolide export ATP-binding/permease p...    92   6e-21
LOLD_PSE14 RecName: Full=Lipoprotein-releasing system ATP-bindin...    92   6e-21
LOLD_GEOSL RecName: Full=Lipoprotein-releasing system ATP-bindin...    92   6e-21
CBIO_STRPY RecName: Full=Cobalt import ATP-binding protein cbiO;...    92   6e-21
CBIO_PEDPA RecName: Full=Cobalt import ATP-binding protein cbiO;...    92   6e-21
CBIO2_STRPG RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO2_STRP8 RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO2_STRP6 RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO2_STRP3 RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO2_STRP1 RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO2_MYCMO RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO2_LISIN RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO1_STRPM RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO1_STRPF RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO1_STRPD RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO1_STRPC RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO1_OCEIH RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
CBIO1_LACPL RecName: Full=Cobalt import ATP-binding protein cbiO...    92   6e-21
ARAG1_BURTA RecName: Full=Arabinose import ATP-binding protein a...    92   6e-21
YKOD_BACSU RecName: Full=Putative HMP/thiamine import ATP-bindin...    91   8e-21
YCOBB_RHOCA RecName: Full=Putative ABC transporter ATP-binding p...    91   8e-21
Y796_METJA RecName: Full=Uncharacterized ABC transporter ATP-bin...    91   8e-21
Y119_MYCGE RecName: Full=Putative carbohydrate transport ATP-bin...    91   8e-21
POTA_CLONN RecName: Full=Spermidine/putrescine import ATP-bindin...    91   8e-21
PHNC_SHISS RecName: Full=Phosphonates import ATP-binding protein...    91   8e-21
PHNC2_RALME RecName: Full=Phosphonates import ATP-binding protei...    91   8e-21
METN1_STAES RecName: Full=Methionine import ATP-binding protein ...    91   8e-21
LOLD_PSEU2 RecName: Full=Lipoprotein-releasing system ATP-bindin...    91   8e-21
LOLD_PARUW RecName: Full=Lipoprotein-releasing system ATP-bindin...    91   8e-21
LOLD_ECO57 RecName: Full=Lipoprotein-releasing system ATP-bindin...    91   8e-21
FBPC1_RHOSR RecName: Full=Fe(3+) ions import ATP-binding protein...    91   8e-21
CED7_CAEEL RecName: Full=ABC transporter ced-7;AltName: Full=Cel...    91   8e-21
CBIO2_OENOB RecName: Full=Cobalt import ATP-binding protein cbiO...    91   8e-21
CBIO2_BACHD RecName: Full=Cobalt import ATP-binding protein cbiO...    91   8e-21
CBIO1_STRPB RecName: Full=Cobalt import ATP-binding protein cbiO...    91   8e-21
CBIO1_LISMF RecName: Full=Cobalt import ATP-binding protein cbiO...    91   8e-21
ARAG_BACST RecName: Full=L-arabinose transport ATP-binding prote...    91   8e-21
YXLF_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    91   1e-20
Y430_STRR6 RecName: Full=Putative ABC transporter ATP-binding pr...    91   1e-20
UGPC_RALSO RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    91   1e-20
PSTB_PYRKO RecName: Full=Phosphate import ATP-binding protein ps...    91   1e-20
PHNC_STAES RecName: Full=Phosphonates import ATP-binding protein...    91   1e-20
PHNC_STAEQ RecName: Full=Phosphonates import ATP-binding protein...    91   1e-20
PHNC_ECOL5 RecName: Full=Phosphonates import ATP-binding protein...    91   1e-20
MACB_PASMU RecName: Full=Macrolide export ATP-binding/permease p...    91   1e-20
LOLD_PORGI RecName: Full=Lipoprotein-releasing system ATP-bindin...    91   1e-20
LOLD_HAES1 RecName: Full=Lipoprotein-releasing system ATP-bindin...    91   1e-20
CYSA_NEPOL RecName: Full=Sulfate/thiosulfate import ATP-binding ...    91   1e-20
CBIO2_CLOP1 RecName: Full=Cobalt import ATP-binding protein cbiO...    91   1e-20
CBIO1_LISMO RecName: Full=Cobalt import ATP-binding protein cbiO...    91   1e-20
CBIO1_LACS1 RecName: Full=Cobalt import ATP-binding protein cbiO...    91   1e-20
CBIO1_CLOPE RecName: Full=Cobalt import ATP-binding protein cbiO...    91   1e-20
AOTP_PSEAE RecName: Full=Arginine/ornithine transport ATP-bindin...    91   1e-20
ABCA7_RAT RecName: Full=ATP-binding cassette sub-family A member 7;    91   1e-20
AAPP_RHIL3 RecName: Full=General L-amino acid transport ATP-bind...    91   1e-20
ZNUC_SHIDS RecName: Full=Zinc import ATP-binding protein znuC;  ...    91   1e-20
THIQ_ERWCT RecName: Full=Thiamine import ATP-binding protein thi...    91   1e-20
TAUB_SILPO RecName: Full=Taurine import ATP-binding protein tauB...    91   1e-20
POTA_CLOAB RecName: Full=Spermidine/putrescine import ATP-bindin...    91   1e-20
PHNC2_SILST RecName: Full=Phosphonates import ATP-binding protei...    91   1e-20
PHNC1_PSEAB RecName: Full=Phosphonates import ATP-binding protei...    91   1e-20
METN_LACSS RecName: Full=Methionine import ATP-binding protein m...    91   1e-20
METN_CHLPN RecName: Full=Methionine import ATP-binding protein m...    91   1e-20
MACB_HAEDU RecName: Full=Macrolide export ATP-binding/permease p...    91   1e-20
LOLD_PSEF5 RecName: Full=Lipoprotein-releasing system ATP-bindin...    91   1e-20
ABCA7_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    91   1e-20
ZNUC_SILPO RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
ZNUC_SHISS RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
ZNUC_SHIBS RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
ZNUC_ECOUT RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
ZNUC_ECOLI RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
ZNUC_ECOL6 RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
ZNUC_ECOL5 RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
ZNUC_ECOK1 RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
ZNUC_ECO57 RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
ZNUC_AGRT5 RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
YDBJ_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    90   2e-20
Y3364_BACAN RecName: Full=Putative ABC transporter ATP-binding p...    90   2e-20
UGPC_VIBCH RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    90   2e-20
PHNC_LACAC RecName: Full=Phosphonates import ATP-binding protein...    90   2e-20
PHNC_ECO57 RecName: Full=Phosphonates import ATP-binding protein...    90   2e-20
PHNC1_SYNJB RecName: Full=Phosphonates import ATP-binding protei...    90   2e-20
NOCP_AGRT5 RecName: Full=Nopaline permease ATP-binding protein P;      90   2e-20
METN2_BURS3 RecName: Full=Methionine import ATP-binding protein ...    90   2e-20
METN2_BURCM RecName: Full=Methionine import ATP-binding protein ...    90   2e-20
LOLD_NITHX RecName: Full=Lipoprotein-releasing system ATP-bindin...    90   2e-20
CBIO2_LISMO RecName: Full=Cobalt import ATP-binding protein cbiO...    90   2e-20
CBIO1_LACSS RecName: Full=Cobalt import ATP-binding protein cbiO...    90   2e-20
ARAG_BURMA RecName: Full=Arabinose import ATP-binding protein ar...    90   2e-20
ZNUC_SILST RecName: Full=Zinc import ATP-binding protein znuC;  ...    90   2e-20
Y1662_METJA RecName: Full=Uncharacterized ABC transporter ATP-bi...    90   2e-20
Y124_THEMA RecName: Full=Probable metal transport system ATP-bin...    90   2e-20
SSUB_RHOPA RecName: Full=Aliphatic sulfonates import ATP-binding...    90   2e-20
SMOK_RHOSH RecName: Full=ATP-binding transport protein smoK;AltN...    90   2e-20
RBSA2_AGRT5 RecName: Full=Ribose import ATP-binding protein rbsA...    90   2e-20
PSTB_FRASC RecName: Full=Phosphate import ATP-binding protein ps...    90   2e-20
POTA_SALTY RecName: Full=Spermidine/putrescine import ATP-bindin...    90   2e-20
POTA_SALTI RecName: Full=Spermidine/putrescine import ATP-bindin...    90   2e-20
POTA_SALPA RecName: Full=Spermidine/putrescine import ATP-bindin...    90   2e-20
POTA_SALCH RecName: Full=Spermidine/putrescine import ATP-bindin...    90   2e-20
PHNC_STAS1 RecName: Full=Phosphonates import ATP-binding protein...    90   2e-20
PHNC_AGRT5 RecName: Full=Phosphonates import ATP-binding protein...    90   2e-20
PHNC2_PSEAE RecName: Full=Phosphonates import ATP-binding protei...    90   2e-20
METN_HELPY RecName: Full=Methionine import ATP-binding protein m...    90   2e-20
METN2_BURCH RecName: Full=Methionine import ATP-binding protein ...    90   2e-20
METN2_BURCA RecName: Full=Methionine import ATP-binding protein ...    90   2e-20
HMUV_RHIL3 RecName: Full=Hemin import ATP-binding protein hmuV; ...    90   2e-20
GLUA_CORGL RecName: Full=Glutamate transport ATP-binding protein...    90   2e-20
CBIO2_METHJ RecName: Full=Cobalt import ATP-binding protein cbiO...    90   2e-20
CBIO2_LISW6 RecName: Full=Cobalt import ATP-binding protein cbiO...    90   2e-20
CBIO2_LISMF RecName: Full=Cobalt import ATP-binding protein cbiO...    90   2e-20
Y528_PYRFU RecName: Full=Putative ABC transporter ATP-binding pr...    89   3e-20
Y3946_ANASP RecName: Full=Putative ABC transporter ATP-binding p...    89   3e-20
Y1704_LACJO RecName: Full=Putative ABC transporter ATP-binding p...    89   3e-20
Y1087_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bi...    89   3e-20
RBSA1_AGRT5 RecName: Full=Ribose import ATP-binding protein rbsA...    89   3e-20
POTA_STAEQ RecName: Full=Spermidine/putrescine import ATP-bindin...    89   3e-20
PHNC_SILPO RecName: Full=Phosphonates import ATP-binding protein...    89   3e-20
NODI_BRASS RecName: Full=Nod factor export ATP-binding protein I...    89   3e-20
MNTB_LISIN RecName: Full=Manganese transport system ATP-binding ...    89   3e-20
MALK_PHOLL RecName: Full=Maltose/maltodextrin import ATP-binding...    89   3e-20
MACB_AZOSE RecName: Full=Macrolide export ATP-binding/permease p...    89   3e-20
LOLD_PASMU RecName: Full=Lipoprotein-releasing system ATP-bindin...    89   3e-20
LOLD_HAEIN RecName: Full=Lipoprotein-releasing system ATP-bindin...    89   3e-20
LOLD_HAEI8 RecName: Full=Lipoprotein-releasing system ATP-bindin...    89   3e-20
HMUV_RHIEC RecName: Full=Hemin import ATP-binding protein hmuV; ...    89   3e-20
CYSA_XYLFA RecName: Full=Sulfate/thiosulfate import ATP-binding ...    89   3e-20
CYSA_RHOPA RecName: Full=Sulfate/thiosulfate import ATP-binding ...    89   3e-20
ZNUC_CHRSD RecName: Full=Zinc import ATP-binding protein znuC;  ...    89   4e-20
Y870_METAC RecName: Full=Putative ABC transporter ATP-binding pr...    89   4e-20
Y2030_SULSO RecName: Full=Putative ABC transporter ATP-binding p...    89   4e-20
XYLG_PSESM RecName: Full=Xylose import ATP-binding protein xylG;...    89   4e-20
UGPC_BARBK RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    89   4e-20
SRTF_STRPY RecName: Full=Lantibiotic transport ATP-binding prote...    89   4e-20
SRTF_STRP1 RecName: Full=Lantibiotic transport ATP-binding prote...    89   4e-20
PSTB_HAHCH RecName: Full=Phosphate import ATP-binding protein ps...    89   4e-20
POTA_CLOD6 RecName: Full=Spermidine/putrescine import ATP-bindin...    89   4e-20
PHNC_BACSK RecName: Full=Phosphonates import ATP-binding protein...    89   4e-20
MACB_ACTAC RecName: Full=Macrolide export ATP-binding/permease p...    89   4e-20
LSRA_SALTY RecName: Full=Autoinducer 2 import ATP-binding protei...    89   4e-20
LSRA_SALPB RecName: Full=Autoinducer 2 import ATP-binding protei...    89   4e-20
LSRA_SALPA RecName: Full=Autoinducer 2 import ATP-binding protei...    89   4e-20
LSRA_SALCH RecName: Full=Autoinducer 2 import ATP-binding protei...    89   4e-20
LOLD_AQUAE RecName: Full=Lipoprotein-releasing system ATP-bindin...    89   4e-20
CBIO2_LACGA RecName: Full=Cobalt import ATP-binding protein cbiO...    89   4e-20
CBIO2_BACCR RecName: Full=Cobalt import ATP-binding protein cbiO...    89   4e-20
CBIO1_MYCPN RecName: Full=Cobalt import ATP-binding protein cbiO...    89   4e-20
BTUD_PHOPR RecName: Full=Vitamin B12 import ATP-binding protein ...    89   4e-20
Y462_METMA RecName: Full=Putative ABC transporter ATP-binding pr...    89   5e-20
Y2317_HALSA RecName: Full=Putative ABC transporter ATP-binding p...    89   5e-20
UGPC_BURCM RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    89   5e-20
SSUB_RHOP5 RecName: Full=Aliphatic sulfonates import ATP-binding...    89   5e-20
SAPF_SHIFL RecName: Full=Peptide transport system ATP-binding pr...    89   5e-20
SAPF_ECOLI RecName: Full=Peptide transport system ATP-binding pr...    89   5e-20
SAPF_ECOL6 RecName: Full=Peptide transport system ATP-binding pr...    89   5e-20
RBSA1_PASMU RecName: Full=Ribose import ATP-binding protein rbsA...    89   5e-20
PSTB2_HALMA RecName: Full=Phosphate import ATP-binding protein p...    89   5e-20
PHNC_CORGL RecName: Full=Phosphonates import ATP-binding protein...    89   5e-20
NRTD_SYNE7 RecName: Full=Nitrate transport ATP-binding protein n...    89   5e-20
NIKE_ECOUT RecName: Full=Nickel import ATP-binding protein nikE;...    89   5e-20
NIKE_ECOL6 RecName: Full=Nickel import ATP-binding protein nikE;...    89   5e-20
NIKE_ECOL5 RecName: Full=Nickel import ATP-binding protein nikE;...    89   5e-20
MACB_CHLCH RecName: Full=Macrolide export ATP-binding/permease p...    89   5e-20
LOLD_MANSM RecName: Full=Lipoprotein-releasing system ATP-bindin...    89   5e-20
DPPF_ECOLI RecName: Full=Dipeptide transport ATP-binding protein...    89   5e-20
CBIO_ENTFC RecName: Full=Cobalt import ATP-binding protein cbiO;...    89   5e-20
CBIO2_STAAC RecName: Full=Cobalt import ATP-binding protein cbiO...    89   5e-20
CBIO2_STAA8 RecName: Full=Cobalt import ATP-binding protein cbiO...    89   5e-20
CBIO2_STAA3 RecName: Full=Cobalt import ATP-binding protein cbiO...    89   5e-20
CBIO2_BACHK RecName: Full=Cobalt import ATP-binding protein cbiO...    89   5e-20
CBIO2_BACCZ RecName: Full=Cobalt import ATP-binding protein cbiO...    89   5e-20
CBIO2_BACAN RecName: Full=Cobalt import ATP-binding protein cbiO...    89   5e-20
CBIO2_BACAH RecName: Full=Cobalt import ATP-binding protein cbiO...    89   5e-20
ZNUC_YERPN RecName: Full=Zinc import ATP-binding protein znuC;  ...    88   7e-20
ZNUC_YERPE RecName: Full=Zinc import ATP-binding protein znuC;  ...    88   7e-20
ZNUC_YERPA RecName: Full=Zinc import ATP-binding protein znuC;  ...    88   7e-20
ZNUC_SHIFL RecName: Full=Zinc import ATP-binding protein znuC;  ...    88   7e-20
ZNUC_SHIF8 RecName: Full=Zinc import ATP-binding protein znuC;  ...    88   7e-20
Y2668_BACC1 RecName: Full=Putative ABC transporter ATP-binding p...    88   7e-20
UGPC_YERPS RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    88   7e-20
UGPC_BORPE RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    88   7e-20
UGPC_BORBR RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    88   7e-20
PSTB_PROAC RecName: Full=Phosphate import ATP-binding protein ps...    88   7e-20
PSTB_COLP3 RecName: Full=Phosphate import ATP-binding protein ps...    88   7e-20
PHNC_STAHJ RecName: Full=Phosphonates import ATP-binding protein...    88   7e-20
PHNC_SHIDS RecName: Full=Phosphonates import ATP-binding protein...    88   7e-20
PHNC_ECOUT RecName: Full=Phosphonates import ATP-binding protein...    88   7e-20
PHNC_ECOL6 RecName: Full=Phosphonates import ATP-binding protein...    88   7e-20
PHNC1_TRIEI RecName: Full=Phosphonates import ATP-binding protei...    88   7e-20
MODC_AGRT5 RecName: Full=Molybdenum import ATP-binding protein m...    88   7e-20
MACB_RHIME RecName: Full=Macrolide export ATP-binding/permease p...    88   7e-20
MACB_ACIAD RecName: Full=Macrolide export ATP-binding/permease p...    88   7e-20
LOLD_XANC5 RecName: Full=Lipoprotein-releasing system ATP-bindin...    88   7e-20
LOLD_METFK RecName: Full=Lipoprotein-releasing system ATP-bindin...    88   7e-20
CBIO_CARHZ RecName: Full=Cobalt import ATP-binding protein cbiO;...    88   7e-20
CBIO2_LACPL RecName: Full=Cobalt import ATP-binding protein cbiO...    88   7e-20
CBIO2_BACC1 RecName: Full=Cobalt import ATP-binding protein cbiO...    88   7e-20
ZNUC_YERPS RecName: Full=Zinc import ATP-binding protein znuC;  ...    88   9e-20
Y1934_STRMU RecName: Full=Putative ABC transporter ATP-binding p...    88   9e-20
XYLG_RALSO RecName: Full=Xylose import ATP-binding protein xylG;...    88   9e-20
UGPC_YERPN RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    88   9e-20
UGPC_YERPE RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    88   9e-20
UGPC_YERPA RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    88   9e-20
RBSA1_BURTA RecName: Full=Ribose import ATP-binding protein rbsA...    88   9e-20
PSTB_PSEHT RecName: Full=Phosphate import ATP-binding protein ps...    88   9e-20
POTA_PSEPF RecName: Full=Spermidine/putrescine import ATP-bindin...    88   9e-20
PHNC_STAAW RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
PHNC_STAAS RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
PHNC_STAAN RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
PHNC_STAAM RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
PHNC_STAAC RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
PHNC_STAA8 RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
PHNC_STAA3 RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
PHNC_SHIBS RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
PHNC_ECOLI RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
PHNC_BACCR RecName: Full=Phosphonates import ATP-binding protein...    88   9e-20
NRTC_SYNE7 RecName: Full=Nitrate transport ATP-binding protein n...    88   9e-20
MODC_SACD2 RecName: Full=Molybdenum import ATP-binding protein m...    88   9e-20
MODC_AZOSE RecName: Full=Molybdenum import ATP-binding protein m...    88   9e-20
MACB2_YERPS RecName: Full=Macrolide export ATP-binding/permease ...    88   9e-20
MACB2_YERPE RecName: Full=Macrolide export ATP-binding/permease ...    88   9e-20
MACB2_YERPA RecName: Full=Macrolide export ATP-binding/permease ...    88   9e-20
MACB1_YERPN RecName: Full=Macrolide export ATP-binding/permease ...    88   9e-20
LOLD2_RHORT RecName: Full=Lipoprotein-releasing system ATP-bindi...    88   9e-20
LIVF_ARCFU RecName: Full=Probable branched-chain amino acid tran...    88   9e-20
CYSA_SYNY3 RecName: Full=Sulfate/thiosulfate import ATP-binding ...    88   9e-20
CBIO_SYNWW RecName: Full=Cobalt import ATP-binding protein cbiO;...    88   9e-20
CBIO1_MYCGE RecName: Full=Cobalt import ATP-binding protein cbiO...    88   9e-20
CBIO1_BACSU RecName: Full=Cobalt import ATP-binding protein cbiO...    88   9e-20
BCEA_BACHD RecName: Full=Bacitracin export ATP-binding protein b...    88   9e-20
YFEB_YERPE RecName: Full=Chelated iron transport system membrane...    87   1e-19
YDCT_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    87   1e-19
Y5958_STRCO RecName: Full=Putative ABC transporter ATP-binding p...    87   1e-19
Y3105_BACHK RecName: Full=Putative ABC transporter ATP-binding p...    87   1e-19
Y2387_METMA RecName: Full=Putative ABC transporter ATP-binding p...    87   1e-19
Y089_METJA RecName: Full=Uncharacterized ABC transporter ATP-bin...    87   1e-19
THIQ_PASMU RecName: Full=Thiamine import ATP-binding protein thi...    87   1e-19
PSTB_CLOTE RecName: Full=Phosphate import ATP-binding protein ps...    87   1e-19
POTA_STAS1 RecName: Full=Spermidine/putrescine import ATP-bindin...    87   1e-19
POTA_NITMU RecName: Full=Spermidine/putrescine import ATP-bindin...    87   1e-19
PHNC_LACDB RecName: Full=Phosphonates import ATP-binding protein...    87   1e-19
PHNC_LACDA RecName: Full=Phosphonates import ATP-binding protein...    87   1e-19
NODI_RALEJ RecName: Full=Nod factor export ATP-binding protein I...    87   1e-19
NIKE_ECO57 RecName: Full=Nickel import ATP-binding protein nikE;...    87   1e-19
METN_HELPJ RecName: Full=Methionine import ATP-binding protein m...    87   1e-19
METN_HELPH RecName: Full=Methionine import ATP-binding protein m...    87   1e-19
MACB_CHLPD RecName: Full=Macrolide export ATP-binding/permease p...    87   1e-19
LOLD_SALTY RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   1e-19
LOLD_SALTI RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   1e-19
LOLD_SALPA RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   1e-19
CYSA_GLOVI RecName: Full=Sulfate/thiosulfate import ATP-binding ...    87   1e-19
CBIO1_STRTD RecName: Full=Cobalt import ATP-binding protein cbiO...    87   1e-19
CBIO1_STRT2 RecName: Full=Cobalt import ATP-binding protein cbiO...    87   1e-19
CBIO1_STRT1 RecName: Full=Cobalt import ATP-binding protein cbiO...    87   1e-19
Y4MK_RHISN RecName: Full=Uncharacterized ABC transporter ATP-bin...    87   2e-19
Y289_GLOVI RecName: Full=Putative ABC transporter ATP-binding pr...    87   2e-19
Y1893_SULSO RecName: Full=Putative ABC transporter ATP-binding p...    87   2e-19
SSUB_ZYMMO RecName: Full=Aliphatic sulfonates import ATP-binding...    87   2e-19
PSTB_PELCD RecName: Full=Phosphate import ATP-binding protein ps...    87   2e-19
PSTB_AQUAE RecName: Full=Phosphate import ATP-binding protein ps...    87   2e-19
PSTB1_LISMO RecName: Full=Phosphate import ATP-binding protein p...    87   2e-19
PSTB1_LISMF RecName: Full=Phosphate import ATP-binding protein p...    87   2e-19
PSTB1_LISIN RecName: Full=Phosphate import ATP-binding protein p...    87   2e-19
PSTB1_HALMA RecName: Full=Phosphate import ATP-binding protein p...    87   2e-19
POTA_STAES RecName: Full=Spermidine/putrescine import ATP-bindin...    87   2e-19
PHNC_ANAVT RecName: Full=Phosphonates import ATP-binding protein...    87   2e-19
PHNC1_HALMA RecName: Full=Phosphonates import ATP-binding protei...    87   2e-19
OPPD_BACSU RecName: Full=Oligopeptide transport ATP-binding prot...    87   2e-19
NIKE_SHIDS RecName: Full=Nickel import ATP-binding protein nikE;...    87   2e-19
LOLD_XANOR RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   2e-19
LOLD_XANOM RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   2e-19
LOLD_SALCH RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   2e-19
FBPC3_RHOSR RecName: Full=Fe(3+) ions import ATP-binding protein...    87   2e-19
DDPF_ECOLI RecName: Full=Probable D,D-dipeptide transport ATP-bi...    87   2e-19
YTRE_BACSU RecName: Full=ABC transporter ATP-binding protein ytrE;     87   2e-19
Y4OS_RHISN RecName: Full=Uncharacterized ABC transporter ATP-bin...    87   2e-19
PSTB_RHILO RecName: Full=Phosphate import ATP-binding protein ps...    87   2e-19
PSTB_ALHEH RecName: Full=Phosphate import ATP-binding protein ps...    87   2e-19
PHNC_SHIFL RecName: Full=Phosphonates import ATP-binding protein...    87   2e-19
PHNC_SHIF8 RecName: Full=Phosphonates import ATP-binding protein...    87   2e-19
OPPF_HAEIN RecName: Full=Oligopeptide transport ATP-binding prot...    87   2e-19
OPPD_ECOLI RecName: Full=Oligopeptide transport ATP-binding prot...    87   2e-19
METN_CLOD6 RecName: Full=Methionine import ATP-binding protein m...    87   2e-19
LOLD_YERPN RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   2e-19
LOLD_YERPE RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   2e-19
LOLD_YERPA RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   2e-19
LOLD_RHOP2 RecName: Full=Lipoprotein-releasing system ATP-bindin...    87   2e-19
HMUV_JANSC RecName: Full=Hemin import ATP-binding protein hmuV; ...    87   2e-19
CYSA_XYLFT RecName: Full=Sulfate/thiosulfate import ATP-binding ...    87   2e-19
CBIO_MOOTA RecName: Full=Cobalt import ATP-binding protein cbiO;...    87   2e-19
CBIO2_MYCGA RecName: Full=Cobalt import ATP-binding protein cbiO...    87   2e-19
CBIO2_BACSU RecName: Full=Cobalt import ATP-binding protein cbiO...    87   2e-19
CBIO2_BACLD RecName: Full=Cobalt import ATP-binding protein cbiO...    87   2e-19
CBIO1_MYCGA RecName: Full=Cobalt import ATP-binding protein cbiO...    87   2e-19
ABCA3_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    87   2e-19
ZNUC_RICTY RecName: Full=Zinc import ATP-binding protein znuC;  ...    86   3e-19
YADG_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    86   3e-19
Y373_PYRAB RecName: Full=Putative ABC transporter ATP-binding pr...    86   3e-19
UGPC_YERE8 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    86   3e-19
UGPC_BORPA RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    86   3e-19
PSTB_CORJK RecName: Full=Phosphate import ATP-binding protein ps...    86   3e-19
POTA_ROSDO RecName: Full=Spermidine/putrescine import ATP-bindin...    86   3e-19
POTA_PSEAB RecName: Full=Spermidine/putrescine import ATP-bindin...    86   3e-19
POTA2_PSEAE RecName: Full=Spermidine/putrescine import ATP-bindi...    86   3e-19
PHNC_STAAR RecName: Full=Phosphonates import ATP-binding protein...    86   3e-19
PHNC2_ANASP RecName: Full=Phosphonates import ATP-binding protei...    86   3e-19
MODC_MAGSA RecName: Full=Molybdenum import ATP-binding protein m...    86   3e-19
LSRA_SALTI RecName: Full=Autoinducer 2 import ATP-binding protei...    86   3e-19
LOLD_XANAC RecName: Full=Lipoprotein-releasing system ATP-bindin...    86   3e-19
LOLD_PSEPK RecName: Full=Lipoprotein-releasing system ATP-bindin...    86   3e-19
LOLD_ANADE RecName: Full=Lipoprotein-releasing system ATP-bindin...    86   3e-19
CBIO2_STAAW RecName: Full=Cobalt import ATP-binding protein cbiO...    86   3e-19
CBIO2_STAAS RecName: Full=Cobalt import ATP-binding protein cbiO...    86   3e-19
CBIO2_STAAR RecName: Full=Cobalt import ATP-binding protein cbiO...    86   3e-19
CBIO2_STAAN RecName: Full=Cobalt import ATP-binding protein cbiO...    86   3e-19
CBIO2_STAAM RecName: Full=Cobalt import ATP-binding protein cbiO...    86   3e-19
CBIO1_LACLA RecName: Full=Cobalt import ATP-binding protein cbiO...    86   3e-19
ABCA1_DICDI RecName: Full=ABC transporter A family member 1;AltN...    86   3e-19
YHDZ_ECOLI RecName: Full=Uncharacterized amino-acid ABC transpor...    86   4e-19
Y483_STRPN RecName: Full=Putative ABC transporter ATP-binding pr...    86   4e-19
Y361_HAEIN RecName: Full=Probable iron transport system ATP-bind...    86   4e-19
Y222_THEMA RecName: Full=Putative ABC transporter ATP-binding pr...    86   4e-19
Y1242_METJA RecName: Full=Uncharacterized ABC transporter ATP-bi...    86   4e-19
Y1216_LISMF RecName: Full=Putative ABC transporter ATP-binding p...    86   4e-19
Y1207_LISMO RecName: Full=Putative ABC transporter ATP-binding p...    86   4e-19
TAUB_BURS3 RecName: Full=Taurine import ATP-binding protein tauB...    86   4e-19
SSUB1_RHILO RecName: Full=Aliphatic sulfonates import ATP-bindin...    86   4e-19
SKFE_BACSU RecName: Full=SkfA peptide export ATP-binding protein...    86   4e-19
LOLD_PSEPF RecName: Full=Lipoprotein-releasing system ATP-bindin...    86   4e-19
LOLD_ERWCT RecName: Full=Lipoprotein-releasing system ATP-bindin...    86   4e-19
LOLD1_RHORT RecName: Full=Lipoprotein-releasing system ATP-bindi...    86   4e-19
HMUV_SODGM RecName: Full=Hemin import ATP-binding protein hmuV; ...    86   4e-19
CBIO2_CLOAB RecName: Full=Cobalt import ATP-binding protein cbiO...    86   4e-19
CBIO1_CLOPS RecName: Full=Cobalt import ATP-binding protein cbiO...    86   4e-19
CBIO1_CLONN RecName: Full=Cobalt import ATP-binding protein cbiO...    86   4e-19
ARTP_SHIFL RecName: Full=Arginine transport ATP-binding protein ...    86   4e-19
ARTP_ECOLI RecName: Full=Arginine transport ATP-binding protein ...    86   4e-19
ARTP_ECOL6 RecName: Full=Arginine transport ATP-binding protein ...    86   4e-19
ARTP_ECO57 RecName: Full=Arginine transport ATP-binding protein ...    86   4e-19
ABCAC_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    86   4e-19
Y542_CHLPN RecName: Full=Probable metal transport system ATP-bin...    86   5e-19
Y2593_MYCBO RecName: Full=Uncharacterized ABC transporter ATP-bi...    86   5e-19
Y2564_MYCTU RecName: Full=Uncharacterized ABC transporter ATP-bi...    86   5e-19
TAUB_PELUB RecName: Full=Taurine import ATP-binding protein tauB...    86   5e-19
SSUB_BACCZ RecName: Full=Aliphatic sulfonates import ATP-binding...    86   5e-19
SSUB_BACCR RecName: Full=Aliphatic sulfonates import ATP-binding...    86   5e-19
PSTB_THEFY RecName: Full=Phosphate import ATP-binding protein ps...    86   5e-19
POTA_CLOTH RecName: Full=Spermidine/putrescine import ATP-bindin...    86   5e-19
PHNC_STAAB RecName: Full=Phosphonates import ATP-binding protein...    86   5e-19
PHNC_LACGA RecName: Full=Phosphonates import ATP-binding protein...    86   5e-19
NIKE_ECOLI RecName: Full=Nickel import ATP-binding protein nikE;...    86   5e-19
MODC_SHEON RecName: Full=Molybdenum import ATP-binding protein m...    86   5e-19
MNTB_BACSU RecName: Full=Manganese transport system ATP-binding ...    86   5e-19
METN_LACDB RecName: Full=Methionine import ATP-binding protein m...    86   5e-19
METN_LACDA RecName: Full=Methionine import ATP-binding protein m...    86   5e-19
METN2_PSEF5 RecName: Full=Methionine import ATP-binding protein ...    86   5e-19
MACB_BARHE RecName: Full=Macrolide export ATP-binding/permease p...    86   5e-19
LOLD_HAEDU RecName: Full=Lipoprotein-releasing system ATP-bindin...    86   5e-19
HMUV_RHILE RecName: Full=Hemin import ATP-binding protein hmuV; ...    86   5e-19
CYSA_RALSO RecName: Full=Sulfate/thiosulfate import ATP-binding ...    86   5e-19
CBIO_SALTY RecName: Full=Cobalt import ATP-binding protein cbiO;...    86   5e-19
CBIO2_STAAB RecName: Full=Cobalt import ATP-binding protein cbiO...    86   5e-19
ZNUC_SALTI RecName: Full=Zinc import ATP-binding protein znuC;  ...    85   6e-19
ZNUC_SALPA RecName: Full=Zinc import ATP-binding protein znuC;  ...    85   6e-19
ZNUC_SALCH RecName: Full=Zinc import ATP-binding protein znuC;  ...    85   6e-19
ZNUC_RICPR RecName: Full=Zinc import ATP-binding protein znuC;  ...    85   6e-19
ZNUC_RHIL3 RecName: Full=Zinc import ATP-binding protein znuC;  ...    85   6e-19
YKNV_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    85   6e-19
UGPC_BORA1 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    85   6e-19
TAUB_PSESM RecName: Full=Taurine import ATP-binding protein tauB...    85   6e-19
SSUB1_XANAC RecName: Full=Aliphatic sulfonates import ATP-bindin...    85   6e-19
SAPF_SALTY RecName: Full=Peptide transport system ATP-binding pr...    85   6e-19
PSTB_XYLFA RecName: Full=Phosphate import ATP-binding protein ps...    85   6e-19
PSTB_SHEDO RecName: Full=Phosphate import ATP-binding protein ps...    85   6e-19
PSTB_METMA RecName: Full=Phosphate import ATP-binding protein ps...    85   6e-19
PSTB3_STRA1 RecName: Full=Phosphate import ATP-binding protein p...    85   6e-19
PHNC_DESDG RecName: Full=Phosphonates import ATP-binding protein...    85   6e-19
NIKE_SHISS RecName: Full=Nickel import ATP-binding protein nikE;...    85   6e-19
NIKE_SHIBS RecName: Full=Nickel import ATP-binding protein nikE;...    85   6e-19
MACB_AGRT5 RecName: Full=Macrolide export ATP-binding/permease p...    85   6e-19
HMUV_BRAJA RecName: Full=Hemin import ATP-binding protein hmuV; ...    85   6e-19
FTSE_HAEIN RecName: Full=Cell division ATP-binding protein ftsE;       85   6e-19
CBIO3_CLOP1 RecName: Full=Cobalt import ATP-binding protein cbiO...    85   6e-19
CBIO2_ENTFA RecName: Full=Cobalt import ATP-binding protein cbiO...    85   6e-19
CBIO2_CLOTE RecName: Full=Cobalt import ATP-binding protein cbiO...    85   6e-19
CBIO2_CLOPS RecName: Full=Cobalt import ATP-binding protein cbiO...    85   6e-19
CBIO2_CLOPE RecName: Full=Cobalt import ATP-binding protein cbiO...    85   6e-19
ZNUC_SALTY RecName: Full=Zinc import ATP-binding protein znuC;  ...    85   8e-19
Y412_METJA RecName: Full=Uncharacterized ABC transporter ATP-bin...    85   8e-19
Y1815_PYRHO RecName: Full=Putative ABC transporter ATP-binding p...    85   8e-19
THIQ_HAES1 RecName: Full=Thiamine import ATP-binding protein thi...    85   8e-19
SSUB_RHOFD RecName: Full=Aliphatic sulfonates import ATP-binding...    85   8e-19
SSUB_BACHK RecName: Full=Aliphatic sulfonates import ATP-binding...    85   8e-19
SSUB_BACAN RecName: Full=Aliphatic sulfonates import ATP-binding...    85   8e-19
PSTB_SHESR RecName: Full=Phosphate import ATP-binding protein ps...    85   8e-19
PSTB_SHESM RecName: Full=Phosphate import ATP-binding protein ps...    85   8e-19
PSTB_PSYCK RecName: Full=Phosphate import ATP-binding protein ps...    85   8e-19
PSTB_METBU RecName: Full=Phosphate import ATP-binding protein ps...    85   8e-19
PSTB_CLOPS RecName: Full=Phosphate import ATP-binding protein ps...    85   8e-19
PSTB_CLOPE RecName: Full=Phosphate import ATP-binding protein ps...    85   8e-19
PSTB_CLOP1 RecName: Full=Phosphate import ATP-binding protein ps...    85   8e-19
PSTB1_SHEON RecName: Full=Phosphate import ATP-binding protein p...    85   8e-19
PEB1C_CAMJJ RecName: Full=Probable ABC transporter ATP-binding p...    85   8e-19
MODC_RHIEC RecName: Full=Molybdenum import ATP-binding protein m...    85   8e-19
METN_STAS1 RecName: Full=Methionine import ATP-binding protein m...    85   8e-19
METN_RHIME RecName: Full=Methionine import ATP-binding protein m...    85   8e-19
METN_RHILO RecName: Full=Methionine import ATP-binding protein m...    85   8e-19
MACB_BARQU RecName: Full=Macrolide export ATP-binding/permease p...    85   8e-19
HISP_PSEAE RecName: Full=Histidine transport ATP-binding protein...    85   8e-19
CBIO1_LACLS RecName: Full=Cobalt import ATP-binding protein cbiO...    85   8e-19
CBIO1_LACLM RecName: Full=Cobalt import ATP-binding protein cbiO...    85   8e-19
ZNUC_PARDP RecName: Full=Zinc import ATP-binding protein znuC;  ...    84   1e-18
YURJ_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    84   1e-18
THIQ_HAEIN RecName: Full=Thiamine import ATP-binding protein thi...    84   1e-18
THIQ_BRUSU RecName: Full=Thiamine import ATP-binding protein thi...    84   1e-18
THIQ_BRUME RecName: Full=Thiamine import ATP-binding protein thi...    84   1e-18
SSUB_BACAH RecName: Full=Aliphatic sulfonates import ATP-binding...    84   1e-18
PSTB_THEEB RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB_STRGR RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB_RHOSR RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB_PELLD RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB_GLUOX RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB_CORGL RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB_CLOAB RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB2_VIBF1 RecName: Full=Phosphate import ATP-binding protein p...    84   1e-18
PSTB2_MYCTU RecName: Full=Phosphate import ATP-binding protein p...    84   1e-18
PSTB2_MYCBO RecName: Full=Phosphate import ATP-binding protein p...    84   1e-18
PSTB2_BACSK RecName: Full=Phosphate import ATP-binding protein p...    84   1e-18
PHNC_LACJO RecName: Full=Phosphonates import ATP-binding protein...    84   1e-18
PEB1C_CAMJE RecName: Full=Probable ABC transporter ATP-binding p...    84   1e-18
OPPF_ECOLI RecName: Full=Oligopeptide transport ATP-binding prot...    84   1e-18
MODC_GRABC RecName: Full=Molybdenum import ATP-binding protein m...    84   1e-18
MACB2_PSEU2 RecName: Full=Macrolide export ATP-binding/permease ...    84   1e-18
LOLD_YERPS RecName: Full=Lipoprotein-releasing system ATP-bindin...    84   1e-18
LOLD2_RHOPB RecName: Full=Lipoprotein-releasing system ATP-bindi...    84   1e-18
CBIO1_STRMU RecName: Full=Cobalt import ATP-binding protein cbiO...    84   1e-18
CBIO1_BACHD RecName: Full=Cobalt import ATP-binding protein cbiO...    84   1e-18
AB17I_ARATH RecName: Full=ABC transporter I family member 17;   ...    84   1e-18
YKFD_BACSU RecName: Full=Putative oligopeptide transport ATP-bin...    84   1e-18
YHAQ_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    84   1e-18
THIQ_RHIME RecName: Full=Thiamine import ATP-binding protein thi...    84   1e-18
RBSA_BURMA RecName: Full=Ribose import ATP-binding protein rbsA;...    84   1e-18
RBSA1_BURP1 RecName: Full=Ribose import ATP-binding protein rbsA...    84   1e-18
PSTB_PSYA2 RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB_PASMU RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB_ANADE RecName: Full=Phosphate import ATP-binding protein ps...    84   1e-18
PSTB1_VIBPA RecName: Full=Phosphate import ATP-binding protein p...    84   1e-18
PHNC2_RALEH RecName: Full=Phosphonates import ATP-binding protei...    84   1e-18
PHNC2_PSESM RecName: Full=Phosphonates import ATP-binding protei...    84   1e-18
PHNC2_PSE14 RecName: Full=Phosphonates import ATP-binding protei...    84   1e-18
LOLD_TREDE RecName: Full=Lipoprotein-releasing system ATP-bindin...    84   1e-18
LOLD_IDILO RecName: Full=Lipoprotein-releasing system ATP-bindin...    84   1e-18
HMUV_PASPI RecName: Full=Hemin import ATP-binding protein hmuV; ...    84   1e-18
CBIO1_CLOP1 RecName: Full=Cobalt import ATP-binding protein cbiO...    84   1e-18
ABCA3_DICDI RecName: Full=ABC transporter A family member 3;AltN...    84   1e-18
ZNUC_SACD2 RecName: Full=Zinc import ATP-binding protein znuC;  ...    84   2e-18
ZNUC_PHOLL RecName: Full=Zinc import ATP-binding protein znuC;  ...    84   2e-18
Y731_ARCFU RecName: Full=Putative ABC transporter ATP-binding pr...    84   2e-18
UGPC_BURCH RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    84   2e-18
UGPC_BURCA RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    84   2e-18
THIQ_VIBF1 RecName: Full=Thiamine import ATP-binding protein thi...    84   2e-18
TAUB_PARPN RecName: Full=Taurine import ATP-binding protein tauB...    84   2e-18
PSTB_STRAW RecName: Full=Phosphate import ATP-binding protein ps...    84   2e-18
PSTB3_STRR6 RecName: Full=Phosphate import ATP-binding protein p...    84   2e-18
PSTB3_STRPN RecName: Full=Phosphate import ATP-binding protein p...    84   2e-18
PSTB3_STRA5 RecName: Full=Phosphate import ATP-binding protein p...    84   2e-18
PSTB3_STRA3 RecName: Full=Phosphate import ATP-binding protein p...    84   2e-18
PSTB2_CHRSD RecName: Full=Phosphate import ATP-binding protein p...    84   2e-18
PSTB1_GLOVI RecName: Full=Phosphate import ATP-binding protein p...    84   2e-18
POTA_STAAW RecName: Full=Spermidine/putrescine import ATP-bindin...    84   2e-18
POTA_STAAS RecName: Full=Spermidine/putrescine import ATP-bindin...    84   2e-18
POTA_STAAR RecName: Full=Spermidine/putrescine import ATP-bindin...    84   2e-18
POTA_STAAN RecName: Full=Spermidine/putrescine import ATP-bindin...    84   2e-18
POTA_STAAM RecName: Full=Spermidine/putrescine import ATP-bindin...    84   2e-18
POTA_STAAC RecName: Full=Spermidine/putrescine import ATP-bindin...    84   2e-18
POTA_STAAB RecName: Full=Spermidine/putrescine import ATP-bindin...    84   2e-18
POTA_STAA8 RecName: Full=Spermidine/putrescine import ATP-bindin...    84   2e-18
POTA_STAA3 RecName: Full=Spermidine/putrescine import ATP-bindin...    84   2e-18
PHNC_LACLS RecName: Full=Phosphonates import ATP-binding protein...    84   2e-18
NDVA_AGRVI RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    84   2e-18
MODC_RHIL3 RecName: Full=Molybdenum import ATP-binding protein m...    84   2e-18
LOLD2_RHOPA RecName: Full=Lipoprotein-releasing system ATP-bindi...    84   2e-18
FTSE_SHIFL RecName: Full=Cell division ATP-binding protein ftsE;       84   2e-18
FTSE_ECOLI RecName: Full=Cell division ATP-binding protein ftsE;       84   2e-18
FTSE_ECOL6 RecName: Full=Cell division ATP-binding protein ftsE;       84   2e-18
FTSE_ECO57 RecName: Full=Cell division ATP-binding protein ftsE;       84   2e-18
FBPC_YEREN RecName: Full=Fe(3+) ions import ATP-binding protein ...    84   2e-18
ZNUC_ERWCT RecName: Full=Zinc import ATP-binding protein znuC;  ...    83   2e-18
YVRO_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    83   2e-18
Y3551_METAC RecName: Full=Putative ABC transporter ATP-binding p...    83   2e-18
Y1633_STRA5 RecName: Full=Putative ABC transporter ATP-binding p...    83   2e-18
XYLG_BRUAB RecName: Full=Xylose import ATP-binding protein xylG;...    83   2e-18
XYLG_BRUA2 RecName: Full=Xylose import ATP-binding protein xylG;...    83   2e-18
UGPC_BURS3 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    83   2e-18
THIQ_BRUAB RecName: Full=Thiamine import ATP-binding protein thi...    83   2e-18
THIQ_BRUA2 RecName: Full=Thiamine import ATP-binding protein thi...    83   2e-18
TAUB_PSEPK RecName: Full=Taurine import ATP-binding protein tauB...    83   2e-18
PSTB_XYLFT RecName: Full=Phosphate import ATP-binding protein ps...    83   2e-18
PSTB_PSEAE RecName: Full=Phosphate import ATP-binding protein ps...    83   2e-18
PSTB_HAEI8 RecName: Full=Phosphate import ATP-binding protein ps...    83   2e-18
PSTB_CAMJR RecName: Full=Phosphate import ATP-binding protein ps...    83   2e-18
PSTB_CAMJE RecName: Full=Phosphate import ATP-binding protein ps...    83   2e-18
PHNC_RALEJ RecName: Full=Phosphonates import ATP-binding protein...    83   2e-18
MACB_SALTY RecName: Full=Macrolide export ATP-binding/permease p...    83   2e-18
MACB_SALTI RecName: Full=Macrolide export ATP-binding/permease p...    83   2e-18
MACB_SALPA RecName: Full=Macrolide export ATP-binding/permease p...    83   2e-18
MACB_PSYA2 RecName: Full=Macrolide export ATP-binding/permease p...    83   2e-18
LOLD_XANCP RecName: Full=Lipoprotein-releasing system ATP-bindin...    83   2e-18
LOLD_XANC8 RecName: Full=Lipoprotein-releasing system ATP-bindin...    83   2e-18
LOLD_RHOPS RecName: Full=Lipoprotein-releasing system ATP-bindin...    83   2e-18
LOLD_BURTA RecName: Full=Lipoprotein-releasing system ATP-bindin...    83   2e-18
FTSE_BACSU RecName: Full=Cell division ATP-binding protein ftsE;       83   2e-18
CBIO_SALTI RecName: Full=Cobalt import ATP-binding protein cbiO;...    83   2e-18
CBIO_SALPA RecName: Full=Cobalt import ATP-binding protein cbiO;...    83   2e-18
CBIO2_SYMTH RecName: Full=Cobalt import ATP-binding protein cbiO...    83   2e-18
CBIO2_STRA5 RecName: Full=Cobalt import ATP-binding protein cbiO...    83   2e-18
CBIO2_STRA3 RecName: Full=Cobalt import ATP-binding protein cbiO...    83   2e-18
CBIO2_STRA1 RecName: Full=Cobalt import ATP-binding protein cbiO...    83   2e-18
CBIO2_LACS1 RecName: Full=Cobalt import ATP-binding protein cbiO...    83   2e-18
CBIO1_LACDB RecName: Full=Cobalt import ATP-binding protein cbiO...    83   2e-18
ABCA3_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    83   2e-18
ZNUC_VIBVY RecName: Full=Zinc import ATP-binding protein znuC;  ...    83   3e-18
ZNUC_VIBVU RecName: Full=Zinc import ATP-binding protein znuC;  ...    83   3e-18
Y246_THETN RecName: Full=Putative ABC transporter ATP-binding pr...    83   3e-18
Y1170_LISIN RecName: Full=Putative ABC transporter ATP-binding p...    83   3e-18
PSTB_RUBXD RecName: Full=Phosphate import ATP-binding protein ps...    83   3e-18
PSTB_RHORT RecName: Full=Phosphate import ATP-binding protein ps...    83   3e-18
PSTB_BIFLO RecName: Full=Phosphate import ATP-binding protein ps...    83   3e-18
PSTB2_MAGSA RecName: Full=Phosphate import ATP-binding protein p...    83   3e-18
PSTB1_PHOPR RecName: Full=Phosphate import ATP-binding protein p...    83   3e-18
PHNC2_PSEU2 RecName: Full=Phosphonates import ATP-binding protei...    83   3e-18
NRTD_SYNY3 RecName: Full=Putative nitrate transport ATP-binding ...    83   3e-18
MALK_PHOPR RecName: Full=Maltose/maltodextrin import ATP-binding...    83   3e-18
MACB_PHOLL RecName: Full=Macrolide export ATP-binding/permease p...    83   3e-18
HMUV_LISDA RecName: Full=Hemin import ATP-binding protein hmuV; ...    83   3e-18
CBIO_SYNAS RecName: Full=Cobalt import ATP-binding protein cbiO;...    83   3e-18
CBIO2_STRR6 RecName: Full=Cobalt import ATP-binding protein cbiO...    83   3e-18
CBIO2_STRPN RecName: Full=Cobalt import ATP-binding protein cbiO...    83   3e-18
CBIO2_STRP2 RecName: Full=Cobalt import ATP-binding protein cbiO...    83   3e-18
CBIO2_STRMU RecName: Full=Cobalt import ATP-binding protein cbiO...    83   3e-18
CBIO1_LEUMM RecName: Full=Cobalt import ATP-binding protein cbiO...    83   3e-18
ZNUC_MARAV RecName: Full=Zinc import ATP-binding protein znuC;  ...    82   4e-18
Y1312_MYCBO RecName: Full=Uncharacterized ABC transporter ATP-bi...    82   4e-18
Y1281_MYCTU RecName: Full=Uncharacterized ABC transporter ATP-bi...    82   4e-18
THIQ_YERPS RecName: Full=Thiamine import ATP-binding protein thi...    82   4e-18
THIQ_YERPN RecName: Full=Thiamine import ATP-binding protein thi...    82   4e-18
THIQ_YERPE RecName: Full=Thiamine import ATP-binding protein thi...    82   4e-18
THIQ_YERPA RecName: Full=Thiamine import ATP-binding protein thi...    82   4e-18
SSUB_PSEPF RecName: Full=Aliphatic sulfonates import ATP-binding...    82   4e-18
SSUB_BRAJA RecName: Full=Aliphatic sulfonates import ATP-binding...    82   4e-18
SSUB2_PSESM RecName: Full=Aliphatic sulfonates import ATP-bindin...    82   4e-18
SSUB1_PSEU2 RecName: Full=Aliphatic sulfonates import ATP-bindin...    82   4e-18
SSUB1_PSE14 RecName: Full=Aliphatic sulfonates import ATP-bindin...    82   4e-18
PSTB_LACDA RecName: Full=Phosphate import ATP-binding protein ps...    82   4e-18
PSTB1_PSE14 RecName: Full=Phosphate import ATP-binding protein p...    82   4e-18
MSMX_BACSU RecName: Full=Maltodextrin import ATP-binding protein...    82   4e-18
METN2_BURPS RecName: Full=Methionine import ATP-binding protein ...    82   4e-18
METN2_BURP1 RecName: Full=Methionine import ATP-binding protein ...    82   4e-18
METN2_BURMA RecName: Full=Methionine import ATP-binding protein ...    82   4e-18
LOLD_PSYCK RecName: Full=Lipoprotein-releasing system ATP-bindin...    82   4e-18
LKTB_MANGL RecName: Full=Leukotoxin translocation ATP-binding pr...    82   4e-18
CBIO2_LACBA RecName: Full=Cobalt import ATP-binding protein cbiO...    82   4e-18
CBIO1_STAHJ RecName: Full=Cobalt import ATP-binding protein cbiO...    82   4e-18
ZNUC_RHIME RecName: Full=Zinc import ATP-binding protein znuC;  ...    82   5e-18
Y3323_BACC1 RecName: Full=Putative ABC transporter ATP-binding p...    82   5e-18
Y195_CLOPE RecName: Full=Putative ABC transporter ATP-binding pr...    82   5e-18
XYLG_BRUME RecName: Full=Xylose import ATP-binding protein xylG;...    82   5e-18
UGPC_SALTI RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    82   5e-18
THIQ_VIBVY RecName: Full=Thiamine import ATP-binding protein thi...    82   5e-18
THIQ_VIBVU RecName: Full=Thiamine import ATP-binding protein thi...    82   5e-18
THIQ_SHIF8 RecName: Full=Thiamine import ATP-binding protein thi...    82   5e-18
THIQ_SHIBS RecName: Full=Thiamine import ATP-binding protein thi...    82   5e-18
TAUB_PSEPU RecName: Full=Taurine import ATP-binding protein tauB...    82   5e-18
PSTB_BURSP RecName: Full=Phosphate import ATP-binding protein ps...    82   5e-18
PSTB_BORPE RecName: Full=Phosphate import ATP-binding protein ps...    82   5e-18
PSTB_BORPA RecName: Full=Phosphate import ATP-binding protein ps...    82   5e-18
PSTB_BORBR RecName: Full=Phosphate import ATP-binding protein ps...    82   5e-18
PSTB1_PSEU2 RecName: Full=Phosphate import ATP-binding protein p...    82   5e-18
PSTB1_PSESM RecName: Full=Phosphate import ATP-binding protein p...    82   5e-18
PHNC_LACLA RecName: Full=Phosphonates import ATP-binding protein...    82   5e-18
OPPF_SALTY RecName: Full=Oligopeptide transport ATP-binding prot...    82   5e-18
MODC2_BRAJA RecName: Full=Molybdenum import ATP-binding protein ...    82   5e-18
MNTB_BACHD RecName: Full=Manganese transport system ATP-binding ...    82   5e-18
MACB_ERWCT RecName: Full=Macrolide export ATP-binding/permease p...    82   5e-18
LOLD_SYNAS RecName: Full=Lipoprotein-releasing system ATP-bindin...    82   5e-18
LOLD_SHEON RecName: Full=Lipoprotein-releasing system ATP-bindin...    82   5e-18
LOLD_NITOC RecName: Full=Lipoprotein-releasing system ATP-bindin...    82   5e-18
LOLD_NITMU RecName: Full=Lipoprotein-releasing system ATP-bindin...    82   5e-18
LOLD_LEGPH RecName: Full=Lipoprotein-releasing system ATP-bindin...    82   5e-18
LKTB_PASTR RecName: Full=Leukotoxin translocation ATP-binding pr...    82   5e-18
LKTB7_PASHA RecName: Full=Leukotoxin translocation ATP-binding p...    82   5e-18
LKB2B_PASHA RecName: Full=Leukotoxin translocation ATP-binding p...    82   5e-18
LKB2A_PASHA RecName: Full=Leukotoxin translocation ATP-binding p...    82   5e-18
LKB1B_PASHA RecName: Full=Leukotoxin translocation ATP-binding p...    82   5e-18
LKB1A_PASHA RecName: Full=Leukotoxin translocation ATP-binding p...    82   5e-18
LKB16_PASHA RecName: Full=Leukotoxin translocation ATP-binding p...    82   5e-18
LKB14_PASHA RecName: Full=Leukotoxin translocation ATP-binding p...    82   5e-18
LKB13_PASHA RecName: Full=Leukotoxin translocation ATP-binding p...    82   5e-18
HMUV_RHOPA RecName: Full=Hemin import ATP-binding protein hmuV; ...    82   5e-18
HLYB_PROVU RecName: Full=Alpha-hemolysin translocation ATP-bindi...    82   5e-18
CYSA2_CHRVO RecName: Full=Sulfate/thiosulfate import ATP-binding...    82   5e-18
CBIO2_SPIKU RecName: Full=Cobalt import ATP-binding protein cbiO...    82   5e-18
CBIO1_LACDA RecName: Full=Cobalt import ATP-binding protein cbiO...    82   5e-18
CBIO1_CLOTH RecName: Full=Cobalt import ATP-binding protein cbiO...    82   5e-18
ZNUC_MANSM RecName: Full=Zinc import ATP-binding protein znuC;  ...    82   7e-18
ZNUC_EHRRW RecName: Full=Zinc import ATP-binding protein znuC;  ...    82   7e-18
ZNUC_EHRRG RecName: Full=Zinc import ATP-binding protein znuC;  ...    82   7e-18
YCOBA_PROFR RecName: Full=Putative ABC transporter ATP-binding p...    82   7e-18
Y182_METKA RecName: Full=Putative ABC transporter ATP-binding pr...    82   7e-18
Y1680_STRA3 RecName: Full=Putative ABC transporter ATP-binding p...    82   7e-18
THIQ_HAEI8 RecName: Full=Thiamine import ATP-binding protein thi...    82   7e-18
TAUB_PSEE4 RecName: Full=Taurine import ATP-binding protein tauB...    82   7e-18
PSTB_SPHAL RecName: Full=Phosphate import ATP-binding protein ps...    82   7e-18
PSTB_BRAJA RecName: Full=Phosphate import ATP-binding protein ps...    82   7e-18
PSTB_ARCFU RecName: Full=Phosphate import ATP-binding protein ps...    82   7e-18
PSTB2_LISMO RecName: Full=Phosphate import ATP-binding protein p...    82   7e-18
PSTB2_LISMF RecName: Full=Phosphate import ATP-binding protein p...    82   7e-18
PSTB2_LISIN RecName: Full=Phosphate import ATP-binding protein p...    82   7e-18
PSTB1_YERPS RecName: Full=Phosphate import ATP-binding protein p...    82   7e-18
PSTB1_YERPN RecName: Full=Phosphate import ATP-binding protein p...    82   7e-18
PSTB1_YERPE RecName: Full=Phosphate import ATP-binding protein p...    82   7e-18
PSTB1_YERPA RecName: Full=Phosphate import ATP-binding protein p...    82   7e-18
PHNC1_BACHD RecName: Full=Phosphonates import ATP-binding protei...    82   7e-18
MACB_BRUA2 RecName: Full=Macrolide export ATP-binding/permease p...    82   7e-18
MACB_AZOSB RecName: Full=Macrolide export ATP-binding/permease p...    82   7e-18
MACB2_YERPN RecName: Full=Macrolide export ATP-binding/permease ...    82   7e-18
MACB1_YERPS RecName: Full=Macrolide export ATP-binding/permease ...    82   7e-18
MACB1_YERPE RecName: Full=Macrolide export ATP-binding/permease ...    82   7e-18
MACB1_YERPA RecName: Full=Macrolide export ATP-binding/permease ...    82   7e-18
LOLD_BDEBA RecName: Full=Lipoprotein-releasing system ATP-bindin...    82   7e-18
LOLD1_RHOPB RecName: Full=Lipoprotein-releasing system ATP-bindi...    82   7e-18
LOLD1_CHLCH RecName: Full=Lipoprotein-releasing system ATP-bindi...    82   7e-18
HMUV_SALRD RecName: Full=Hemin import ATP-binding protein hmuV; ...    82   7e-18
HLYBP_ECOLX RecName: Full=Alpha-hemolysin translocation ATP-bind...    82   7e-18
HLYBC_ECOLX RecName: Full=Alpha-hemolysin translocation ATP-bind...    82   7e-18
CBIO2_STRSV RecName: Full=Cobalt import ATP-binding protein cbiO...    82   7e-18
CBIO1_STRSV RecName: Full=Cobalt import ATP-binding protein cbiO...    82   7e-18
XYLG_BRUSU RecName: Full=Xylose import ATP-binding protein xylG;...    81   9e-18
THIQ_SALPA RecName: Full=Thiamine import ATP-binding protein thi...    81   9e-18
THIQ_SALCH RecName: Full=Thiamine import ATP-binding protein thi...    81   9e-18
PSTB_SHEFN RecName: Full=Phosphate import ATP-binding protein ps...    81   9e-18
PSTB_RHOPS RecName: Full=Phosphate import ATP-binding protein ps...    81   9e-18
PSTB_RHOBA RecName: Full=Phosphate import ATP-binding protein ps...    81   9e-18
PSTB_METKA RecName: Full=Phosphate import ATP-binding protein ps...    81   9e-18
PSTB1_BACSU RecName: Full=Phosphate import ATP-binding protein p...    81   9e-18
POTA_BORGA RecName: Full=Spermidine/putrescine import ATP-bindin...    81   9e-18
POTA_BORBU RecName: Full=Spermidine/putrescine import ATP-bindin...    81   9e-18
MSBA_BURTA RecName: Full=Lipid A export ATP-binding/permease pro...    81   9e-18
MACB_PSYCK RecName: Full=Macrolide export ATP-binding/permease p...    81   9e-18
MACB_BRUME RecName: Full=Macrolide export ATP-binding/permease p...    81   9e-18
LOLD_ALCBS RecName: Full=Lipoprotein-releasing system ATP-bindin...    81   9e-18
LOLD2_PELLD RecName: Full=Lipoprotein-releasing system ATP-bindi...    81   9e-18
HMUV_YEREN RecName: Full=Hemin import ATP-binding protein hmuV; ...    81   9e-18
HLYB_ECOL6 RecName: Full=Alpha-hemolysin translocation ATP-bindi...    81   9e-18
HLYB3_ECOLX RecName: Full=Alpha-hemolysin translocation ATP-bind...    81   9e-18
FHUC_ECOLI RecName: Full=Iron(3+)-hydroxamate import ATP-binding...    81   9e-18
FBPC_PSEF5 RecName: Full=Fe(3+) ions import ATP-binding protein ...    81   9e-18
CBIO2_STAHJ RecName: Full=Cobalt import ATP-binding protein cbiO...    81   9e-18
BCEA_BACSU RecName: Full=Bacitracin export ATP-binding protein b...    81   9e-18
ABCA4_MOUSE RecName: Full=Retinal-specific ATP-binding cassette ...    81   9e-18
ZNUC_EHRCJ RecName: Full=Zinc import ATP-binding protein znuC;  ...    81   1e-17
YTLC_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    81   1e-17
YFIC_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    81   1e-17
Y415_SYNY3 RecName: Full=Uncharacterized ABC transporter ATP-bin...    81   1e-17
PSTB_RALEJ RecName: Full=Phosphate import ATP-binding protein ps...    81   1e-17
PSTB_NOVAD RecName: Full=Phosphate import ATP-binding protein ps...    81   1e-17
PSTB_HALWD RecName: Full=Phosphate import ATP-binding protein ps...    81   1e-17
PSTB2_HALSA RecName: Full=Phosphate import ATP-binding protein p...    81   1e-17
PSTB1_SYMTH RecName: Full=Phosphate import ATP-binding protein p...    81   1e-17
OPPF_LACLS RecName: Full=Oligopeptide transport ATP-binding prot...    81   1e-17
OPPF_LACLA RecName: Full=Oligopeptide transport ATP-binding prot...    81   1e-17
MSBA_RALSO RecName: Full=Lipid A export ATP-binding/permease pro...    81   1e-17
MODC_MYCTU RecName: Full=Molybdenum import ATP-binding protein m...    81   1e-17
MACB_CAMJR RecName: Full=Macrolide export ATP-binding/permease p...    81   1e-17
MACB_CAMJE RecName: Full=Macrolide export ATP-binding/permease p...    81   1e-17
HMUV_SILST RecName: Full=Hemin import ATP-binding protein hmuV; ...    81   1e-17
HMUV_METFK RecName: Full=Hemin import ATP-binding protein hmuV; ...    81   1e-17
CBIO1_STAAR RecName: Full=Cobalt import ATP-binding protein cbiO...    81   1e-17
ABCA4_HUMAN RecName: Full=Retinal-specific ATP-binding cassette ...    81   1e-17
ABCA2_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    81   1e-17
ZNUC_EHRCR RecName: Full=Zinc import ATP-binding protein znuC;  ...    80   1e-17
ZNUC_BUCBP RecName: Full=Zinc import ATP-binding protein znuC;  ...    80   1e-17
ZNUC_ALCBS RecName: Full=Zinc import ATP-binding protein znuC;  ...    80   1e-17
Y282_TREDE RecName: Full=Putative ABC transporter ATP-binding pr...    80   1e-17
Y1037_METMA RecName: Full=Putative ABC transporter ATP-binding p...    80   1e-17
UGPC_ERWCT RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    80   1e-17
THIQ_SHIFL RecName: Full=Thiamine import ATP-binding protein thi...    80   1e-17
THIQ_SALTI RecName: Full=Thiamine import ATP-binding protein thi...    80   1e-17
THIQ_ECOLI RecName: Full=Thiamine import ATP-binding protein thi...    80   1e-17
SSUB_ACIAD RecName: Full=Aliphatic sulfonates import ATP-binding...    80   1e-17
PSTB_MYXXD RecName: Full=Phosphate import ATP-binding protein ps...    80   1e-17
PSTB_METAC RecName: Full=Phosphate import ATP-binding protein ps...    80   1e-17
PSTB_EHRRW RecName: Full=Phosphate import ATP-binding protein ps...    80   1e-17
PSTB_EHRRG RecName: Full=Phosphate import ATP-binding protein ps...    80   1e-17
PSTB_CHLTE RecName: Full=Phosphate import ATP-binding protein ps...    80   1e-17
PSTB_BURS3 RecName: Full=Phosphate import ATP-binding protein ps...    80   1e-17
NIKE_SHIFL RecName: Full=Nickel import ATP-binding protein nikE;...    80   1e-17
NIKE_SHIF8 RecName: Full=Nickel import ATP-binding protein nikE;...    80   1e-17
MODC_SHESR RecName: Full=Molybdenum import ATP-binding protein m...    80   1e-17
MACB_HAHCH RecName: Full=Macrolide export ATP-binding/permease p...    80   1e-17
MACB_BORA1 RecName: Full=Macrolide export ATP-binding/permease p...    80   1e-17
LOLD_SODGM RecName: Full=Lipoprotein-releasing system ATP-bindin...    80   1e-17
LOLD_PSYA2 RecName: Full=Lipoprotein-releasing system ATP-bindin...    80   1e-17
LKTB_PASSP RecName: Full=Leukotoxin translocation ATP-binding pr...    80   1e-17
HRTA_STAHJ RecName: Full=Putative hemin import ATP-binding prote...    80   1e-17
HMUV_MESSB RecName: Full=Hemin import ATP-binding protein hmuV; ...    80   1e-17
CBIO2_STAS1 RecName: Full=Cobalt import ATP-binding protein cbiO...    80   1e-17
ABCG1_HUMAN RecName: Full=ATP-binding cassette sub-family G memb...    80   1e-17
ABCA5_DICDI RecName: Full=ABC transporter A family member 5;AltN...    80   1e-17
ZNUC_MAGSM RecName: Full=Zinc import ATP-binding protein znuC;  ...    80   2e-17
YHCG_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    80   2e-17
SSUB_PSEPU RecName: Full=Aliphatic sulfonates import ATP-binding...    80   2e-17
PSTB_THET2 RecName: Full=Phosphate import ATP-binding protein ps...    80   2e-17
PSTB_CHRVO RecName: Full=Phosphate import ATP-binding protein ps...    80   2e-17
PSTB2_SHEON RecName: Full=Phosphate import ATP-binding protein p...    80   2e-17
PSTB2_BACLD RecName: Full=Phosphate import ATP-binding protein p...    80   2e-17
PSTB1_VIBCH RecName: Full=Phosphate import ATP-binding protein p...    80   2e-17
PSTB1_LACJO RecName: Full=Phosphate import ATP-binding protein p...    80   2e-17
POTA_CHRVO RecName: Full=Spermidine/putrescine import ATP-bindin...    80   2e-17
PHNC_PSEST RecName: Full=Phosphonates import ATP-binding protein...    80   2e-17
OPPD_SALTY RecName: Full=Oligopeptide transport ATP-binding prot...    80   2e-17
NDVA_BARHE RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    80   2e-17
MSMK_STRMU RecName: Full=Multiple sugar-binding transport ATP-bi...    80   2e-17
MSBA_RALEJ RecName: Full=Lipid A export ATP-binding/permease pro...    80   2e-17
MODC_SHESM RecName: Full=Molybdenum import ATP-binding protein m...    80   2e-17
LOLD_LEGPL RecName: Full=Lipoprotein-releasing system ATP-bindin...    80   2e-17
LOLD_LEGPA RecName: Full=Lipoprotein-releasing system ATP-bindin...    80   2e-17
LOLD_COLP3 RecName: Full=Lipoprotein-releasing system ATP-bindin...    80   2e-17
LOLD1_CAUCR RecName: Full=Lipoprotein-releasing system ATP-bindi...    80   2e-17
LKTB_ACTAC RecName: Full=Leukotoxin translocation ATP-binding pr...    80   2e-17
DPPD_BACSU RecName: Full=Dipeptide transport ATP-binding protein...    80   2e-17
CBIO2_STRPM RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO2_STRPF RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO2_STRPD RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO2_STRPC RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO2_STRPB RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO2_LACC3 RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO1_STRPG RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO1_STRP8 RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO1_STRP6 RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO1_STRP3 RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO1_STRP1 RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
CBIO1_CLOAB RecName: Full=Cobalt import ATP-binding protein cbiO...    80   2e-17
ABCG1_MOUSE RecName: Full=ATP-binding cassette sub-family G memb...    80   2e-17
ABCA2_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    80   2e-17
ABCA1_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    80   2e-17
Y130_PYRAB RecName: Full=Putative ABC transporter ATP-binding pr...    80   3e-17
THIQ_ECO57 RecName: Full=Thiamine import ATP-binding protein thi...    80   3e-17
TAUB_PSEAB RecName: Full=Taurine import ATP-binding protein tauB...    80   3e-17
SSUB_GRABC RecName: Full=Aliphatic sulfonates import ATP-binding...    80   3e-17
PSTB_THET8 RecName: Full=Phosphate import ATP-binding protein ps...    80   3e-17
PSTB_RALSO RecName: Full=Phosphate import ATP-binding protein ps...    80   3e-17
PSTB_NITWN RecName: Full=Phosphate import ATP-binding protein ps...    80   3e-17
PSTB_IDILO RecName: Full=Phosphate import ATP-binding protein ps...    80   3e-17
MSBA_RALME RecName: Full=Lipid A export ATP-binding/permease pro...    80   3e-17
MODC_RHOCA RecName: Full=Molybdenum import ATP-binding protein m...    80   3e-17
LOLD_VIBF1 RecName: Full=Lipoprotein-releasing system ATP-bindin...    80   3e-17
LOLD_MAGSA RecName: Full=Lipoprotein-releasing system ATP-bindin...    80   3e-17
LCNC_LACLA RecName: Full=Lactococcin-A transport/processing ATP-...    80   3e-17
CCMA_ANAMM RecName: Full=Cytochrome c biogenesis ATP-binding exp...    80   3e-17
ABCA5_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    80   3e-17
ZNUC_THICR RecName: Full=Zinc import ATP-binding protein znuC;  ...    79   3e-17
YKNY_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    79   3e-17
UGPC_SALTY RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    79   3e-17
TAUB_PSE14 RecName: Full=Taurine import ATP-binding protein tauB...    79   3e-17
RTX1B_ACTPL RecName: Full=Toxin RTX-I translocation ATP-binding ...    79   3e-17
PSTB_PSEPF RecName: Full=Phosphate import ATP-binding protein ps...    79   3e-17
PSTB_METBF RecName: Full=Phosphate import ATP-binding protein ps...    79   3e-17
PSTB_CARHZ RecName: Full=Phosphate import ATP-binding protein ps...    79   3e-17
PSTB_BORA1 RecName: Full=Phosphate import ATP-binding protein ps...    79   3e-17
PSTB1_VIBVY RecName: Full=Phosphate import ATP-binding protein p...    79   3e-17
PSTB1_VIBVU RecName: Full=Phosphate import ATP-binding protein p...    79   3e-17
NDVA_NITHX RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    79   3e-17
MSBA_BURPS RecName: Full=Lipid A export ATP-binding/permease pro...    79   3e-17
MSBA_BURP1 RecName: Full=Lipid A export ATP-binding/permease pro...    79   3e-17
MSBA_BURMA RecName: Full=Lipid A export ATP-binding/permease pro...    79   3e-17
MODC_PSESM RecName: Full=Molybdenum import ATP-binding protein m...    79   3e-17
MACB2_AERHH RecName: Full=Macrolide export ATP-binding/permease ...    79   3e-17
LOLD_ALHEH RecName: Full=Lipoprotein-releasing system ATP-bindin...    79   3e-17
CBIO1_MYCMS RecName: Full=Cobalt import ATP-binding protein cbiO...    79   3e-17
CBIO1_LACJO RecName: Full=Cobalt import ATP-binding protein cbiO...    79   3e-17
ZNUC_RHIEC RecName: Full=Zinc import ATP-binding protein znuC;  ...    79   4e-17
UGPC_SALCH RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    79   4e-17
THIQ_SHIDS RecName: Full=Thiamine import ATP-binding protein thi...    79   4e-17
PSTB_SILPO RecName: Full=Phosphate import ATP-binding protein ps...    79   4e-17
PSTB_NITHX RecName: Full=Phosphate import ATP-binding protein ps...    79   4e-17
PSTB_MYCSS RecName: Full=Phosphate import ATP-binding protein ps...    79   4e-17
PSTB_METCA RecName: Full=Phosphate import ATP-binding protein ps...    79   4e-17
PSTB_BURXL RecName: Full=Phosphate import ATP-binding protein ps...    79   4e-17
PSTB1_LACAC RecName: Full=Phosphate import ATP-binding protein p...    79   4e-17
POTA_BORAP RecName: Full=Spermidine/putrescine import ATP-bindin...    79   4e-17
PHNC_BACHK RecName: Full=Phosphonates import ATP-binding protein...    79   4e-17
NDVA_BRAJA RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    79   4e-17
MODC_VIBCH RecName: Full=Molybdenum import ATP-binding protein m...    79   4e-17
MACB_CAMJJ RecName: Full=Macrolide export ATP-binding/permease p...    79   4e-17
LOLD_PHOLL RecName: Full=Lipoprotein-releasing system ATP-bindin...    79   4e-17
LOLD_MESSB RecName: Full=Lipoprotein-releasing system ATP-bindin...    79   4e-17
LOLD_BRAJA RecName: Full=Lipoprotein-releasing system ATP-bindin...    79   4e-17
LOLD_ANAMM RecName: Full=Lipoprotein-releasing system ATP-bindin...    79   4e-17
LOLD1_CHLTE RecName: Full=Lipoprotein-releasing system ATP-bindi...    79   4e-17
FBPC_NEIG1 RecName: Full=Fe(3+) ions import ATP-binding protein ...    79   4e-17
CYSA_THEEB RecName: Full=Sulfate/thiosulfate import ATP-binding ...    79   4e-17
CBIO_THEMA RecName: Full=Putative cobalt import ATP-binding prot...    79   4e-17
CBIO1_STAAB RecName: Full=Cobalt import ATP-binding protein cbiO...    79   4e-17
CBIO1_FUSNN RecName: Full=Cobalt import ATP-binding protein cbiO...    79   4e-17
ABCX_STRMU RecName: Full=Putative ABC transporter ATP-binding pr...    79   4e-17
ABCA5_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    79   4e-17
ZNUC_PSEF5 RecName: Full=Zinc import ATP-binding protein znuC;  ...    79   6e-17
ZNUC_ANAPZ RecName: Full=Zinc import ATP-binding protein znuC;  ...    79   6e-17
Y035_METJA RecName: Full=Uncharacterized ABC transporter ATP-bin...    79   6e-17
UGPC_SALPA RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    79   6e-17
THIQ_VIBCH RecName: Full=Thiamine import ATP-binding protein thi...    79   6e-17
THIQ_SALTY RecName: Full=Thiamine import ATP-binding protein thi...    79   6e-17
TAUB_RHIME RecName: Full=Taurine import ATP-binding protein tauB...    79   6e-17
PSTB_SULSO RecName: Full=Phosphate import ATP-binding protein ps...    79   6e-17
PSTB_RHOPA RecName: Full=Phosphate import ATP-binding protein ps...    79   6e-17
PSTB_PSEPU RecName: Full=Phosphate import ATP-binding protein ps...    79   6e-17
PSTB_PSEF5 RecName: Full=Phosphate import ATP-binding protein ps...    79   6e-17
PSTB_NITMU RecName: Full=Phosphate import ATP-binding protein ps...    79   6e-17
PSTB_MOOTA RecName: Full=Phosphate import ATP-binding protein ps...    79   6e-17
PSTB_HYPNA RecName: Full=Phosphate import ATP-binding protein ps...    79   6e-17
PSTB_AERPE RecName: Full=Phosphate import ATP-binding protein ps...    79   6e-17
PSTB5_ANAVT RecName: Full=Phosphate import ATP-binding protein p...    79   6e-17
PSTB2_ANASP RecName: Full=Phosphate import ATP-binding protein p...    79   6e-17
POTA_PSEF5 RecName: Full=Spermidine/putrescine import ATP-bindin...    79   6e-17
POTA_FRAAA RecName: Full=Spermidine/putrescine import ATP-bindin...    79   6e-17
MODC_HAEDU RecName: Full=Molybdenum import ATP-binding protein m...    79   6e-17
MDLB_ECOLI RecName: Full=Multidrug resistance-like ATP-binding p...    79   6e-17
MDLB_ECOL6 RecName: Full=Multidrug resistance-like ATP-binding p...    79   6e-17
MDLB_ECO57 RecName: Full=Multidrug resistance-like ATP-binding p...    79   6e-17
LOLD_ZYMMO RecName: Full=Lipoprotein-releasing system ATP-bindin...    79   6e-17
LOLD_HYPNA RecName: Full=Lipoprotein-releasing system ATP-bindin...    79   6e-17
ABCBA_HUMAN RecName: Full=ATP-binding cassette sub-family B memb...    79   6e-17
ABCA7_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    79   6e-17
Y753_CLOTE RecName: Full=Putative ABC transporter ATP-binding pr...    78   7e-17
Y1023_METJA RecName: Full=Uncharacterized ABC transporter ATP-bi...    78   7e-17
TROB_TREPA RecName: Full=Zinc transport system ATP-binding prote...    78   7e-17
PSTB_SALTY RecName: Full=Phosphate import ATP-binding protein ps...    78   7e-17
PSTB_SALTI RecName: Full=Phosphate import ATP-binding protein ps...    78   7e-17
PSTB_SALPA RecName: Full=Phosphate import ATP-binding protein ps...    78   7e-17
PSTB_MYCSM RecName: Full=Phosphate import ATP-binding protein ps...    78   7e-17
PSTB_MYCS2 RecName: Full=Phosphate import ATP-binding protein ps...    78   7e-17
PSTB3_SYNY3 RecName: Full=Phosphate import ATP-binding protein p...    78   7e-17
MSBA_FRATT RecName: Full=Lipid A export ATP-binding/permease pro...    78   7e-17
MSBA_FRAT1 RecName: Full=Lipid A export ATP-binding/permease pro...    78   7e-17
MSBA_BURXL RecName: Full=Lipid A export ATP-binding/permease pro...    78   7e-17
MODC_PSE14 RecName: Full=Molybdenum import ATP-binding protein m...    78   7e-17
METN_CHLFF RecName: Full=Methionine import ATP-binding protein m...    78   7e-17
METN_CHLAB RecName: Full=Methionine import ATP-binding protein m...    78   7e-17
METN1_ACIAD RecName: Full=Methionine import ATP-binding protein ...    78   7e-17
MACB_CAMFF RecName: Full=Macrolide export ATP-binding/permease p...    78   7e-17
LOLD_SHEFN RecName: Full=Lipoprotein-releasing system ATP-bindin...    78   7e-17
CBIO2_MYCH2 RecName: Full=Cobalt import ATP-binding protein cbiO...    78   7e-17
CBIO2_LEUMM RecName: Full=Cobalt import ATP-binding protein cbiO...    78   7e-17
CBIO1_MYCH7 RecName: Full=Cobalt import ATP-binding protein cbiO...    78   7e-17
CBIO1_LACAC RecName: Full=Cobalt import ATP-binding protein cbiO...    78   7e-17
CBIO1_CLOTE RecName: Full=Cobalt import ATP-binding protein cbiO...    78   7e-17
BTUD_VIBC3 RecName: Full=Vitamin B12 import ATP-binding protein ...    78   7e-17
ATM1_ASPOR RecName: Full=Iron-sulfur clusters transporter atm1, ...    78   7e-17
ABCA5_RAT RecName: Full=ATP-binding cassette sub-family A member 5;    78   7e-17
ABCA2_RAT RecName: Full=ATP-binding cassette sub-family A member...    78   7e-17
YLMA_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    78   1e-16
YBBA_SHIFL RecName: Full=Uncharacterized ABC transporter ATP-bin...    78   1e-16
YBBA_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    78   1e-16
YBBA_ECO57 RecName: Full=Uncharacterized ABC transporter ATP-bin...    78   1e-16
Y986_MYCTU RecName: Full=Uncharacterized ABC transporter ATP-bin...    78   1e-16
Y4FO_RHISN RecName: Full=Uncharacterized ABC transporter ATP-bin...    78   1e-16
WTPC_METJA RecName: Full=Molybdate/tungstate import ATP-binding ...    78   1e-16
SSUB_PSEPK RecName: Full=Aliphatic sulfonates import ATP-binding...    78   1e-16
SSUB1_AGRT5 RecName: Full=Aliphatic sulfonates import ATP-bindin...    78   1e-16
PSTB_SYNAS RecName: Full=Phosphate import ATP-binding protein ps...    78   1e-16
PSTB_SILST RecName: Full=Phosphate import ATP-binding protein ps...    78   1e-16
PSTB_SALRD RecName: Full=Phosphate import ATP-binding protein ps...    78   1e-16
PSTB_SALCH RecName: Full=Phosphate import ATP-binding protein ps...    78   1e-16
PSTB_EDWTA RecName: Full=Phosphate import ATP-binding protein ps...    78   1e-16
PSTB2_RHIL3 RecName: Full=Phosphate import ATP-binding protein p...    78   1e-16
PSTB2_PSEU2 RecName: Full=Phosphate import ATP-binding protein p...    78   1e-16
PSTB2_PSE14 RecName: Full=Phosphate import ATP-binding protein p...    78   1e-16
PSTB2_PHOPR RecName: Full=Phosphate import ATP-binding protein p...    78   1e-16
PHNC_MYCS2 RecName: Full=Phosphate-import ATP-binding protein ph...    78   1e-16
PHNC_FRASC RecName: Full=Phosphonates import ATP-binding protein...    78   1e-16
PHNC_BACCZ RecName: Full=Phosphonates import ATP-binding protein...    78   1e-16
MODC_RHORT RecName: Full=Molybdenum import ATP-binding protein m...    78   1e-16
METN_CHLCV RecName: Full=Methionine import ATP-binding protein m...    78   1e-16
MDL1_CANAL RecName: Full=ATP-dependent permease MDL1;                  78   1e-16
HMUV_ERWCT RecName: Full=Hemin import ATP-binding protein hmuV; ...    78   1e-16
HLYB_ECO57 RecName: Full=Alpha-hemolysin translocation ATP-bindi...    78   1e-16
ATM1_ASPFU RecName: Full=Iron-sulfur clusters transporter atm1, ...    78   1e-16
ABCGK_DICDI RecName: Full=ABC transporter G family member 20;Alt...    78   1e-16
ABCAB_DICDI RecName: Full=ABC transporter A family member 11;Alt...    78   1e-16
AB7A_ARATH RecName: Full=ABC transporter A family member 7;     ...    78   1e-16
AB12A_ARATH RecName: Full=ABC transporter A family member 12;   ...    78   1e-16
YVCR_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    77   1e-16
UGPC_SHISS RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    77   1e-16
UGPC_SHIBS RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    77   1e-16
UGPC_ECOLI RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    77   1e-16
UGPC_ECO57 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    77   1e-16
THIQ_MANSM RecName: Full=Thiamine import ATP-binding protein thi...    77   1e-16
SSUB2_PSEAE RecName: Full=Aliphatic sulfonates import ATP-bindin...    77   1e-16
SSUB1_PSEAB RecName: Full=Aliphatic sulfonates import ATP-bindin...    77   1e-16
PSTB_PROMA RecName: Full=Phosphate import ATP-binding protein ps...    77   1e-16
PSTB_POLSJ RecName: Full=Phosphate import ATP-binding protein ps...    77   1e-16
PSTB_NOCFA RecName: Full=Phosphate import ATP-binding protein ps...    77   1e-16
PSTB_AGRT5 RecName: Full=Phosphate import ATP-binding protein ps...    77   1e-16
PHNC_BACAN RecName: Full=Phosphonates import ATP-binding protein...    77   1e-16
PHNC1_RALME RecName: Full=Phosphonates import ATP-binding protei...    77   1e-16
MACB_NITWN RecName: Full=Macrolide export ATP-binding/permease p...    77   1e-16
LOLD_SHESM RecName: Full=Lipoprotein-releasing system ATP-bindin...    77   1e-16
LOLD_BLOPB RecName: Full=Lipoprotein-releasing system ATP-bindin...    77   1e-16
GSIA_ERWCT RecName: Full=Glutathione import ATP-binding protein ...    77   1e-16
CBIO2_STRTD RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO2_STRT2 RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO2_STRT1 RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO2_LACLS RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO2_GEOKA RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO1_STAAW RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO1_STAAS RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO1_STAAN RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO1_STAAM RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO1_STAAC RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO1_STAA8 RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO1_STAA3 RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
CBIO1_LACBA RecName: Full=Cobalt import ATP-binding protein cbiO...    77   1e-16
ABCAD_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    77   1e-16
AB26B_ARATH RecName: Full=ABC transporter B family member 26, ch...    77   1e-16
AB14B_ARATH RecName: Full=ABC transporter B family member 14;   ...    77   1e-16
YVRA_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    77   2e-16
SSUB_ERWCT RecName: Full=Aliphatic sulfonates import ATP-binding...    77   2e-16
SSUB2_BURS3 RecName: Full=Aliphatic sulfonates import ATP-bindin...    77   2e-16
SSUB2_BACSK RecName: Full=Aliphatic sulfonates import ATP-bindin...    77   2e-16
RTX3B_ACTPL RecName: Full=Toxin RTX-III translocation ATP-bindin...    77   2e-16
PSTB_MYCMO RecName: Full=Phosphate import ATP-binding protein ps...    77   2e-16
PSTB_METJA RecName: Full=Phosphate import ATP-binding protein ps...    77   2e-16
PSTB_BDEBA RecName: Full=Phosphate import ATP-binding protein ps...    77   2e-16
PSTB_ALCFA RecName: Full=Phosphate import ATP-binding protein ps...    77   2e-16
PSTB2_PSEPK RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
PSTB2_NITOC RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
PSTB1_RHIL3 RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
PSTB1_ERWCT RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
NDVA_BARQU RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    77   2e-16
MSBA_SYNAS RecName: Full=Lipid A export ATP-binding/permease pro...    77   2e-16
MSBA_FRANO RecName: Full=Lipid A export ATP-binding/permease pro...    77   2e-16
MODC_RHOPA RecName: Full=Molybdenum import ATP-binding protein m...    77   2e-16
MODC_PSEAE RecName: Full=Molybdenum import ATP-binding protein m...    77   2e-16
MKL_MYCTU RecName: Full=Probable ribonucleotide transport ATP-bi...    77   2e-16
MKL_MYCBO RecName: Full=Probable ribonucleotide transport ATP-bi...    77   2e-16
MACB_ECOLX RecName: Full=Macrolide export ATP-binding/permease p...    77   2e-16
MACB2_ECOK1 RecName: Full=Macrolide export ATP-binding/permease ...    77   2e-16
MACB1_PSEPF RecName: Full=Macrolide export ATP-binding/permease ...    77   2e-16
LOLD_XYLFT RecName: Full=Lipoprotein-releasing system ATP-bindin...    77   2e-16
LOLD_TREPA RecName: Full=Lipoprotein-releasing system ATP-bindin...    77   2e-16
HMUV_AGRT5 RecName: Full=Hemin import ATP-binding protein hmuV; ...    77   2e-16
CBIO2_MESFL RecName: Full=Cobalt import ATP-binding protein cbiO...    77   2e-16
CBIO2_LACAC RecName: Full=Cobalt import ATP-binding protein cbiO...    77   2e-16
CBIO2_CLOD6 RecName: Full=Cobalt import ATP-binding protein cbiO...    77   2e-16
CBIO1_MYCHJ RecName: Full=Cobalt import ATP-binding protein cbiO...    77   2e-16
AB8A_ARATH RecName: Full=ABC transporter A family member 8;     ...    77   2e-16
Y5847_STRAW RecName: Full=Putative ABC transporter ATP-binding p...    77   2e-16
UGPC_BURXL RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    77   2e-16
TAUB_PSEAE RecName: Full=Taurine import ATP-binding protein tauB...    77   2e-16
PSTB_ENTCL RecName: Full=Phosphate import ATP-binding protein ps...    77   2e-16
PSTB3_NATPD RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
PSTB2_YERPS RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
PSTB2_YERPN RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
PSTB2_YERPE RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
PSTB2_YERPA RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
PSTB2_PSESM RecName: Full=Phosphate import ATP-binding protein p...    77   2e-16
MODC_VIBPA RecName: Full=Molybdenum import ATP-binding protein m...    77   2e-16
MODC_METCA RecName: Full=Molybdenum import ATP-binding protein m...    77   2e-16
MODC1_AZOVI RecName: Full=Molybdenum import ATP-binding protein ...    77   2e-16
LOLD_SHESR RecName: Full=Lipoprotein-releasing system ATP-bindin...    77   2e-16
LOLD_PSEHT RecName: Full=Lipoprotein-releasing system ATP-bindin...    77   2e-16
LOLD_PSEAE RecName: Full=Lipoprotein-releasing system ATP-bindin...    77   2e-16
YJKB_BACSU RecName: Full=Putative ABC transporter ATP-binding pr...    76   3e-16
Y2766_STAAR RecName: Full=Putative ABC transporter ATP-binding p...    76   3e-16
PSTB_RHOFD RecName: Full=Phosphate import ATP-binding protein ps...    76   3e-16
PSTB_RALME RecName: Full=Phosphate import ATP-binding protein ps...    76   3e-16
PSTB_MARMM RecName: Full=Phosphate import ATP-binding protein ps...    76   3e-16
PSTB_LEIXX RecName: Full=Phosphate import ATP-binding protein ps...    76   3e-16
PSTB2_VIBPA RecName: Full=Phosphate import ATP-binding protein p...    76   3e-16
PSTB1_STRA5 RecName: Full=Phosphate import ATP-binding protein p...    76   3e-16
PSTB1_STRA3 RecName: Full=Phosphate import ATP-binding protein p...    76   3e-16
PSTB1_STRA1 RecName: Full=Phosphate import ATP-binding protein p...    76   3e-16
PSTB1_LACPL RecName: Full=Phosphate import ATP-binding protein p...    76   3e-16
LOLD_CHRVO RecName: Full=Lipoprotein-releasing system ATP-bindin...    76   3e-16
LOLD_BARHE RecName: Full=Lipoprotein-releasing system ATP-bindin...    76   3e-16
FBPC_NEIGO RecName: Full=Fe(3+) ions import ATP-binding protein ...    76   3e-16
CYSA_ANTFO RecName: Full=Probable sulfate/thiosulfate import ATP...    76   3e-16
CBIO2_LACSS RecName: Full=Cobalt import ATP-binding protein cbiO...    76   3e-16
CBIO1_MYCPU RecName: Full=Cobalt import ATP-binding protein cbiO...    76   3e-16
CBIO1_MYCCT RecName: Full=Cobalt import ATP-binding protein cbiO...    76   3e-16
ABCA6_DICDI RecName: Full=ABC transporter A family member 6;AltN...    76   3e-16
AB9A_ARATH RecName: Full=ABC transporter A family member 9;     ...    76   3e-16
ZNUC_VIBPA RecName: Full=Zinc import ATP-binding protein znuC;  ...    76   4e-16
YHIH_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    76   4e-16
Y2132_TREDE RecName: Full=Putative ABC transporter ATP-binding p...    76   4e-16
Y1841_ARCFU RecName: Full=Putative ABC transporter ATP-binding p...    76   4e-16
Y1589_THETN RecName: Full=Putative ABC transporter ATP-binding p...    76   4e-16
UGPC_ECOUT RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    76   4e-16
UGPC_ECOL6 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    76   4e-16
UGPC_ECOL5 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    76   4e-16
UGPC_ECOK1 RecName: Full=sn-glycerol-3-phosphate import ATP-bind...    76   4e-16
THIQ_SHISS RecName: Full=Thiamine import ATP-binding protein thi...    76   4e-16
TAUB_PSEF5 RecName: Full=Taurine import ATP-binding protein tauB...    76   4e-16
SSUB_DELAC RecName: Full=Aliphatic sulfonates import ATP-binding...    76   4e-16
PSTB2_STRT2 RecName: Full=Phosphate import ATP-binding protein p...    76   4e-16
PSTB2_STRT1 RecName: Full=Phosphate import ATP-binding protein p...    76   4e-16
PSTB2_LACSS RecName: Full=Phosphate import ATP-binding protein p...    76   4e-16
PSTB2_ANAVT RecName: Full=Phosphate import ATP-binding protein p...    76   4e-16
PHNC_BACC1 RecName: Full=Phosphonates import ATP-binding protein...    76   4e-16
NDVA_RHIEC RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    76   4e-16
NDVA_BARBK RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    76   4e-16
NDVA_BARBA RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    76   4e-16
MSBA_FRATO RecName: Full=Lipid A export ATP-binding/permease pro...    76   4e-16
MSBA_FRATH RecName: Full=Lipid A export ATP-binding/permease pro...    76   4e-16
MODC_PSEF5 RecName: Full=Molybdenum import ATP-binding protein m...    76   4e-16
MKL_MYCLE RecName: Full=Probable ribonucleotide transport ATP-bi...    76   4e-16
LOLD_XYLFA RecName: Full=Lipoprotein-releasing system ATP-bindin...    76   4e-16
LOLD_SHEDO RecName: Full=Lipoprotein-releasing system ATP-bindin...    76   4e-16
LOLD2_RHOBA RecName: Full=Lipoprotein-releasing system ATP-bindi...    76   4e-16
GSIA_SALPA RecName: Full=Glutathione import ATP-binding protein ...    76   4e-16
FBPC_NEIMB RecName: Full=Fe(3+) ions import ATP-binding protein ...    76   4e-16
FBPC_NEIMA RecName: Full=Fe(3+) ions import ATP-binding protein ...    76   4e-16
AB5A_ARATH RecName: Full=ABC transporter A family member 5;     ...    76   4e-16
AB10A_ARATH RecName: Full=ABC transporter A family member 10;   ...    76   4e-16
ZNUC_RHOS4 RecName: Full=Zinc import ATP-binding protein znuC;  ...    75   5e-16
Y3423_BRUAB RecName: Full=Putative ATP-binding protein BruAb2_11...    75   5e-16
Y2708_STAAC RecName: Full=Putative ABC transporter ATP-binding p...    75   5e-16
Y2684_STAAM RecName: Full=Putative ABC transporter ATP-binding p...    75   5e-16
Y2476_STAAN RecName: Full=Putative ABC transporter ATP-binding p...    75   5e-16
Y1038_METMA RecName: Full=Putative ABC transporter ATP-binding p...    75   5e-16
Y068_CHLTR RecName: Full=Probable metal transport system ATP-bin...    75   5e-16
TAUB_RHIEC RecName: Full=Taurine import ATP-binding protein tauB...    75   5e-16
SSUB2_PSEF5 RecName: Full=Aliphatic sulfonates import ATP-bindin...    75   5e-16
SSUB1_RHOSR RecName: Full=Aliphatic sulfonates import ATP-bindin...    75   5e-16
PSTB_THICR RecName: Full=Phosphate import ATP-binding protein ps...    75   5e-16
PSTB_MYCGE RecName: Full=Phosphate import ATP-binding protein ps...    75   5e-16
PSTB_MYCGA RecName: Full=Phosphate import ATP-binding protein ps...    75   5e-16
PSTB_DESVH RecName: Full=Phosphate import ATP-binding protein ps...    75   5e-16
PSTB1_VIBF1 RecName: Full=Phosphate import ATP-binding protein p...    75   5e-16
P29_MYCPN RecName: Full=Probable ABC transporter ATP-binding pro...    75   5e-16
NODI_AZOC5 RecName: Full=Nod factor export ATP-binding protein I...    75   5e-16
MACB2_PSEF5 RecName: Full=Macrolide export ATP-binding/permease ...    75   5e-16
LOLD_VIBVY RecName: Full=Lipoprotein-releasing system ATP-bindin...    75   5e-16
LOLD_VIBVU RecName: Full=Lipoprotein-releasing system ATP-bindin...    75   5e-16
LOLD_PHOPR RecName: Full=Lipoprotein-releasing system ATP-bindin...    75   5e-16
LOLD1_RHOPA RecName: Full=Lipoprotein-releasing system ATP-bindi...    75   5e-16
HMUV_YERPS RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   5e-16
HMUV_YERPN RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   5e-16
HMUV_YERPE RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   5e-16
HMUV_YERPA RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   5e-16
GSIA_SHIDS RecName: Full=Glutathione import ATP-binding protein ...    75   5e-16
FHUC_BACSU RecName: Full=Iron(3+)-hydroxamate import ATP-binding...    75   5e-16
ATM1_EMENI RecName: Full=Iron-sulfur clusters transporter atm1, ...    75   5e-16
ABCA7_DICDI RecName: Full=ABC transporter A family member 7;AltN...    75   5e-16
AB3A_ARATH RecName: Full=ABC transporter A family member 3;     ...    75   5e-16
ZNUC_PSEPF RecName: Full=Zinc import ATP-binding protein znuC;  ...    75   6e-16
Y3001_GEOSL RecName: Full=Putative ABC transporter ATP-binding p...    75   6e-16
Y1383_MYCBO RecName: Full=Uncharacterized ABC transporter ATP-bi...    75   6e-16
Y1348_MYCTU RecName: Full=Uncharacterized ABC transporter ATP-bi...    75   6e-16
PSTB_SHISS RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_SHIFL RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_SHIDS RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_SHIBS RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_PSEA6 RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_PROMT RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_METHJ RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_ECOUT RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_ECOLI RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_ECOL6 RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_ECOL5 RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_ECO57 RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB_DESPS RecName: Full=Phosphate import ATP-binding protein ps...    75   6e-16
PSTB2_SYNY3 RecName: Full=Phosphate import ATP-binding protein p...    75   6e-16
PSTB2_LACAC RecName: Full=Phosphate import ATP-binding protein p...    75   6e-16
POTA_STAHJ RecName: Full=Spermidine/putrescine import ATP-bindin...    75   6e-16
PAXB_PASAE RecName: Full=Exotoxin translocation ATP-binding prot...    75   6e-16
NDVA_RHIME RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    75   6e-16
MODC_DECAR RecName: Full=Molybdenum import ATP-binding protein m...    75   6e-16
MACB_MARAV RecName: Full=Macrolide export ATP-binding/permease p...    75   6e-16
LOLD_RHOFD RecName: Full=Lipoprotein-releasing system ATP-bindin...    75   6e-16
LOLD_RHIL3 RecName: Full=Lipoprotein-releasing system ATP-bindin...    75   6e-16
LOLD_POLSJ RecName: Full=Lipoprotein-releasing system ATP-bindin...    75   6e-16
LCNCL_LACLA RecName: Full=Lactococcin transport/processing ATP-b...    75   6e-16
HMUV_BORAV RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   6e-16
HMUV_BORA1 RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   6e-16
GSIA_SALTY RecName: Full=Glutathione import ATP-binding protein ...    75   6e-16
GSIA_SALTI RecName: Full=Glutathione import ATP-binding protein ...    75   6e-16
GSIA_SALCH RecName: Full=Glutathione import ATP-binding protein ...    75   6e-16
CBIO2_MYCHJ RecName: Full=Cobalt import ATP-binding protein cbiO...    75   6e-16
CBIO1_MYCH2 RecName: Full=Cobalt import ATP-binding protein cbiO...    75   6e-16
CBIO1_LACGA RecName: Full=Cobalt import ATP-binding protein cbiO...    75   6e-16
ABCG4_HUMAN RecName: Full=ATP-binding cassette sub-family G memb...    75   6e-16
AB6A_ARATH RecName: Full=ABC transporter A family member 6;     ...    75   6e-16
AB11A_ARATH RecName: Full=ABC transporter A family member 11;   ...    75   6e-16
YCJV_ECOL6 RecName: Full=Uncharacterized ABC transporter ATP-bin...    75   8e-16
YCJV_ECOL5 RecName: Full=Uncharacterized ABC transporter ATP-bin...    75   8e-16
THIQ_SILST RecName: Full=Thiamine import ATP-binding protein thi...    75   8e-16
TAUB_RHISN RecName: Full=Taurine import ATP-binding protein tauB...    75   8e-16
TAGD_DICDI RecName: Full=Serine protease/ABC transporter tagD;  ...    75   8e-16
PSTB_SYNSC RecName: Full=Phosphate import ATP-binding protein ps...    75   8e-16
PSTB_SYNPX RecName: Full=Phosphate import ATP-binding protein ps...    75   8e-16
PSTB_SPIKU RecName: Full=Phosphate import ATP-binding protein ps...    75   8e-16
PSTB_ROSDO RecName: Full=Phosphate import ATP-binding protein ps...    75   8e-16
PSTB_MYCIT RecName: Full=Phosphate import ATP-binding protein ps...    75   8e-16
POTA_DESHY RecName: Full=Spermidine/putrescine import ATP-bindin...    75   8e-16
PHNC2_ROSDO RecName: Full=Phosphonates import ATP-binding protei...    75   8e-16
MODC_BORPE RecName: Full=Molybdenum import ATP-binding protein m...    75   8e-16
MODC_BORPA RecName: Full=Molybdenum import ATP-binding protein m...    75   8e-16
MODC_BORBR RecName: Full=Molybdenum import ATP-binding protein m...    75   8e-16
HMUV_PSEPF RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   8e-16
HMUV_PHOLL RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   8e-16
HMUV_NITWN RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   8e-16
HMUV_DEIRA RecName: Full=Hemin import ATP-binding protein hmuV; ...    75   8e-16
CBIO2_MYCH7 RecName: Full=Cobalt import ATP-binding protein cbiO...    75   8e-16
CBIO1_MYCMO RecName: Full=Cobalt import ATP-binding protein cbiO...    75   8e-16
AB4A_ARATH RecName: Full=ABC transporter A family member 4;     ...    75   8e-16
ZNUC_PSYCK RecName: Full=Zinc import ATP-binding protein znuC;  ...    74   1e-15
YCJV_ECOUT RecName: Full=Uncharacterized ABC transporter ATP-bin...    74   1e-15
YCJV_ECO57 RecName: Full=Uncharacterized ABC transporter ATP-bin...    74   1e-15
Y906_TREDE RecName: Full=Putative ABC transporter ATP-binding pr...    74   1e-15
Y719_METJA RecName: Full=Uncharacterized ABC transporter ATP-bin...    74   1e-15
Y3161_STRCO RecName: Full=Putative ABC transporter ATP-binding p...    74   1e-15
Y2603_STAAW RecName: Full=Putative ABC transporter ATP-binding p...    74   1e-15
Y2569_STAAS RecName: Full=Putative ABC transporter ATP-binding p...    74   1e-15
Y1996_METMA RecName: Full=Putative ABC transporter ATP-binding p...    74   1e-15
SSUB3_BURXL RecName: Full=Aliphatic sulfonates import ATP-bindin...    74   1e-15
SSUB1_PSESM RecName: Full=Aliphatic sulfonates import ATP-bindin...    74   1e-15
PSTB_SYNS3 RecName: Full=Phosphate import ATP-binding protein ps...    74   1e-15
PSTB3_MAGSA RecName: Full=Phosphate import ATP-binding protein p...    74   1e-15
LOLD_THICR RecName: Full=Lipoprotein-releasing system ATP-bindin...    74   1e-15
LOLD1_RHOBA RecName: Full=Lipoprotein-releasing system ATP-bindi...    74   1e-15
HMUV_VIBF1 RecName: Full=Hemin import ATP-binding protein hmuV; ...    74   1e-15
HMUV_ROSDO RecName: Full=Hemin import ATP-binding protein hmuV; ...    74   1e-15
GSIA_SHIBS RecName: Full=Glutathione import ATP-binding protein ...    74   1e-15
CBIO1_CLOD6 RecName: Full=Cobalt import ATP-binding protein cbiO...    74   1e-15
ZNUC_MAGSA RecName: Full=Zinc import ATP-binding protein znuC;  ...    74   1e-15
Y804_OCEIH RecName: Full=Putative ABC transporter ATP-binding pr...    74   1e-15
Y4187_BRUSU RecName: Full=Putative ATP-binding protein BRA1187; ...    74   1e-15
Y3647_BRUA2 RecName: Full=Putative ATP-binding protein BAB2_1147...    74   1e-15
Y206_BRUME RecName: Full=Putative peptide import ATP-binding pro...    74   1e-15
TAUB2_BURXL RecName: Full=Taurine import ATP-binding protein tau...    74   1e-15
SSUB_MYCPA RecName: Full=Aliphatic sulfonates import ATP-binding...    74   1e-15
SSUB_MYCA1 RecName: Full=Aliphatic sulfonates import ATP-binding...    74   1e-15
PSTB_ZYMMO RecName: Full=Phosphate import ATP-binding protein ps...    74   1e-15
PSTB_RHOS4 RecName: Full=Phosphate import ATP-binding protein ps...    74   1e-15
PSTB_PROMP RecName: Full=Phosphate import ATP-binding protein ps...    74   1e-15
PSTB_NITEU RecName: Full=Phosphate import ATP-binding protein ps...    74   1e-15
PSTB_MESSB RecName: Full=Phosphate import ATP-binding protein ps...    74   1e-15
PSTB_GEOKA RecName: Full=Phosphate import ATP-binding protein ps...    74   1e-15
PSTB_BURCA RecName: Full=Phosphate import ATP-binding protein ps...    74   1e-15
PSTB_ACIBL RecName: Full=Phosphate import ATP-binding protein ps...    74   1e-15
PSTB1_STRMU RecName: Full=Phosphate import ATP-binding protein p...    74   1e-15
PSTB1_MYCBO RecName: Full=Phosphate import ATP-binding protein p...    74   1e-15
MSBA_PSEPF RecName: Full=Lipid A export ATP-binding/permease pro...    74   1e-15
MACB_RHOPB RecName: Full=Macrolide export ATP-binding/permease p...    74   1e-15
MACB_MANSM RecName: Full=Macrolide export ATP-binding/permease p...    74   1e-15
LOLD_PSEA6 RecName: Full=Lipoprotein-releasing system ATP-bindin...    74   1e-15
LOLD_COXBU RecName: Full=Lipoprotein-releasing system ATP-bindin...    74   1e-15
LOLD_AGRT5 RecName: Full=Lipoprotein-releasing system ATP-bindin...    74   1e-15
GSIA_SHISS RecName: Full=Glutathione import ATP-binding protein ...    74   1e-15
GSIA_ECOLI RecName: Full=Glutathione import ATP-binding protein ...    74   1e-15
GSIA_ECO57 RecName: Full=Glutathione import ATP-binding protein ...    74   1e-15
CBIO_METAC RecName: Full=Cobalt import ATP-binding protein cbiO;...    74   1e-15
CBIO2_UREPA RecName: Full=Cobalt import ATP-binding protein cbiO...    74   1e-15
CBIO2_LACDB RecName: Full=Cobalt import ATP-binding protein cbiO...    74   1e-15
CBIO2_LACDA RecName: Full=Cobalt import ATP-binding protein cbiO...    74   1e-15
CBIO1_STAS1 RecName: Full=Cobalt import ATP-binding protein cbiO...    74   1e-15
AB13B_ARATH RecName: Full=ABC transporter B family member 13;   ...    74   1e-15
ZNUC_PSYA2 RecName: Full=Zinc import ATP-binding protein znuC;  ...    74   2e-15
YHEI_BACSU RecName: Full=Probable multidrug resistance ABC trans...    74   2e-15
Y081_MYCPN RecName: Full=Putative ABC transporter ATP-binding pr...    74   2e-15
TAP2_MOUSE RecName: Full=Antigen peptide transporter 2;         ...    74   2e-15
TAGB_DICDI RecName: Full=Prestalk-specific protein tagB;        ...    74   2e-15
SSUB_BACLD RecName: Full=Aliphatic sulfonates import ATP-binding...    74   2e-15
PSTB_THIDA RecName: Full=Phosphate import ATP-binding protein ps...    74   2e-15
PSTB_SYNE7 RecName: Full=Phosphate import ATP-binding protein ps...    74   2e-15
PSTB_BORBU RecName: Full=Phosphate import ATP-binding protein ps...    74   2e-15
PSTB_BORAP RecName: Full=Phosphate import ATP-binding protein ps...    74   2e-15
PSTB_AZOSE RecName: Full=Phosphate import ATP-binding protein ps...    74   2e-15
PSTB2_VIBCH RecName: Full=Phosphate import ATP-binding protein p...    74   2e-15
POTA_MYCGE RecName: Full=Spermidine/putrescine import ATP-bindin...    74   2e-15
PMD1_SCHPO RecName: Full=Leptomycin B resistance protein pmd1;         74   2e-15
NDVA_BRUAB RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    74   2e-15
NDVA_BRUA2 RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    74   2e-15
NATA_BACSU RecName: Full=ATP-binding transport protein natA;AltN...    74   2e-15
MSBA_DECAR RecName: Full=Lipid A export ATP-binding/permease pro...    74   2e-15
MODC_RHOP2 RecName: Full=Molybdenum import ATP-binding protein m...    74   2e-15
MODC_HAHCH RecName: Full=Molybdenum import ATP-binding protein m...    74   2e-15
MDR1_CAEEL RecName: Full=Multidrug resistance protein 1;        ...    74   2e-15
MACB_SHESW RecName: Full=Macrolide export ATP-binding/permease p...    74   2e-15
LPTB_PSEPU RecName: Full=Lipopolysaccharide export system ATP-bi...    74   2e-15
LOLD_RHIEC RecName: Full=Lipoprotein-releasing system ATP-bindin...    74   2e-15
CBIO2_LACLM RecName: Full=Cobalt import ATP-binding protein cbiO...    74   2e-15
CBIO1_LACC3 RecName: Full=Cobalt import ATP-binding protein cbiO...    74   2e-15
ATM1_ASHGO RecName: Full=Iron-sulfur clusters transporter ATM1, ...    74   2e-15
AB22B_ARATH RecName: Full=ABC transporter B family member 22;   ...    74   2e-15
ZNUC_ACIAD RecName: Full=Zinc import ATP-binding protein znuC;  ...    73   2e-15
YCJV_ECOLI RecName: Full=Putative uncharacterized ABC transporte...    73   2e-15
Y1094_BRUSU RecName: Full=Putative peptide import ATP-binding pr...    73   2e-15
Y1052_BRUA2 RecName: Full=Putative peptide import ATP-binding pr...    73   2e-15
Y1033_BRUAB RecName: Full=Putative peptide import ATP-binding pr...    73   2e-15
WTPC_ARCFU RecName: Full=Molybdate/tungstate import ATP-binding ...    73   2e-15
THIQ_VIBPA RecName: Full=Thiamine import ATP-binding protein thi...    73   2e-15
THIQ_ECOUT RecName: Full=Thiamine import ATP-binding protein thi...    73   2e-15
THIQ_ECOL6 RecName: Full=Thiamine import ATP-binding protein thi...    73   2e-15
THIQ_ECOL5 RecName: Full=Thiamine import ATP-binding protein thi...    73   2e-15
TAUB_PSEPF RecName: Full=Taurine import ATP-binding protein tauB...    73   2e-15
PSTB_RHIEC RecName: Full=Phosphate import ATP-binding protein ps...    73   2e-15
PSTB1_MYCTU RecName: Full=Phosphate import ATP-binding protein p...    73   2e-15
PSTB1_LACLA RecName: Full=Phosphate import ATP-binding protein p...    73   2e-15
PHNT_SALTI RecName: Full=Putative 2-aminoethylphosphonate import...    73   2e-15
PHNT_SALPA RecName: Full=Putative 2-aminoethylphosphonate import...    73   2e-15
NDVA_BRUSU RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    73   2e-15
NDVA_BRUME RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    73   2e-15
MACB_PSEAE RecName: Full=Macrolide export ATP-binding/permease p...    73   2e-15
MACB_PSEAB RecName: Full=Macrolide export ATP-binding/permease p...    73   2e-15
MACB1_AERHH RecName: Full=Macrolide export ATP-binding/permease ...    73   2e-15
BTUD_VIBSL RecName: Full=Vitamin B12 import ATP-binding protein ...    73   2e-15
ABCA1_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    73   2e-15
AB21B_ARATH RecName: Full=ABC transporter B family member 21;   ...    73   2e-15
ZNUC_MESSB RecName: Full=Zinc import ATP-binding protein znuC;  ...    73   3e-15
SSUB1_BURS3 RecName: Full=Aliphatic sulfonates import ATP-bindin...    73   3e-15
PSTB_DECAR RecName: Full=Phosphate import ATP-binding protein ps...    73   3e-15
PSTB_CLOD6 RecName: Full=Phosphate import ATP-binding protein ps...    73   3e-15
PSTB2_VIBVY RecName: Full=Phosphate import ATP-binding protein p...    73   3e-15
PSTB2_VIBVU RecName: Full=Phosphate import ATP-binding protein p...    73   3e-15
PSTB2_GLOVI RecName: Full=Phosphate import ATP-binding protein p...    73   3e-15
PSTB2_ENTFA RecName: Full=Phosphate import ATP-binding protein p...    73   3e-15
PSTB1_CHRSD RecName: Full=Phosphate import ATP-binding protein p...    73   3e-15
PHNT_SALTY RecName: Full=Putative 2-aminoethylphosphonate import...    73   3e-15
MSBA_SACD2 RecName: Full=Lipid A export ATP-binding/permease pro...    73   3e-15
MSBA_BORA1 RecName: Full=Lipid A export ATP-binding/permease pro...    73   3e-15
MODC_VIBVY RecName: Full=Molybdenum import ATP-binding protein m...    73   3e-15
MODC_VIBVU RecName: Full=Molybdenum import ATP-binding protein m...    73   3e-15
MACB_WOLSU RecName: Full=Macrolide export ATP-binding/permease p...    73   3e-15
MACB_PSEPK RecName: Full=Macrolide export ATP-binding/permease p...    73   3e-15
MACB1_PSEU2 RecName: Full=Macrolide export ATP-binding/permease ...    73   3e-15
MACB1_PSESM RecName: Full=Macrolide export ATP-binding/permease ...    73   3e-15
LOLD_BURPS RecName: Full=Lipoprotein-releasing system ATP-bindin...    73   3e-15
LOLD_BURMA RecName: Full=Lipoprotein-releasing system ATP-bindin...    73   3e-15
GSIA_SHIFL RecName: Full=Glutathione import ATP-binding protein ...    73   3e-15
GSIA_SHIF8 RecName: Full=Glutathione import ATP-binding protein ...    73   3e-15
CYSA_CHLVU RecName: Full=Probable sulfate/thiosulfate import ATP...    73   3e-15
CBIO_MYCPE RecName: Full=Cobalt import ATP-binding protein cbiO;...    73   3e-15
CBIO2_MYCGE RecName: Full=Cobalt import ATP-binding protein cbiO...    73   3e-15
CBIO2_LACLA RecName: Full=Cobalt import ATP-binding protein cbiO...    73   3e-15
BTUD_VIBCM RecName: Full=Vitamin B12 import ATP-binding protein ...    73   3e-15
BTUD_VIBCH RecName: Full=Vitamin B12 import ATP-binding protein ...    73   3e-15
ABCA2_DICDI RecName: Full=ABC transporter A family member 2;AltN...    73   3e-15
Y100_LACPL RecName: Full=Putative ABC transporter ATP-binding pr...    72   4e-15
SSUB2_AGRT5 RecName: Full=Aliphatic sulfonates import ATP-bindin...    72   4e-15
SSUB1_BURCH RecName: Full=Aliphatic sulfonates import ATP-bindin...    72   4e-15
SSUB1_BURCA RecName: Full=Aliphatic sulfonates import ATP-bindin...    72   4e-15
PSTB_SYNS9 RecName: Full=Phosphate import ATP-binding protein ps...    72   4e-15
PSTB_SYNP6 RecName: Full=Phosphate import ATP-binding protein ps...    72   4e-15
PSTB_SULDN RecName: Full=Phosphate import ATP-binding protein ps...    72   4e-15
PSTB2_ERWCT RecName: Full=Phosphate import ATP-binding protein p...    72   4e-15
PHNK_ECOLI RecName: Full=Phosphonates transport ATP-binding prot...    72   4e-15
MSBA_PSEF5 RecName: Full=Lipid A export ATP-binding/permease pro...    72   4e-15
MSBA_IDILO RecName: Full=Lipid A export ATP-binding/permease pro...    72   4e-15
MSBA_HAHCH RecName: Full=Lipid A export ATP-binding/permease pro...    72   4e-15
MODC_PHOPR RecName: Full=Molybdenum import ATP-binding protein m...    72   4e-15
LOLD_RALSO RecName: Full=Lipoprotein-releasing system ATP-bindin...    72   4e-15
LOLD_BARQU RecName: Full=Lipoprotein-releasing system ATP-bindin...    72   4e-15
HMUV_PSEPK RecName: Full=Hemin import ATP-binding protein hmuV; ...    72   4e-15
HMUV_BURS3 RecName: Full=Hemin import ATP-binding protein hmuV; ...    72   4e-15
GSIA_ECOUT RecName: Full=Glutathione import ATP-binding protein ...    72   4e-15
GSIA_ECOL5 RecName: Full=Glutathione import ATP-binding protein ...    72   4e-15
CBIO2_STAES RecName: Full=Cobalt import ATP-binding protein cbiO...    72   4e-15
CBIO2_STAEQ RecName: Full=Cobalt import ATP-binding protein cbiO...    72   4e-15
CBIO1_SPIKU RecName: Full=Cobalt import ATP-binding protein cbiO...    72   4e-15
ABCBA_MOUSE RecName: Full=ATP-binding cassette sub-family B memb...    72   4e-15
ZNUC_WOLPM RecName: Full=Zinc import ATP-binding protein znuC;  ...    72   5e-15
ZNUC1_HAHCH RecName: Full=Zinc import ATP-binding protein znuC 1...    72   5e-15
Y270_BARQU RecName: Full=Putative ABC transporter ATP-binding pr...    72   5e-15
SSUB2_PSEU2 RecName: Full=Aliphatic sulfonates import ATP-bindin...    72   5e-15
SSUB2_BURXL RecName: Full=Aliphatic sulfonates import ATP-bindin...    72   5e-15
PSTB_OCEIH RecName: Full=Phosphate import ATP-binding protein ps...    72   5e-15
PSTB_GEOSL RecName: Full=Phosphate import ATP-binding protein ps...    72   5e-15
PSTB1_SYNJA RecName: Full=Phosphate import ATP-binding protein p...    72   5e-15
PSTB1_STRP6 RecName: Full=Phosphate import ATP-binding protein p...    72   5e-15
PSTB1_ENTFA RecName: Full=Phosphate import ATP-binding protein p...    72   5e-15
MSBA_VIBCH RecName: Full=Lipid A export ATP-binding/permease pro...    72   5e-15
MODC_RHOPS RecName: Full=Molybdenum import ATP-binding protein m...    72   5e-15
MACB1_PSEE4 RecName: Full=Macrolide export ATP-binding/permease ...    72   5e-15
LOLD_BRUSU RecName: Full=Lipoprotein-releasing system ATP-bindin...    72   5e-15
LOLD_BRUME RecName: Full=Lipoprotein-releasing system ATP-bindin...    72   5e-15
LOLD_BRUAB RecName: Full=Lipoprotein-releasing system ATP-bindin...    72   5e-15
LOLD_BRUA2 RecName: Full=Lipoprotein-releasing system ATP-bindin...    72   5e-15
GSIA_ECOL6 RecName: Full=Glutathione import ATP-binding protein ...    72   5e-15
FEPC_ECOLI RecName: Full=Ferric enterobactin transport ATP-bindi...    72   5e-15
ABCAD_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    72   5e-15
AB31G_ARATH RecName: Full=ABC transporter G family member 31;   ...    72   5e-15
AB1A_ARATH RecName: Full=ABC transporter A family member 1;     ...    72   5e-15
ZNUC_VIBCH RecName: Full=Zinc import ATP-binding protein znuC;  ...    72   7e-15
ZNUC1_VIBF1 RecName: Full=Zinc import ATP-binding protein znuC 1...    72   7e-15
Y696_RICPR RecName: Full=Putative export ATP-binding/permease pr...    72   7e-15
Y065_MYCGE RecName: Full=Putative ABC transporter ATP-binding pr...    72   7e-15
TAGH_LISIN RecName: Full=Teichoic acids export ATP-binding prote...    72   7e-15
RFBB2_KLEPN RecName: Full=O-antigen export system ATP-binding pr...    72   7e-15
PSTB2_LACLA RecName: Full=Phosphate import ATP-binding protein p...    72   7e-15
POTA_MYCPN RecName: Full=Spermidine/putrescine import ATP-bindin...    72   7e-15
NDVA_RHIRD RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    72   7e-15
NDVA_AGRT5 RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    72   7e-15
MODC_RHOPB RecName: Full=Molybdenum import ATP-binding protein m...    72   7e-15
LOLD_BORPE RecName: Full=Lipoprotein-releasing system ATP-bindin...    72   7e-15
LOLD_BORPA RecName: Full=Lipoprotein-releasing system ATP-bindin...    72   7e-15
LOLD_BORBR RecName: Full=Lipoprotein-releasing system ATP-bindin...    72   7e-15
FBPC_STRAW RecName: Full=Fe(3+) ions import ATP-binding protein ...    72   7e-15
ABCA8_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    72   7e-15
ABCA6_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    72   7e-15
ZURA_LISIN RecName: Full=Zinc uptake system ATP-binding protein ...    71   9e-15
ZNUC_WOLTR RecName: Full=Zinc import ATP-binding protein znuC;  ...    71   9e-15
ZNUC_PSEE4 RecName: Full=Zinc import ATP-binding protein znuC;  ...    71   9e-15
YFMF_BACSU RecName: Full=Fe(3+)-citrate import ATP-binding prote...    71   9e-15
Y4TR_RHISN RecName: Full=Probable peptide ABC transporter ATP-bi...    71   9e-15
UUP1_HAEIN RecName: Full=ABC transporter ATP-binding protein uup-1;    71   9e-15
TAGH_LACLA RecName: Full=Teichoic acids export ATP-binding prote...    71   9e-15
SSUB3_PSESM RecName: Full=Aliphatic sulfonates import ATP-bindin...    71   9e-15
RFBB1_KLEPN RecName: Full=O-antigen export system ATP-binding pr...    71   9e-15
PSTB_SACD2 RecName: Full=Phosphate import ATP-binding protein ps...    71   9e-15
PSTB_RHIME RecName: Full=Phosphate import ATP-binding protein ps...    71   9e-15
PSTB_HELMO RecName: Full=Phosphate import ATP-binding protein ps...    71   9e-15
PSTB_DESDG RecName: Full=Phosphate import ATP-binding protein ps...    71   9e-15
PSTB_BURTA RecName: Full=Phosphate import ATP-binding protein ps...    71   9e-15
PSTB_BURPS RecName: Full=Phosphate import ATP-binding protein ps...    71   9e-15
PSTB_BURP1 RecName: Full=Phosphate import ATP-binding protein ps...    71   9e-15
PSTB_BURMA RecName: Full=Phosphate import ATP-binding protein ps...    71   9e-15
PSTB2_BACSU RecName: Full=Phosphate import ATP-binding protein p...    71   9e-15
NDVA_RHOP5 RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    71   9e-15
MODC_YERPS RecName: Full=Molybdenum import ATP-binding protein m...    71   9e-15
MODC_YERPN RecName: Full=Molybdenum import ATP-binding protein m...    71   9e-15
MODC_YERPE RecName: Full=Molybdenum import ATP-binding protein m...    71   9e-15
MODC_YERPA RecName: Full=Molybdenum import ATP-binding protein m...    71   9e-15
MACB2_PSEE4 RecName: Full=Macrolide export ATP-binding/permease ...    71   9e-15
LOLD_EHRRW RecName: Full=Lipoprotein-releasing system ATP-bindin...    71   9e-15
LOLD_EHRRG RecName: Full=Lipoprotein-releasing system ATP-bindin...    71   9e-15
HMUV_VIBCH RecName: Full=Hemin import ATP-binding protein hmuV; ...    71   9e-15
HMUV_BURCM RecName: Full=Hemin import ATP-binding protein hmuV; ...    71   9e-15
AB10B_ARATH RecName: Full=ABC transporter B family member 10;   ...    71   9e-15
ZURA_LISMO RecName: Full=Zinc uptake system ATP-binding protein ...    71   1e-14
Y1631_HALSA RecName: Full=Putative ABC transporter ATP-binding p...    71   1e-14
RFBB_MYXXA RecName: Full=O-antigen export system ATP-binding pro...    71   1e-14
PSTB_XANCP RecName: Full=Phosphate import ATP-binding protein ps...    71   1e-14
PSTB_XANC8 RecName: Full=Phosphate import ATP-binding protein ps...    71   1e-14
PSTB_METTH RecName: Full=Phosphate import ATP-binding protein ps...    71   1e-14
POTA1_PSEAE RecName: Full=Spermidine/putrescine import ATP-bindi...    71   1e-14
PHNT_SALCH RecName: Full=Putative 2-aminoethylphosphonate import...    71   1e-14
OPPD_LACLS RecName: Full=Oligopeptide transport ATP-binding prot...    71   1e-14
MSBA_BURCA RecName: Full=Lipid A export ATP-binding/permease pro...    71   1e-14
MACB_PSE14 RecName: Full=Macrolide export ATP-binding/permease p...    71   1e-14
LOLD_RHILO RecName: Full=Lipoprotein-releasing system ATP-bindin...    71   1e-14
HMUV_PSEE4 RecName: Full=Hemin import ATP-binding protein hmuV; ...    71   1e-14
HMUV_PLESH RecName: Full=Hemin import ATP-binding protein hmuV; ...    71   1e-14
GSIA_ECOK1 RecName: Full=Glutathione import ATP-binding protein ...    71   1e-14
DDPD_ECOLI RecName: Full=Probable D,D-dipeptide transport ATP-bi...    71   1e-14
BTUD_VIBVY RecName: Full=Vitamin B12 import ATP-binding protein ...    71   1e-14
BTUD_VIBVU RecName: Full=Vitamin B12 import ATP-binding protein ...    71   1e-14
AB2A_ARATH RecName: Full=ABC transporter A family member 2;     ...    71   1e-14
ZNUC_HAEDU RecName: Full=Zinc import ATP-binding protein znuC;  ...    70   2e-14
Y691_RICTY RecName: Full=Putative export ATP-binding/permease pr...    70   2e-14
TAP2_RAT RecName: Full=Antigen peptide transporter 2;         Sh...    70   2e-14
SSUB3_PSEU2 RecName: Full=Aliphatic sulfonates import ATP-bindin...    70   2e-14
SSUB3_PSE14 RecName: Full=Aliphatic sulfonates import ATP-bindin...    70   2e-14
SSUB2_BURCH RecName: Full=Aliphatic sulfonates import ATP-bindin...    70   2e-14
SSUB2_BURCA RecName: Full=Aliphatic sulfonates import ATP-bindin...    70   2e-14
PSTB_TRIEI RecName: Full=Phosphate import ATP-binding protein ps...    70   2e-14
PSTB_BORGA RecName: Full=Phosphate import ATP-binding protein ps...    70   2e-14
PSTB_ACIAD RecName: Full=Phosphate import ATP-binding protein ps...    70   2e-14
PSTB1_SYNY3 RecName: Full=Phosphate import ATP-binding protein p...    70   2e-14
PSTB1_STRPC RecName: Full=Phosphate import ATP-binding protein p...    70   2e-14
PSTB1_STRPB RecName: Full=Phosphate import ATP-binding protein p...    70   2e-14
PHNC1_RHOFD RecName: Full=Phosphonates import ATP-binding protei...    70   2e-14
NDVA_RHOPB RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    70   2e-14
NDVA_RHIL3 RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    70   2e-14
MSBA_VIBVY RecName: Full=Lipid A export ATP-binding/permease pro...    70   2e-14
MSBA_VIBVU RecName: Full=Lipid A export ATP-binding/permease pro...    70   2e-14
MSBA_ALHEH RecName: Full=Lipid A export ATP-binding/permease pro...    70   2e-14
MODC_RHILO RecName: Full=Molybdenum import ATP-binding protein m...    70   2e-14
MACB_SODGM RecName: Full=Macrolide export ATP-binding/permease p...    70   2e-14
FBPC_STRCO RecName: Full=Fe(3+) ions import ATP-binding protein ...    70   2e-14
CBIO2_THETN RecName: Full=Cobalt import ATP-binding protein cbiO...    70   2e-14
BTUD_VIBPA RecName: Full=Vitamin B12 import ATP-binding protein ...    70   2e-14
BTUD_VIBHB RecName: Full=Vitamin B12 import ATP-binding protein ...    70   2e-14
ATM1_KLULA RecName: Full=Iron-sulfur clusters transporter ATM1, ...    70   2e-14
THIQ_PHOLL RecName: Full=Thiamine import ATP-binding protein thi...    70   2e-14
SSUB2_PSE14 RecName: Full=Aliphatic sulfonates import ATP-bindin...    70   2e-14
PSTB_WOLSU RecName: Full=Phosphate import ATP-binding protein ps...    70   2e-14
PSTB_JANSC RecName: Full=Phosphate import ATP-binding protein ps...    70   2e-14
PSTB_CHLCH RecName: Full=Phosphate import ATP-binding protein ps...    70   2e-14
PSTB1_STRPM RecName: Full=Phosphate import ATP-binding protein p...    70   2e-14
PSTB1_STRPF RecName: Full=Phosphate import ATP-binding protein p...    70   2e-14
PSTB1_STRPD RecName: Full=Phosphate import ATP-binding protein p...    70   2e-14
PSTB1_STRP8 RecName: Full=Phosphate import ATP-binding protein p...    70   2e-14
PSTB1_STRP3 RecName: Full=Phosphate import ATP-binding protein p...    70   2e-14
PSTB1_STRP1 RecName: Full=Phosphate import ATP-binding protein p...    70   2e-14
MACB_SHEON RecName: Full=Macrolide export ATP-binding/permease p...    70   2e-14
MACB2_PSESM RecName: Full=Macrolide export ATP-binding/permease ...    70   2e-14
CDR4_CANAL RecName: Full=ABC transporter CDR4;                         70   2e-14
CBIO_ONYPE RecName: Full=Putative cobalt import ATP-binding prot...    70   2e-14
ABCB8_XENTR RecName: Full=ATP-binding cassette sub-family B memb...    70   2e-14
ABCAA_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    70   2e-14
ZNUC_HAEI8 RecName: Full=Zinc import ATP-binding protein znuC;  ...    70   3e-14
YHEH_BACSU RecName: Full=Probable multidrug resistance ABC trans...    70   3e-14
Y348_CHLPN RecName: Full=Probable metal transport system ATP-bin...    70   3e-14
TAGH_LISMF RecName: Full=Teichoic acids export ATP-binding prote...    70   3e-14
SSUB_BACSU RecName: Full=Aliphatic sulfonates import ATP-binding...    70   3e-14
PSTB_CAUCR RecName: Full=Phosphate import ATP-binding protein ps...    70   3e-14
PSTB_CAUCN RecName: Full=Phosphate import ATP-binding protein ps...    70   3e-14
PSTB1_NITOC RecName: Full=Phosphate import ATP-binding protein p...    70   3e-14
PSTB1_NATPD RecName: Full=Phosphate import ATP-binding protein p...    70   3e-14
POTA_UREPA RecName: Full=Spermidine/putrescine import ATP-bindin...    70   3e-14
MSBA_BURS3 RecName: Full=Lipid A export ATP-binding/permease pro...    70   3e-14
LOLD_RALME RecName: Full=Lipoprotein-releasing system ATP-bindin...    70   3e-14
LOLD_GLUOX RecName: Full=Lipoprotein-releasing system ATP-bindin...    70   3e-14
HMUV_BARQU RecName: Full=Hemin import ATP-binding protein hmuV; ...    70   3e-14
CYDC_HAEIN RecName: Full=ATP-binding/permease protein cydC;            70   3e-14
Y4342_METAC RecName: Full=Putative ABC transporter ATP-binding p...    69   3e-14
THIQ_MESSB RecName: Full=Thiamine import ATP-binding protein thi...    69   3e-14
SSUB_RALEH RecName: Full=Aliphatic sulfonates import ATP-binding...    69   3e-14
PSTB_XANC5 RecName: Full=Phosphate import ATP-binding protein ps...    69   3e-14
PSTB_XANAC RecName: Full=Phosphate import ATP-binding protein ps...    69   3e-14
PSTB_PROM9 RecName: Full=Phosphate import ATP-binding protein ps...    69   3e-14
PSTB_MYCPN RecName: Full=Phosphate import ATP-binding protein ps...    69   3e-14
PSTB_METST RecName: Full=Phosphate import ATP-binding protein ps...    69   3e-14
OPPD_LACLA RecName: Full=Oligopeptide transport ATP-binding prot...    69   3e-14
MSBA_VIBF1 RecName: Full=Lipid A export ATP-binding/permease pro...    69   3e-14
MSBA_COXBU RecName: Full=Lipid A export ATP-binding/permease pro...    69   3e-14
MSBA_CHRVO RecName: Full=Lipid A export ATP-binding/permease pro...    69   3e-14
MACB_CHRVO RecName: Full=Macrolide export ATP-binding/permease p...    69   3e-14
LOLD_HAHCH RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   3e-14
LOLD_BORA1 RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   3e-14
LMRA_LACLM RecName: Full=Multidrug resistance ABC transporter AT...    69   3e-14
ABCB8_PONAB RecName: Full=ATP-binding cassette sub-family B memb...    69   3e-14
YCLH_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    69   4e-14
TAGH_BACCZ RecName: Full=Teichoic acids export ATP-binding prote...    69   4e-14
SSUB_YERPN RecName: Full=Aliphatic sulfonates import ATP-binding...    69   4e-14
SSUB_YERPE RecName: Full=Aliphatic sulfonates import ATP-binding...    69   4e-14
SSUB_YERPA RecName: Full=Aliphatic sulfonates import ATP-binding...    69   4e-14
SSUB_CORGL RecName: Full=Aliphatic sulfonates import ATP-binding...    69   4e-14
SSUB_ANAVT RecName: Full=Aliphatic sulfonates import ATP-binding...    69   4e-14
PSTB_XANOR RecName: Full=Phosphate import ATP-binding protein ps...    69   4e-14
PSTB_XANOM RecName: Full=Phosphate import ATP-binding protein ps...    69   4e-14
PSTB1_SYNJB RecName: Full=Phosphate import ATP-binding protein p...    69   4e-14
PSTB1_ANASP RecName: Full=Phosphate import ATP-binding protein p...    69   4e-14
MDR3_HUMAN RecName: Full=Multidrug resistance protein 3;        ...    69   4e-14
MACB2_PSEPF RecName: Full=Macrolide export ATP-binding/permease ...    69   4e-14
LOLD_SACD2 RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   4e-14
LOLD_DESDG RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   4e-14
COMA_STRR6 RecName: Full=Transport/processing ATP-binding protei...    69   4e-14
CBIO1_MYCS5 RecName: Full=Cobalt import ATP-binding protein cbiO...    69   4e-14
ADCC_STRR6 RecName: Full=Zinc transport system ATP-binding prote...    69   4e-14
ADCC_STRPN RecName: Full=Zinc transport system ATP-binding prote...    69   4e-14
ABCB8_RAT RecName: Full=ATP-binding cassette sub-family B member...    69   4e-14
ABCB6_RAT RecName: Full=ATP-binding cassette sub-family B member...    69   4e-14
ABCAA_DICDI RecName: Full=ABC transporter A family member 10;Alt...    69   4e-14
ABC8A_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    69   4e-14
TAUB_BURP1 RecName: Full=Taurine import ATP-binding protein tauB...    69   6e-14
TAUB_BURMA RecName: Full=Taurine import ATP-binding protein tauB...    69   6e-14
TAGH_LISMO RecName: Full=Teichoic acids export ATP-binding prote...    69   6e-14
SSUB_YERPS RecName: Full=Aliphatic sulfonates import ATP-binding...    69   6e-14
PSTB_PHOLL RecName: Full=Phosphate import ATP-binding protein ps...    69   6e-14
PSTB_BARHE RecName: Full=Phosphate import ATP-binding protein ps...    69   6e-14
PSTB2_LACPL RecName: Full=Phosphate import ATP-binding protein p...    69   6e-14
PSTB1_ANAVT RecName: Full=Phosphate import ATP-binding protein p...    69   6e-14
PHNC_PSEE4 RecName: Full=Phosphonates import ATP-binding protein...    69   6e-14
MSBA_METFK RecName: Full=Lipid A export ATP-binding/permease pro...    69   6e-14
MODC_PSEPF RecName: Full=Molybdenum import ATP-binding protein m...    69   6e-14
LOLD_VIBPA RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   6e-14
LOLD_ROSDO RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   6e-14
LOLD_RHOS4 RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   6e-14
LOLD_RHIME RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   6e-14
LOLD_EHRCR RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   6e-14
LOLD_ACIBL RecName: Full=Lipoprotein-releasing system ATP-bindin...    69   6e-14
HST6_CANAL RecName: Full=Alpha-factor-transporting ATPase;      ...    69   6e-14
HMUV_BURCH RecName: Full=Hemin import ATP-binding protein hmuV; ...    69   6e-14
HMUV_BURCA RecName: Full=Hemin import ATP-binding protein hmuV; ...    69   6e-14
ABCB6_MOUSE RecName: Full=ATP-binding cassette sub-family B memb...    69   6e-14
ABCA_AERSA RecName: Full=ABC transporter protein abcA;                 69   6e-14
AB15B_ARATH RecName: Full=ABC transporter B family member 15;   ...    69   6e-14
Y276_BARHE RecName: Full=Putative ABC transporter ATP-binding pr...    68   8e-14
Y015_MYCGE RecName: Full=Putative ABC transporter ATP-binding pr...    68   8e-14
TAUB_BURPS RecName: Full=Taurine import ATP-binding protein tauB...    68   8e-14
PSTB4_ANAVT RecName: Full=Phosphate import ATP-binding protein p...    68   8e-14
PHNC_NOCFA RecName: Full=Phosphonates import ATP-binding protein...    68   8e-14
NIKE_BRUSU RecName: Full=Nickel import ATP-binding protein nikE;...    68   8e-14
NIKE_BRUME RecName: Full=Nickel import ATP-binding protein nikE;...    68   8e-14
NIKE_BRUAB RecName: Full=Nickel import ATP-binding protein nikE;...    68   8e-14
NIKE_BRUA2 RecName: Full=Nickel import ATP-binding protein nikE;...    68   8e-14
MSBA_XANOR RecName: Full=Lipid A export ATP-binding/permease pro...    68   8e-14
MSBA_XANOM RecName: Full=Lipid A export ATP-binding/permease pro...    68   8e-14
MSBA_POLSJ RecName: Full=Lipid A export ATP-binding/permease pro...    68   8e-14
MODC_HAEI8 RecName: Full=Molybdenum import ATP-binding protein m...    68   8e-14
MDR3_CAEEL RecName: Full=Multidrug resistance protein 3;        ...    68   8e-14
MACB_BURTA RecName: Full=Macrolide export ATP-binding/permease p...    68   8e-14
LOLD_DECAR RecName: Full=Lipoprotein-releasing system ATP-bindin...    68   8e-14
ATM1_CANGA RecName: Full=Iron-sulfur clusters transporter ATM1, ...    68   8e-14
APPD_BACSU RecName: Full=Oligopeptide transport ATP-binding prot...    68   8e-14
ABCA9_DICDI RecName: Full=ABC transporter A family member 9;AltN...    68   8e-14
YWJA_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    68   1e-13
Y3608_STRAW RecName: Full=Putative ABC transporter ATP-binding p...    68   1e-13
Y1272_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bi...    68   1e-13
THIQ_RHOS4 RecName: Full=Thiamine import ATP-binding protein thi...    68   1e-13
PSTB_GEOMG RecName: Full=Phosphate import ATP-binding protein ps...    68   1e-13
PSTB_DEHE1 RecName: Full=Phosphate import ATP-binding protein ps...    68   1e-13
OPPD_HAEIN RecName: Full=Oligopeptide transport ATP-binding prot...    68   1e-13
MSBA_LEGPH RecName: Full=Lipid A export ATP-binding/permease pro...    68   1e-13
MODC_THIDA RecName: Full=Molybdenum import ATP-binding protein m...    68   1e-13
MDR3_CRIGR RecName: Full=Multidrug resistance protein 3;        ...    68   1e-13
HMUV_HAHCH RecName: Full=Hemin import ATP-binding protein hmuV; ...    68   1e-13
FBPC2_ERWCT RecName: Full=Fe(3+) ions import ATP-binding protein...    68   1e-13
ABCA4_DICDI RecName: Full=ABC transporter A family member 4;AltN...    68   1e-13
ZNUC_HAES1 RecName: Full=Zinc import ATP-binding protein znuC;  ...    67   1e-13
Y2003_STAA8 RecName: Full=Putative multidrug export ATP-binding/...    67   1e-13
Y1956_STAAR RecName: Full=Putative multidrug export ATP-binding/...    67   1e-13
Y1924_STAAC RecName: Full=Putative multidrug export ATP-binding/...    67   1e-13
Y1866_STAAM RecName: Full=Putative multidrug export ATP-binding/...    67   1e-13
Y1847_STAA3 RecName: Full=Putative multidrug export ATP-binding/...    67   1e-13
Y1806_STAAW RecName: Full=Putative multidrug export ATP-binding/...    67   1e-13
Y1788_STAAS RecName: Full=Putative multidrug export ATP-binding/...    67   1e-13
Y1683_STAAN RecName: Full=Putative multidrug export ATP-binding/...    67   1e-13
Y1053_BRUA2 RecName: Full=Putative peptide import ATP-binding pr...    67   1e-13
Y1034_BRUAB RecName: Full=Putative peptide import ATP-binding pr...    67   1e-13
POTA_MYCGA RecName: Full=Spermidine/putrescine import ATP-bindin...    67   1e-13
PHNC_PSEPK RecName: Full=Phosphonates import ATP-binding protein...    67   1e-13
OPPF2_STAAW RecName: Full=Putative oligopeptide transport ATP-bi...    67   1e-13
OPPF2_STAAS RecName: Full=Putative oligopeptide transport ATP-bi...    67   1e-13
NDVA_RHOPS RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    67   1e-13
MSBA_LEGPL RecName: Full=Lipid A export ATP-binding/permease pro...    67   1e-13
MODC_RHIME RecName: Full=Molybdenum import ATP-binding protein m...    67   1e-13
MODC_ERWCT RecName: Full=Molybdenum import ATP-binding protein m...    67   1e-13
LOLD_SPHAL RecName: Full=Lipoprotein-releasing system ATP-bindin...    67   1e-13
LOLD_RICTY RecName: Full=Lipoprotein-releasing system ATP-bindin...    67   1e-13
LOLD_LEPIN RecName: Full=Lipoprotein-releasing system ATP-bindin...    67   1e-13
LOLD_LEPIC RecName: Full=Lipoprotein-releasing system ATP-bindin...    67   1e-13
CCMA_SHEFN RecName: Full=Cytochrome c biogenesis ATP-binding exp...    67   1e-13
ATM1_USTMA RecName: Full=Iron-sulfur clusters transporter ATM1, ...    67   1e-13
ABCX_PORPU RecName: Full=Probable ATP-dependent transporter ycf16;     67   1e-13
ABCG8_HUMAN RecName: Full=ATP-binding cassette sub-family G memb...    67   1e-13
AB7B_ARATH RecName: Full=ABC transporter B family member 7;     ...    67   1e-13
AB27B_ARATH RecName: Full=ABC transporter B family member 27;   ...    67   1e-13
ZNUC_BUCAI RecName: Full=Zinc import ATP-binding protein znuC;  ...    67   2e-13
ZNUC2_HAHCH RecName: Full=Zinc import ATP-binding protein znuC 2...    67   2e-13
Y4021_METAC RecName: Full=Putative ABC transporter ATP-binding p...    67   2e-13
Y339_CHLMU RecName: Full=Probable metal transport system ATP-bin...    67   2e-13
Y1303_MYCBO RecName: Full=Uncharacterized ABC transporter ATP-bi...    67   2e-13
Y1272_MYCTU RecName: Full=Uncharacterized ABC transporter ATP-bi...    67   2e-13
TAP1_RAT RecName: Full=Antigen peptide transporter 1;         Sh...    67   2e-13
SSUB_BURPS RecName: Full=Aliphatic sulfonates import ATP-binding...    67   2e-13
SSUB_BURP1 RecName: Full=Aliphatic sulfonates import ATP-binding...    67   2e-13
SSUB_BURMA RecName: Full=Aliphatic sulfonates import ATP-binding...    67   2e-13
SSUB2_RHIL3 RecName: Full=Aliphatic sulfonates import ATP-bindin...    67   2e-13
PSTB_STAAW RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_STAAS RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_STAAN RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_STAAM RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_STAAC RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_STAA8 RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_STAA3 RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_BARQU RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB2_LACJO RecName: Full=Phosphate import ATP-binding protein p...    67   2e-13
PSTB1_STRT2 RecName: Full=Phosphate import ATP-binding protein p...    67   2e-13
PSTB1_STRT1 RecName: Full=Phosphate import ATP-binding protein p...    67   2e-13
PSTB1_MAGSA RecName: Full=Phosphate import ATP-binding protein p...    67   2e-13
OPPF2_STAAN RecName: Full=Putative oligopeptide transport ATP-bi...    67   2e-13
OPPF2_STAAM RecName: Full=Putative oligopeptide transport ATP-bi...    67   2e-13
OPPF2_STAAC RecName: Full=Putative oligopeptide transport ATP-bi...    67   2e-13
OPPF2_STAA8 RecName: Full=Putative oligopeptide transport ATP-bi...    67   2e-13
OPPF2_STAA3 RecName: Full=Putative oligopeptide transport ATP-bi...    67   2e-13
NIST_LACLA RecName: Full=Nisin transport ATP-binding protein nisT;     67   2e-13
HMUV_BARHE RecName: Full=Hemin import ATP-binding protein hmuV; ...    67   2e-13
CYSA_MARPO RecName: Full=Probable sulfate/thiosulfate import ATP...    67   2e-13
COMA_STRPN RecName: Full=Transport/processing ATP-binding protei...    67   2e-13
CBIO_AYWBP RecName: Full=Cobalt import ATP-binding protein cbiO;...    67   2e-13
CBIO2_MYCPU RecName: Full=Cobalt import ATP-binding protein cbiO...    67   2e-13
AB2B_ARATH RecName: Full=ABC transporter B family member 2;     ...    67   2e-13
YSC1_STRGN RecName: Full=Uncharacterized ABC transporter ATP-bin...    67   2e-13
YKNU_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    67   2e-13
Y205_BRUME RecName: Full=Putative peptide import ATP-binding pro...    67   2e-13
TAP1_HUMAN RecName: Full=Antigen peptide transporter 1;         ...    67   2e-13
SSUB3_RHOSR RecName: Full=Aliphatic sulfonates import ATP-bindin...    67   2e-13
SAPD_SALTY RecName: Full=Peptide transport system ATP-binding pr...    67   2e-13
PSTB_STAAR RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_STAAB RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_CYTH3 RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_BRUSU RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_BRUME RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_BRUAB RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PSTB_BRUA2 RecName: Full=Phosphate import ATP-binding protein ps...    67   2e-13
PHNC_MYCMS RecName: Full=Phosphonates import ATP-binding protein...    67   2e-13
OPPF2_STAAR RecName: Full=Putative oligopeptide transport ATP-bi...    67   2e-13
OPPF2_STAAB RecName: Full=Putative oligopeptide transport ATP-bi...    67   2e-13
MSBA_XANC5 RecName: Full=Lipid A export ATP-binding/permease pro...    67   2e-13
MSBA_XANAC RecName: Full=Lipid A export ATP-binding/permease pro...    67   2e-13
MODC_VIBF1 RecName: Full=Molybdenum import ATP-binding protein m...    67   2e-13
MDR2_RAT RecName: Full=Multidrug resistance protein 2;         E...    67   2e-13
MAM1_SCHPO RecName: Full=Mating factor M secretion protein mam1;...    67   2e-13
MACB1_PSEF5 RecName: Full=Macrolide export ATP-binding/permease ...    67   2e-13
LMRA_LACLA RecName: Full=Multidrug resistance ABC transporter AT...    67   2e-13
FBPC_YERPS RecName: Full=Fe(3+) ions import ATP-binding protein ...    67   2e-13
FBPC_YERPN RecName: Full=Fe(3+) ions import ATP-binding protein ...    67   2e-13
FBPC_YERPE RecName: Full=Fe(3+) ions import ATP-binding protein ...    67   2e-13
FBPC_YERPA RecName: Full=Fe(3+) ions import ATP-binding protein ...    67   2e-13
CCMA_IDILO RecName: Full=Cytochrome c biogenesis ATP-binding exp...    67   2e-13
BTUD_PHOLL RecName: Full=Vitamin B12 import ATP-binding protein ...    67   2e-13
ABCBB_MOUSE RecName: Full=Bile salt export pump;AltName: Full=AT...    67   2e-13
ABCB5_HUMAN RecName: Full=ATP-binding cassette sub-family B memb...    67   2e-13
AB29G_ARATH RecName: Full=ABC transporter G family member 29;   ...    67   2e-13
ZNUC_SODGM RecName: Full=Zinc import ATP-binding protein znuC;  ...    66   3e-13
YBT1_YEAST RecName: Full=ATP-dependent bile acid permease;             66   3e-13
Y683_MYCPN RecName: Full=Putative ABC transporter ATP-binding pr...    66   3e-13
SSUB_ECOLI RecName: Full=Aliphatic sulfonates import ATP-binding...    66   3e-13
SSUB_ECO57 RecName: Full=Aliphatic sulfonates import ATP-binding...    66   3e-13
SSUB_BURTA RecName: Full=Aliphatic sulfonates import ATP-binding...    66   3e-13
PSTB2_LACS1 RecName: Full=Phosphate import ATP-binding protein p...    66   3e-13
PSTB1_LACSS RecName: Full=Phosphate import ATP-binding protein p...    66   3e-13
NDVA_RHILO RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    66   3e-13
MSBA_THICR RecName: Full=Lipid A export ATP-binding/permease pro...    66   3e-13
MSBA_LEGPA RecName: Full=Lipid A export ATP-binding/permease pro...    66   3e-13
MDR1_HUMAN RecName: Full=Multidrug resistance protein 1;        ...    66   3e-13
MACB_SHISS RecName: Full=Macrolide export ATP-binding/permease p...    66   3e-13
MACB_HYPNA RecName: Full=Macrolide export ATP-binding/permease p...    66   3e-13
MACB_ECOUT RecName: Full=Macrolide export ATP-binding/permease p...    66   3e-13
MACB_ECOLI RecName: Full=Macrolide export ATP-binding/permease p...    66   3e-13
MACB_ECOL5 RecName: Full=Macrolide export ATP-binding/permease p...    66   3e-13
MACB1_ECOK1 RecName: Full=Macrolide export ATP-binding/permease ...    66   3e-13
LOLD_SALRD RecName: Full=Lipoprotein-releasing system ATP-bindin...    66   3e-13
HMUV_BORBR RecName: Full=Hemin import ATP-binding protein hmuV; ...    66   3e-13
FBPC2_HAEIN RecName: Full=Fe(3+) ions import ATP-binding protein...    66   3e-13
ABCB8_HUMAN RecName: Full=ATP-binding cassette sub-family B memb...    66   3e-13
Y467_MYCGE RecName: Full=Putative ABC transporter ATP-binding pr...    66   4e-13
Y019_MYCPN RecName: Full=Putative ABC transporter ATP-binding pr...    66   4e-13
TAUB_BURTA RecName: Full=Taurine import ATP-binding protein tauB...    66   4e-13
TAP1_GORGO RecName: Full=Antigen peptide transporter 1;         ...    66   4e-13
PSTB_MYCPE RecName: Full=Phosphate import ATP-binding protein ps...    66   4e-13
PDR3_TOBAC RecName: Full=Pleiotropic drug resistance protein 3;A...    66   4e-13
NDVA_NITWN RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    66   4e-13
MDR2_MOUSE RecName: Full=Multidrug resistance protein 2;        ...    66   4e-13
MACB_SHESA RecName: Full=Macrolide export ATP-binding/permease p...    66   4e-13
LOLD_RALEJ RecName: Full=Lipoprotein-releasing system ATP-bindin...    66   4e-13
LOLD_NITEU RecName: Full=Lipoprotein-releasing system ATP-bindin...    66   4e-13
ABCB7_HUMAN RecName: Full=ATP-binding cassette sub-family B memb...    66   4e-13
ABCA9_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    66   4e-13
YJJK_SHIFL RecName: Full=Uncharacterized ABC transporter ATP-bin...    65   5e-13
YJJK_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    65   5e-13
YJJK_ECO57 RecName: Full=Uncharacterized ABC transporter ATP-bin...    65   5e-13
Y1051_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bi...    65   5e-13
SSUB_SHISS RecName: Full=Aliphatic sulfonates import ATP-binding...    65   5e-13
PSTB_PROMM RecName: Full=Phosphate import ATP-binding protein ps...    65   5e-13
PSTB_MYCCT RecName: Full=Phosphate import ATP-binding protein ps...    65   5e-13
PSTB_METFK RecName: Full=Phosphate import ATP-binding protein ps...    65   5e-13
PSTB_DESHY RecName: Full=Phosphate import ATP-binding protein ps...    65   5e-13
PSTB_BACCR RecName: Full=Phosphate import ATP-binding protein ps...    65   5e-13
PHNC_MYCCT RecName: Full=Phosphonates import ATP-binding protein...    65   5e-13
OCCP_RHIRD RecName: Full=Octopine permease ATP-binding protein P;      65   5e-13
OCCP_AGRT4 RecName: Full=Octopine permease ATP-binding protein P;      65   5e-13
MSBA_XANCP RecName: Full=Lipid A export ATP-binding/permease pro...    65   5e-13
MSBA_XANC8 RecName: Full=Lipid A export ATP-binding/permease pro...    65   5e-13
MSBA_VIBPA RecName: Full=Lipid A export ATP-binding/permease pro...    65   5e-13
LOLD_RICBR RecName: Full=Lipoprotein-releasing system ATP-bindin...    65   5e-13
LOLD_JANSC RecName: Full=Lipoprotein-releasing system ATP-bindin...    65   5e-13
HMUV_VIBAN RecName: Full=Hemin import ATP-binding protein hmuV; ...    65   5e-13
CBRD_DICD3 RecName: Full=Achromobactin transport ATP-binding pro...    65   5e-13
CBIO1_STRA5 RecName: Full=Cobalt import ATP-binding protein cbiO...    65   5e-13
CBIO1_STRA3 RecName: Full=Cobalt import ATP-binding protein cbiO...    65   5e-13
CBIO1_STRA1 RecName: Full=Cobalt import ATP-binding protein cbiO...    65   5e-13
ATM1_YEAST RecName: Full=Iron-sulfur clusters transporter ATM1, ...    65   5e-13
ABCX_PORYE RecName: Full=Probable ATP-dependent transporter ycf16;     65   5e-13
YNT9_SCHPO RecName: Full=Uncharacterized ABC transporter ATP-bin...    65   6e-13
SSUB_SHIF8 RecName: Full=Aliphatic sulfonates import ATP-binding...    65   6e-13
SSUB_ECOUT RecName: Full=Aliphatic sulfonates import ATP-binding...    65   6e-13
SSUB_ECOK1 RecName: Full=Aliphatic sulfonates import ATP-binding...    65   6e-13
SAPD_SHIFL RecName: Full=Peptide transport system ATP-binding pr...    65   6e-13
SAPD_ECOLI RecName: Full=Peptide transport system ATP-binding pr...    65   6e-13
SAPD_ECOL6 RecName: Full=Peptide transport system ATP-binding pr...    65   6e-13
SAPD_ECO57 RecName: Full=Peptide transport system ATP-binding pr...    65   6e-13
PSTB_DEHSC RecName: Full=Phosphate import ATP-binding protein ps...    65   6e-13
PSTB2_THETN RecName: Full=Phosphate import ATP-binding protein p...    65   6e-13
NDVA_RHOP2 RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    65   6e-13
MDL2_YEAST RecName: Full=ATP-dependent permease MDL2, mitochondr...    65   6e-13
MACB_SHIDS RecName: Full=Macrolide export ATP-binding/permease p...    65   6e-13
MACB_RHOP2 RecName: Full=Macrolide export ATP-binding/permease p...    65   6e-13
LOLD_FRATO RecName: Full=Lipoprotein-releasing system ATP-bindin...    65   6e-13
LOLD_BUCAP RecName: Full=Lipoprotein-releasing system ATP-bindin...    65   6e-13
HMUV_PSEHT RecName: Full=Hemin import ATP-binding protein hmuV; ...    65   6e-13
FBPC2_RHIME RecName: Full=Fe(3+) ions import ATP-binding protein...    65   6e-13
ABCB9_RAT RecName: Full=ATP-binding cassette sub-family B member...    65   6e-13
ABCB9_HUMAN RecName: Full=ATP-binding cassette sub-family B memb...    65   6e-13
ABCB8_MOUSE RecName: Full=ATP-binding cassette sub-family B memb...    65   6e-13
ABCA6_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    65   6e-13
ABC8B_MOUSE RecName: Full=ATP-binding cassette sub-family A memb...    65   6e-13
Y288_THEMA RecName: Full=Uncharacterized ABC transporter ATP-bin...    65   8e-13
Y1470_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bi...    65   8e-13
Y1073_RICCN RecName: Full=Putative export ATP-binding/permease p...    65   8e-13
TAUB_RHIL3 RecName: Full=Taurine import ATP-binding protein tauB...    65   8e-13
PSTB_STAHJ RecName: Full=Phosphate import ATP-binding protein ps...    65   8e-13
PSTB_PELUB RecName: Full=Phosphate import ATP-binding protein ps...    65   8e-13
PSTB_BACHK RecName: Full=Phosphate import ATP-binding protein ps...    65   8e-13
PSTB_BACCZ RecName: Full=Phosphate import ATP-binding protein ps...    65   8e-13
PSTB_BACC1 RecName: Full=Phosphate import ATP-binding protein ps...    65   8e-13
PSTB_BACAN RecName: Full=Phosphate import ATP-binding protein ps...    65   8e-13
PSTB2_STRPM RecName: Full=Phosphate import ATP-binding protein p...    65   8e-13
PSTB2_STRPF RecName: Full=Phosphate import ATP-binding protein p...    65   8e-13
PSTB2_STRPD RecName: Full=Phosphate import ATP-binding protein p...    65   8e-13
PSTB2_STRPC RecName: Full=Phosphate import ATP-binding protein p...    65   8e-13
PSTB2_STRPB RecName: Full=Phosphate import ATP-binding protein p...    65   8e-13
PSTB2_STRP6 RecName: Full=Phosphate import ATP-binding protein p...    65   8e-13
PSTB2_STRP3 RecName: Full=Phosphate import ATP-binding protein p...    65   8e-13
PSTB2_STRP1 RecName: Full=Phosphate import ATP-binding protein p...    65   8e-13
PSTB2_STRMU RecName: Full=Phosphate import ATP-binding protein p...    65   8e-13
MSBA_THIDA RecName: Full=Lipid A export ATP-binding/permease pro...    65   8e-13
MSBA_AZOSE RecName: Full=Lipid A export ATP-binding/permease pro...    65   8e-13
MODC_PHOLL RecName: Full=Molybdenum import ATP-binding protein m...    65   8e-13
MDR49_DROME RecName: Full=Multidrug resistance protein homolog 4...    65   8e-13
MACB_PELLD RecName: Full=Macrolide export ATP-binding/permease p...    65   8e-13
LOLD_RICPR RecName: Full=Lipoprotein-releasing system ATP-bindin...    65   8e-13
LOLD_AZOSE RecName: Full=Lipoprotein-releasing system ATP-bindin...    65   8e-13
AB3B_ARATH RecName: Full=ABC transporter B family member 3;     ...    65   8e-13
AB14G_ARATH RecName: Full=ABC transporter G family member 14;   ...    65   8e-13
ZNUC_PASMU RecName: Full=Zinc import ATP-binding protein znuC;  ...    64   1e-12
Y285_STRP1 RecName: Full=Probable ABC transporter ATP-binding pr...    64   1e-12
Y273_STRP6 RecName: Full=Probable ABC transporter ATP-binding pr...    64   1e-12
Y208_STRP3 RecName: Full=Probable ABC transporter ATP-binding pr...    64   1e-12
Y1384_MYCBO RecName: Full=Uncharacterized ABC transporter ATP-bi...    64   1e-12
Y1349_MYCTU RecName: Full=Uncharacterized ABC transporter ATP-bi...    64   1e-12
Y1056_DESVH RecName: Full=Putative ABC transporter ATP-binding p...    64   1e-12
Y014_MYCGE RecName: Full=Putative ABC transporter ATP-binding pr...    64   1e-12
WHT1_CAEEL RecName: Full=ABC transporter ATP-binding protein/per...    64   1e-12
SSUB_RALME RecName: Full=Aliphatic sulfonates import ATP-binding...    64   1e-12
SSUB_BURCM RecName: Full=Aliphatic sulfonates import ATP-binding...    64   1e-12
SSUB_BACC1 RecName: Full=Aliphatic sulfonates import ATP-binding...    64   1e-12
PSTB_MYCLE RecName: Full=Phosphate import ATP-binding protein ps...    64   1e-12
PSTB2_SYMTH RecName: Full=Phosphate import ATP-binding protein p...    64   1e-12
PSTB2_STRP8 RecName: Full=Phosphate import ATP-binding protein p...    64   1e-12
PDR13_ORYSJ RecName: Full=Pleiotropic drug resistance protein 13;      64   1e-12
MSBA_CHRSD RecName: Full=Lipid A export ATP-binding/permease pro...    64   1e-12
MACB_SHIFL RecName: Full=Macrolide export ATP-binding/permease p...    64   1e-12
MACB_ECO57 RecName: Full=Macrolide export ATP-binding/permease p...    64   1e-12
LOLD2_CHLTE RecName: Full=Lipoprotein-releasing system ATP-bindi...    64   1e-12
LOLD2_CAUCR RecName: Full=Lipoprotein-releasing system ATP-bindi...    64   1e-12
HMUV_GLOVI RecName: Full=Hemin import ATP-binding protein hmuV; ...    64   1e-12
HMUV_ENTCL RecName: Full=Hemin import ATP-binding protein hmuV; ...    64   1e-12
HMUV_DEIGD RecName: Full=Hemin import ATP-binding protein hmuV; ...    64   1e-12
HMUV_BORPA RecName: Full=Hemin import ATP-binding protein hmuV; ...    64   1e-12
FECE_ECOLI RecName: Full=Fe(3+) dicitrate transport ATP-binding ...    64   1e-12
FBPC_HAEI8 RecName: Full=Fe(3+) ions import ATP-binding protein ...    64   1e-12
CDR1_CANAL RecName: Full=Multidrug resistance protein CDR1;            64   1e-12
ADCC_BACSU RecName: Full=Probable zinc transport system ATP-bind...    64   1e-12
AB5B_ARATH RecName: Full=ABC transporter B family member 5;     ...    64   1e-12
AB18B_ARATH RecName: Full=ABC transporter B family member 18;   ...    64   1e-12
AB12B_ARATH RecName: Full=ABC transporter B family member 12;   ...    64   1e-12
Y773_CLOAB RecName: Full=Putative ABC transporter ATP-binding pr...    64   1e-12
Y1474_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bi...    64   1e-12
SSUB_ECOL6 RecName: Full=Aliphatic sulfonates import ATP-binding...    64   1e-12
SSUB1_STRAW RecName: Full=Aliphatic sulfonates import ATP-bindin...    64   1e-12
PSTB_STAES RecName: Full=Phosphate import ATP-binding protein ps...    64   1e-12
PSTB_STAEQ RecName: Full=Phosphate import ATP-binding protein ps...    64   1e-12
PSTB_METMP RecName: Full=Phosphate import ATP-binding protein ps...    64   1e-12
P29_MYCGE RecName: Full=Probable ABC transporter ATP-binding pro...    64   1e-12
OCCP_RHIME RecName: Full=Octopine permease ATP-binding protein P;      64   1e-12
MSBA_PSEA6 RecName: Full=Lipid A export ATP-binding/permease pro...    64   1e-12
MESD_LEUME RecName: Full=Mesentericin-Y105 transport/processing ...    64   1e-12
MDR3_MOUSE RecName: Full=Multidrug resistance protein 3;        ...    64   1e-12
MDR2_CRIGR RecName: Full=Multidrug resistance protein 2;        ...    64   1e-12
MACB3_PARDP RecName: Full=Macrolide export ATP-binding/permease ...    64   1e-12
LOLD_SILST RecName: Full=Lipoprotein-releasing system ATP-bindin...    64   1e-12
HMUV_SHEON RecName: Full=Hemin import ATP-binding protein hmuV; ...    64   1e-12
CDR2_CANAL RecName: Full=Multidrug resistance protein CDR2;            64   1e-12
CCMA_SHEDO RecName: Full=Cytochrome c biogenesis ATP-binding exp...    64   1e-12
CCMA_NITMU RecName: Full=Cytochrome c biogenesis ATP-binding exp...    64   1e-12
AB40G_ARATH RecName: Full=ABC transporter G family member 40;   ...    64   1e-12
Y3849_PHOLL RecName: Full=Putative ABC transporter ATP-binding p...    64   2e-12
TAP1_MOUSE RecName: Full=Antigen peptide transporter 1;         ...    64   2e-12
TAGH_LACBA RecName: Full=Teichoic acids export ATP-binding prote...    64   2e-12
TAGH_BACSK RecName: Full=Teichoic acids export ATP-binding prote...    64   2e-12
PSTB2_STRA5 RecName: Full=Phosphate import ATP-binding protein p...    64   2e-12
PSTB2_STRA3 RecName: Full=Phosphate import ATP-binding protein p...    64   2e-12
PSTB2_STRA1 RecName: Full=Phosphate import ATP-binding protein p...    64   2e-12
PHNL_ECOLI RecName: Full=Phosphonates transport ATP-binding prot...    64   2e-12
MODC_PSEU2 RecName: Full=Molybdenum import ATP-binding protein m...    64   2e-12
MDR1_CRIGR RecName: Full=Multidrug resistance protein 1;        ...    64   2e-12
LOLD_MYXXD RecName: Full=Lipoprotein-releasing system ATP-bindin...    64   2e-12
LOLD_BURCA RecName: Full=Lipoprotein-releasing system ATP-bindin...    64   2e-12
CCMA_SACD2 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    64   2e-12
ABCBB_RAT RecName: Full=Bile salt export pump;AltName: Full=ATP-...    64   2e-12
ABCB9_MOUSE RecName: Full=ATP-binding cassette sub-family B memb...    64   2e-12
ABCB6_HUMAN RecName: Full=ATP-binding cassette sub-family B memb...    64   2e-12
AB7G_ARATH RecName: Full=ABC transporter G family member 7;     ...    64   2e-12
AB11B_ARATH RecName: Full=ABC transporter B family member 11;   ...    64   2e-12
YBBL_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    63   2e-12
Y2439_THEEB RecName: Full=Putative ABC transporter ATP-binding p...    63   2e-12
Y2324_STRCO RecName: Full=Putative ABC transporter ATP-binding p...    63   2e-12
PSTB_RHOPB RecName: Full=Phosphate import ATP-binding protein ps...    63   2e-12
POTA_MYCPE RecName: Full=Spermidine/putrescine import ATP-bindin...    63   2e-12
MDLB_BUCAP RecName: Full=Multidrug resistance-like ATP-binding p...    63   2e-12
MCJD_ECOLX RecName: Full=Microcin-J25 export ATP-binding/permeas...    63   2e-12
MACB_BURPS RecName: Full=Macrolide export ATP-binding/permease p...    63   2e-12
MACB_BURP1 RecName: Full=Macrolide export ATP-binding/permease p...    63   2e-12
LOLD_FRATT RecName: Full=Lipoprotein-releasing system ATP-bindin...    63   2e-12
LOLD_FRATH RecName: Full=Lipoprotein-releasing system ATP-bindin...    63   2e-12
LOLD_FRAT1 RecName: Full=Lipoprotein-releasing system ATP-bindin...    63   2e-12
LOLD_BURXL RecName: Full=Lipoprotein-releasing system ATP-bindin...    63   2e-12
LOLD_BURS3 RecName: Full=Lipoprotein-releasing system ATP-bindin...    63   2e-12
HMUV_SHIDY RecName: Full=Hemin import ATP-binding protein hmuV; ...    63   2e-12
ATM1_CHAGB RecName: Full=Iron-sulfur clusters transporter ATM1, ...    63   2e-12
ABCX_GUITH RecName: Full=Probable ATP-dependent transporter ycf16;     63   2e-12
ABCB6_XENTR RecName: Full=ATP-binding cassette sub-family B memb...    63   2e-12
AB16B_ARATH RecName: Full=ABC transporter B family member 16;   ...    63   2e-12
AB13G_ARATH RecName: Full=ABC transporter G family member 13;   ...    63   2e-12
YUSV_BACSU RecName: Full=Probable siderophore transport system A...    63   3e-12
Y1799_STAAB RecName: Full=Putative multidrug export ATP-binding/...    63   3e-12
THIQ_HAEDU RecName: Full=Thiamine import ATP-binding protein thi...    63   3e-12
POTA_MYCMO RecName: Full=Spermidine/putrescine import ATP-bindin...    63   3e-12
MSBA_PSEAE RecName: Full=Lipid A export ATP-binding/permease pro...    63   3e-12
MODC_HAEIN RecName: Full=Molybdenum import ATP-binding protein m...    63   3e-12
MACB_SHIBS RecName: Full=Macrolide export ATP-binding/permease p...    63   3e-12
HMUV_NOCFA RecName: Full=Hemin import ATP-binding protein hmuV; ...    63   3e-12
ABCB7_RAT RecName: Full=ATP-binding cassette sub-family B member...    63   3e-12
AB4B_ARATH RecName: Full=ABC transporter B family member 4;     ...    63   3e-12
YATR_BACPF RecName: Full=Uncharacterized ABC transporter ATP-bin...    62   4e-12
Y492_RICBR RecName: Full=Putative export ATP-binding/permease pr...    62   4e-12
THIQ_AGRT5 RecName: Full=Thiamine import ATP-binding protein thi...    62   4e-12
SSUB2_RHILO RecName: Full=Aliphatic sulfonates import ATP-bindin...    62   4e-12
PEDD_PEDAC RecName: Full=Pediocin PA-1 transport/processing ATP-...    62   4e-12
MDR1_RAT RecName: Full=Multidrug resistance protein 1;         E...    62   4e-12
CCMA_VIBVY RecName: Full=Cytochrome c biogenesis ATP-binding exp...    62   4e-12
CBIO2_MYCS5 RecName: Full=Cobalt import ATP-binding protein cbiO...    62   4e-12
BTUD_CITK8 RecName: Full=Vitamin B12 import ATP-binding protein ...    62   4e-12
ATM1_YARLI RecName: Full=Iron-sulfur clusters transporter ATM1, ...    62   4e-12
ABCB7_MOUSE RecName: Full=ATP-binding cassette sub-family B memb...    62   4e-12
AB37G_ARATH RecName: Full=ABC transporter G family member 37;   ...    62   4e-12
AB33G_ARATH RecName: Full=ABC transporter G family member 33;   ...    62   4e-12
AB25G_ARATH RecName: Full=ABC transporter G family member 25;   ...    62   4e-12
AB24G_ARATH RecName: Full=ABC transporter G family member 24;   ...    62   4e-12
SSUB1_PARDP RecName: Full=Aliphatic sulfonates import ATP-bindin...    62   5e-12
SPAT_BACSU RecName: Full=Subtilin transport ATP-binding protein ...    62   5e-12
PSTB_MYCPA RecName: Full=Phosphate import ATP-binding protein ps...    62   5e-12
METN1_PSEE4 RecName: Full=Methionine import ATP-binding protein ...    62   5e-12
CCMA_VIBVU RecName: Full=Cytochrome c biogenesis ATP-binding exp...    62   5e-12
ATM1_CRYNE RecName: Full=Iron-sulfur clusters transporter ATM1, ...    62   5e-12
ABCA9_HUMAN RecName: Full=ATP-binding cassette sub-family A memb...    62   5e-12
AB30G_ARATH RecName: Full=ABC transporter G family member 30;   ...    62   5e-12
AB24B_ARATH RecName: Full=ABC transporter B family member 24, mi...    62   5e-12
Y3864_BRUME RecName: Full=Putative peptide import ATP-binding pr...    62   7e-12
Y3404_BRUSU RecName: Full=Putative peptide import ATP-binding pr...    62   7e-12
Y3318_BRUA2 RecName: Full=Putative peptide import ATP-binding pr...    62   7e-12
Y3097_BRUAB RecName: Full=Putative peptide import ATP-binding pr...    62   7e-12
Y273_STRP8 RecName: Full=Probable ABC transporter ATP-binding pr...    62   7e-12
Y2547_BRUO2 RecName: Full=Putative peptide import ATP-binding pr...    62   7e-12
TAGH_LACPL RecName: Full=Teichoic acids export ATP-binding prote...    62   7e-12
SSUB1_BURXL RecName: Full=Aliphatic sulfonates import ATP-bindin...    62   7e-12
PHNC2_RHOFD RecName: Full=Phosphonates import ATP-binding protei...    62   7e-12
PDR7_ORYSJ RecName: Full=Putative pleiotropic drug resistance pr...    62   7e-12
NDVA_RHOPA RecName: Full=Beta-(1-->2)glucan export ATP-binding/p...    62   7e-12
MDR1_MOUSE RecName: Full=Multidrug resistance protein 1;        ...    62   7e-12
MDR1_LEIEN RecName: Full=Multidrug resistance protein 1;        ...    62   7e-12
LOLD2_CHLCH RecName: Full=Lipoprotein-releasing system ATP-bindi...    62   7e-12
CCMA_VIBPA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    62   7e-12
ABCB8_DANRE RecName: Full=ATP-binding cassette sub-family B memb...    62   7e-12
AB41G_ARATH RecName: Full=ABC transporter G family member 41;   ...    62   7e-12
AB32G_ARATH RecName: Full=ABC transporter G family member 32;   ...    62   7e-12
AB1B_ARATH RecName: Full=ABC transporter B family member 1;     ...    62   7e-12
ZNUC_HAEIN RecName: Full=Zinc import ATP-binding protein znuC;  ...    61   9e-12
Y1368_BRUSU RecName: Full=Putative ABC transporter ATP-binding p...    61   9e-12
TAGH_BACLD RecName: Full=Teichoic acids export ATP-binding prote...    61   9e-12
TAGH_BACAN RecName: Full=Teichoic acids export ATP-binding prote...    61   9e-12
PSTB_MESFL RecName: Full=Phosphate import ATP-binding protein ps...    61   9e-12
PSTB1_PSEPK RecName: Full=Phosphate import ATP-binding protein p...    61   9e-12
MSBA_RHOFD RecName: Full=Lipid A export ATP-binding/permease pro...    61   9e-12
MSBA_NITOC RecName: Full=Lipid A export ATP-binding/permease pro...    61   9e-12
MRP2_RAT RecName: Full=Canalicular multispecific organic anion t...    61   9e-12
LOLD_GRABC RecName: Full=Lipoprotein-releasing system ATP-bindin...    61   9e-12
HMUV_SHEDO RecName: Full=Hemin import ATP-binding protein hmuV; ...    61   9e-12
DPPD_HAEIN RecName: Full=Dipeptide transport ATP-binding protein...    61   9e-12
CYDD_BACSU RecName: Full=ATP-binding/permease protein cydD;            61   9e-12
BTUD_ECO5E RecName: Full=Vitamin B12 import ATP-binding protein ...    61   9e-12
BTUD_ECO57 RecName: Full=Vitamin B12 import ATP-binding protein ...    61   9e-12
ALBC_BACSU RecName: Full=Putative ABC transporter ATP-binding pr...    61   9e-12
ABCGI_DICDI RecName: Full=ABC transporter G family member 18;Alt...    61   9e-12
AB43G_ARATH RecName: Full=ABC transporter G family member 43;   ...    61   9e-12
YH85_SCHPO RecName: Full=Uncharacterized ABC transporter ATP-bin...    61   1e-11
YFIB_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    61   1e-11
UVRA_AQUAE RecName: Full=UvrABC system protein A;         Short=...    61   1e-11
PDR6_ORYSJ RecName: Full=Pleiotropic drug resistance protein 6;        61   1e-11
PDR2_ORYSJ RecName: Full=Probable pleiotropic drug resistance pr...    61   1e-11
PDR1_TOBAC RecName: Full=Pleiotropic drug resistance protein 1;A...    61   1e-11
NIKD_RHORT RecName: Full=Nickel import ATP-binding protein nikD;...    61   1e-11
LOLD_THIDA RecName: Full=Lipoprotein-releasing system ATP-bindin...    61   1e-11
HMUV_SHIDS RecName: Full=Hemin import ATP-binding protein hmuV; ...    61   1e-11
CCMA_PSEAE RecName: Full=Cytochrome c biogenesis ATP-binding exp...    61   1e-11
CCMA_COLP3 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    61   1e-11
YBP8_SCHPO RecName: Full=Uncharacterized ABC transporter ATP-bin...    60   2e-11
Y4GM_RHISN RecName: Full=Uncharacterized ABC transporter ATP-bin...    60   2e-11
Y187_MYCGE RecName: Full=Putative ABC transporter ATP-binding pr...    60   2e-11
UUP_ECOLI RecName: Full=ABC transporter ATP-binding protein uup;       60   2e-11
TAUB_CHRVO RecName: Full=Taurine import ATP-binding protein tauB...    60   2e-11
SSUB_ECOL5 RecName: Full=Aliphatic sulfonates import ATP-binding...    60   2e-11
PSTB_BACHD RecName: Full=Phosphate import ATP-binding protein ps...    60   2e-11
POTA_MYCS5 RecName: Full=Spermidine/putrescine import ATP-bindin...    60   2e-11
PHNC_POLSJ RecName: Full=Phosphonates import ATP-binding protein...    60   2e-11
PHNC_BURXL RecName: Full=Phosphonates import ATP-binding protein...    60   2e-11
PDR12_ORYSJ RecName: Full=Pleiotropic drug resistance protein 12;      60   2e-11
MDR_ORYSJ RecName: Full=Putative multidrug resistance protein;Al...    60   2e-11
MDLB_BUCAI RecName: Full=Multidrug resistance-like ATP-binding p...    60   2e-11
LOLD_NEOSM RecName: Full=Lipoprotein-releasing system ATP-bindin...    60   2e-11
HMUV_ECOL6 RecName: Full=Hemin import ATP-binding protein hmuV; ...    60   2e-11
HMUV_ECOL5 RecName: Full=Hemin import ATP-binding protein hmuV; ...    60   2e-11
HMUV_ECO57 RecName: Full=Hemin import ATP-binding protein hmuV; ...    60   2e-11
CCMA_MESSB RecName: Full=Cytochrome c biogenesis ATP-binding exp...    60   2e-11
CCMA_AZOSE RecName: Full=Cytochrome c biogenesis ATP-binding exp...    60   2e-11
ABCG2_PIG RecName: Full=ATP-binding cassette sub-family G member...    60   2e-11
ABCG2_BOVIN RecName: Full=ATP-binding cassette sub-family G memb...    60   2e-11
AB9B_ARATH RecName: Full=ABC transporter B family member 9;     ...    60   2e-11
TAGH_BACSU RecName: Full=Teichoic acids export ATP-binding prote...    60   2e-11
PSTB2_STRPN RecName: Full=Phosphate import ATP-binding protein p...    60   2e-11
OPPF_MYCGE RecName: Full=Oligopeptide transport ATP-binding prot...    60   2e-11
MSBA_ALCBS RecName: Full=Lipid A export ATP-binding/permease pro...    60   2e-11
LOLD_WIGBR RecName: Full=Lipoprotein-releasing system ATP-bindin...    60   2e-11
LOLD1_PELLD RecName: Full=Lipoprotein-releasing system ATP-bindi...    60   2e-11
HMUV_THICR RecName: Full=Hemin import ATP-binding protein hmuV; ...    60   2e-11
CCMA_RECAM RecName: Full=Cytochrome c biogenesis ATP-binding exp...    60   2e-11
ATM1_DEBHA RecName: Full=Iron-sulfur clusters transporter ATM1, ...    60   2e-11
AB4F_ARATH RecName: Full=ABC transporter F family member 4;     ...    60   2e-11
AB42G_ARATH RecName: Full=ABC transporter G family member 42;   ...    60   2e-11
AB23B_ARATH RecName: Full=ABC transporter B family member 23, mi...    60   2e-11
YFMR_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    60   3e-11
PSTB2_STRR6 RecName: Full=Phosphate import ATP-binding protein p...    60   3e-11
MACB_BRAJA RecName: Full=Macrolide export ATP-binding/permease p...    60   3e-11
LOLD_EHRCJ RecName: Full=Lipoprotein-releasing system ATP-bindin...    60   3e-11
HMUV_VIBPA RecName: Full=Hemin import ATP-binding protein hmuV; ...    60   3e-11
HMUV_ECOUT RecName: Full=Hemin import ATP-binding protein hmuV; ...    60   3e-11
CCMA_PSEPK RecName: Full=Cytochrome c biogenesis ATP-binding exp...    60   3e-11
CCMA_PSEPF RecName: Full=Cytochrome c biogenesis ATP-binding exp...    60   3e-11
CCMA2_RALME RecName: Full=Cytochrome c biogenesis ATP-binding ex...    60   3e-11
BTUD_SHISS RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_SHIFL RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_SHIF8 RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_SHIDS RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_SHIB3 RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_ECOSM RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_ECOSE RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_ECOLU RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_ECOLC RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_ECOHS RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_ECO8A RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_ECO7I RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_ECO55 RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
BTUD_ECO24 RecName: Full=Vitamin B12 import ATP-binding protein ...    60   3e-11
ABCX_CYACA RecName: Full=Probable ATP-dependent transporter ycf16;     60   3e-11
ZNUC_WIGBR RecName: Full=Zinc import ATP-binding protein znuC;  ...    59   4e-11
Y1388_BRUA2 RecName: Full=Putative ABC transporter ATP-binding p...    59   4e-11
Y1365_BRUAB RecName: Full=Putative ABC transporter ATP-binding p...    59   4e-11
PSTB2_SYNJA RecName: Full=Phosphate import ATP-binding protein p...    59   4e-11
POTA_MYCHJ RecName: Full=Spermidine/putrescine import ATP-bindin...    59   4e-11
POTA_MYCH7 RecName: Full=Spermidine/putrescine import ATP-bindin...    59   4e-11
POTA_MYCH2 RecName: Full=Spermidine/putrescine import ATP-bindin...    59   4e-11
MSBA_PSEPK RecName: Full=Lipid A export ATP-binding/permease pro...    59   4e-11
MDLB_BUCBP RecName: Full=Multidrug resistance-like ATP-binding p...    59   4e-11
HEPA_ANASP RecName: Full=Heterocyst differentiation ATP-binding ...    59   4e-11
CCMA_RHOS4 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    59   4e-11
CCMA_PSEPG RecName: Full=Cytochrome c biogenesis ATP-binding exp...    59   4e-11
CCMA_BURXL RecName: Full=Cytochrome c biogenesis ATP-binding exp...    59   4e-11
BTUD_SALTY RecName: Full=Vitamin B12 import ATP-binding protein ...    59   4e-11
BTUD_SALTI RecName: Full=Vitamin B12 import ATP-binding protein ...    59   4e-11
BTUD_SALHS RecName: Full=Vitamin B12 import ATP-binding protein ...    59   4e-11
BTUD_SALEP RecName: Full=Vitamin B12 import ATP-binding protein ...    59   4e-11
BTUD_SALDC RecName: Full=Vitamin B12 import ATP-binding protein ...    59   4e-11
BTUD_SALCH RecName: Full=Vitamin B12 import ATP-binding protein ...    59   4e-11
BTUD_ECOLI RecName: Full=Vitamin B12 import ATP-binding protein ...    59   4e-11
BTUD_ECODH RecName: Full=Vitamin B12 import ATP-binding protein ...    59   4e-11
BTUD_ECOBW RecName: Full=Vitamin B12 import ATP-binding protein ...    59   4e-11
ATM1_GIBZE RecName: Full=Iron-sulfur clusters transporter ATM1, ...    59   4e-11
Y214_RICFE RecName: Full=Putative export ATP-binding/permease pr...    59   5e-11
SSUB_PSEE4 RecName: Full=Aliphatic sulfonates import ATP-binding...    59   5e-11
SCRT_DROME RecName: Full=Protein scarlet;                              59   5e-11
PSTB_MYCMS RecName: Full=Phosphate import ATP-binding protein ps...    59   5e-11
PSTB3_ANAVT RecName: Full=Phosphate import ATP-binding protein p...    59   5e-11
POTA_AYWBP RecName: Full=Spermidine/putrescine import ATP-bindin...    59   5e-11
MSBA_PASMU RecName: Full=Lipid A export ATP-binding/permease pro...    59   5e-11
MODC_PASMU RecName: Full=Molybdenum import ATP-binding protein m...    59   5e-11
LOLD_RICFE RecName: Full=Lipoprotein-releasing system ATP-bindin...    59   5e-11
LOLD_FUSNN RecName: Full=Lipoprotein-releasing system ATP-bindin...    59   5e-11
HMUV_BURPS RecName: Full=Hemin import ATP-binding protein hmuV; ...    59   5e-11
HMUV_BURP1 RecName: Full=Hemin import ATP-binding protein hmuV; ...    59   5e-11
HMUV_BURMA RecName: Full=Hemin import ATP-binding protein hmuV; ...    59   5e-11
CDR3_CANAL RecName: Full=Opaque-specific ABC transporter CDR3;         59   5e-11
CCMA_PARDP RecName: Full=Cytochrome c biogenesis ATP-binding exp...    59   5e-11
BTUD_SHIBS RecName: Full=Vitamin B12 import ATP-binding protein ...    59   5e-11
BTUD_SALPK RecName: Full=Vitamin B12 import ATP-binding protein ...    59   5e-11
BTUD_SALPA RecName: Full=Vitamin B12 import ATP-binding protein ...    59   5e-11
ATM1_SCHPO RecName: Full=Iron-sulfur clusters transporter atm1, ...    59   5e-11
ATM1_NEUCR RecName: Full=Iron-sulfur clusters transporter atm-1,...    59   5e-11
ABCG2_HUMAN RecName: Full=ATP-binding cassette sub-family G memb...    59   5e-11
ABCBB_HUMAN RecName: Full=Bile salt export pump;AltName: Full=AT...    59   5e-11
AB28G_ARATH RecName: Full=ABC transporter G family member 28;   ...    59   5e-11
AB27G_ARATH RecName: Full=ABC transporter G family member 27;   ...    59   5e-11
AB23G_ARATH RecName: Full=ABC transporter G family member 23;   ...    59   5e-11
Y3108_BRUME RecName: Full=Putative ATP-binding protein BMEII0108...    59   6e-11
WHITE_LUCCU RecName: Full=Protein white;                               59   6e-11
SUFC_ECOLI RecName: Full=Probable ATP-dependent transporter sufC;      59   6e-11
STE6_YEAST RecName: Full=Alpha-factor-transporting ATPase;      ...    59   6e-11
PDR5_YEAST RecName: Full=Pleiotropic ABC efflux transporter of m...    59   6e-11
NIKE_RHORT RecName: Full=Nickel import ATP-binding protein nikE;...    59   6e-11
MSBA_PSYCK RecName: Full=Lipid A export ATP-binding/permease pro...    59   6e-11
MCBF_ECOLX RecName: Full=Protein mcbF;                                 59   6e-11
HMUV_BURTA RecName: Full=Hemin import ATP-binding protein hmuV; ...    59   6e-11
CCMA_PSE14 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    59   6e-11
BMRA_BACSU RecName: Full=Multidrug resistance ABC transporter AT...    59   6e-11
BFR1_SCHPO RecName: Full=Brefeldin A resistance protein;               59   6e-11
AB21G_ARATH RecName: Full=ABC transporter G family member 21;   ...    59   6e-11
Y4389_ANASP RecName: Full=Uncharacterized ABC transporter ATP-bi...    58   8e-11
PSTB3_ANASP RecName: Full=Phosphate import ATP-binding protein p...    58   8e-11
OPPD2_STAAR RecName: Full=Putative oligopeptide transport ATP-bi...    58   8e-11
MSBA_SHEON RecName: Full=Lipid A export ATP-binding/permease pro...    58   8e-11
CCMA_RHOCA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    58   8e-11
ABCBB_RABIT RecName: Full=Bile salt export pump;AltName: Full=AT...    58   8e-11
YNJD_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    58   1e-10
PSTB_RHOP2 RecName: Full=Phosphate import ATP-binding protein ps...    58   1e-10
PDR2_NICPL RecName: Full=Pleiotropic drug resistance protein 2;A...    58   1e-10
OPPD_MYCPN RecName: Full=Oligopeptide transport ATP-binding prot...    58   1e-10
MDL1_YEAST RecName: Full=ATP-dependent permease MDL1, mitochondr...    58   1e-10
ADP1_YEAST RecName: Full=Probable ATP-dependent permease;Flags: ...    58   1e-10
AB3F_ARATH RecName: Full=ABC transporter F family member 3;     ...    58   1e-10
AB26G_ARATH RecName: Full=ABC transporter G family member 26;   ...    58   1e-10
Y3863_BRUME RecName: Full=Putative peptide import ATP-binding pr...    57   1e-10
Y3405_BRUSU RecName: Full=Putative peptide import ATP-binding pr...    57   1e-10
Y018_MYCPN RecName: Full=Putative ABC transporter ATP-binding pr...    57   1e-10
PHNC_MESFL RecName: Full=Phosphonates import ATP-binding protein...    57   1e-10
PDR10_YEAST RecName: Full=ATP-dependent permease PDR10;                57   1e-10
MSBA_PSYA2 RecName: Full=Lipid A export ATP-binding/permease pro...    57   1e-10
MSBA_PSEU2 RecName: Full=Lipid A export ATP-binding/permease pro...    57   1e-10
MSBA_NEIMB RecName: Full=Lipid A export ATP-binding/permease pro...    57   1e-10
MSBA1_COLP3 RecName: Full=Lipid A export ATP-binding/permease pr...    57   1e-10
MACB1_PARDP RecName: Full=Macrolide export ATP-binding/permease ...    57   1e-10
ECSA_BACSU RecName: Full=ABC-type transporter ATP-binding protei...    57   1e-10
ABCG2_RAT RecName: Full=ATP-binding cassette sub-family G member...    57   1e-10
ABCG2_MOUSE RecName: Full=ATP-binding cassette sub-family G memb...    57   1e-10
AB34G_ARATH RecName: Full=ABC transporter G family member 34;   ...    57   1e-10
AB20B_ARATH RecName: Full=ABC transporter B family member 20;   ...    57   1e-10
Y432_MYCPN RecName: Full=Putative ABC transporter ATP-binding pr...    57   2e-10
UVRA_CHLTR RecName: Full=UvrABC system protein A;         Short=...    57   2e-10
TAGH_STAS1 RecName: Full=Teichoic acids export ATP-binding prote...    57   2e-10
PSTB1_LACS1 RecName: Full=Phosphate import ATP-binding protein p...    57   2e-10
PHNC_ANADE RecName: Full=Phosphonates import ATP-binding protein...    57   2e-10
OPPF_MYCPN RecName: Full=Oligopeptide transport ATP-binding prot...    57   2e-10
NOSF_PSEST RecName: Full=Copper transport ATP-binding protein nosF;    57   2e-10
MSBA_SHESR RecName: Full=Lipid A export ATP-binding/permease pro...    57   2e-10
MSBA_SHESM RecName: Full=Lipid A export ATP-binding/permease pro...    57   2e-10
MSBA_PSE14 RecName: Full=Lipid A export ATP-binding/permease pro...    57   2e-10
MSBA2_COLP3 RecName: Full=Lipid A export ATP-binding/permease pr...    57   2e-10
MODF_ECOLI RecName: Full=Putative molybdenum transport ATP-bindi...    57   2e-10
LOLD_VIBCH RecName: Full=Lipoprotein-releasing system ATP-bindin...    57   2e-10
LOLD_DESPS RecName: Full=Lipoprotein-releasing system ATP-bindin...    57   2e-10
HMUV_PHOPR RecName: Full=Hemin import ATP-binding protein hmuV; ...    57   2e-10
HMUV_MYXXD RecName: Full=Hemin import ATP-binding protein hmuV; ...    57   2e-10
CCMA_PSEF5 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    57   2e-10
AB19G_ARATH RecName: Full=ABC transporter G family member 19;   ...    57   2e-10
YTRB_BACSU RecName: Full=ABC transporter ATP-binding protein ytrB;     57   2e-10
Y3317_BRUA2 RecName: Full=Putative peptide import ATP-binding pr...    57   2e-10
Y3096_BRUAB RecName: Full=Putative peptide import ATP-binding pr...    57   2e-10
Y1618_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bi...    57   2e-10
Y035_TREPA RecName: Full=Probable metal transport system ATP-bin...    57   2e-10
V296_BACSU RecName: Full=Vegetative protein 296;         Short=V...    57   2e-10
TUR2_SPIPO RecName: Full=Pleiotropic drug resistance protein TUR...    57   2e-10
THIQ_RHILO RecName: Full=Thiamine import ATP-binding protein thi...    57   2e-10
RFBE_YEREN RecName: Full=O-antigen export system ATP-binding pro...    57   2e-10
PSTB_ALCBS RecName: Full=Phosphate import ATP-binding protein ps...    57   2e-10
MRP2_HUMAN RecName: Full=Canalicular multispecific organic anion...    57   2e-10
MDR65_DROME RecName: Full=Multidrug resistance protein homolog 6...    57   2e-10
MDLA_BUCAP RecName: Full=Multidrug resistance-like ATP-binding p...    57   2e-10
HMUV_PSEAE RecName: Full=Hemin import ATP-binding protein hmuV; ...    57   2e-10
HMUV_PSEAB RecName: Full=Hemin import ATP-binding protein hmuV; ...    57   2e-10
CCMA_SHEON RecName: Full=Cytochrome c biogenesis ATP-binding exp...    57   2e-10
BTUD_ECOUT RecName: Full=Vitamin B12 import ATP-binding protein ...    57   2e-10
BTUD_ECOL6 RecName: Full=Vitamin B12 import ATP-binding protein ...    57   2e-10
BTUD_ECOL5 RecName: Full=Vitamin B12 import ATP-binding protein ...    57   2e-10
BTUD_ECOK1 RecName: Full=Vitamin B12 import ATP-binding protein ...    57   2e-10
BTUD_ECO81 RecName: Full=Vitamin B12 import ATP-binding protein ...    57   2e-10
BTUD_ECO45 RecName: Full=Vitamin B12 import ATP-binding protein ...    57   2e-10
BTUD_ECO27 RecName: Full=Vitamin B12 import ATP-binding protein ...    57   2e-10
ABCG2_MACMU RecName: Full=ATP-binding cassette sub-family G memb...    57   2e-10
ABCC9_RAT RecName: Full=ATP-binding cassette transporter sub-fam...    57   2e-10
AB38G_ARATH RecName: Full=ABC transporter G family member 38;   ...    57   2e-10
Y075_SYNY3 RecName: Full=Probable ATP-dependent transporter slr0...    56   3e-10
WHITE_DROME RecName: Full=Protein white;                               56   3e-10
TAUB_RHILO RecName: Full=Taurine import ATP-binding protein tauB...    56   3e-10
SSUB2_STRAW RecName: Full=Aliphatic sulfonates import ATP-bindin...    56   3e-10
POTA_ONYPE RecName: Full=Spermidine/putrescine import ATP-bindin...    56   3e-10
PDR12_YEAST RecName: Full=ATP-dependent permease PDR12;                56   3e-10
MRP6_HUMAN RecName: Full=Multidrug resistance-associated protein...    56   3e-10
MODC_BRUME RecName: Full=Molybdenum import ATP-binding protein m...    56   3e-10
LOLD_RICCN RecName: Full=Lipoprotein-releasing system ATP-bindin...    56   3e-10
HMT1_SCHPO RecName: Full=Heavy metal tolerance protein;Flags: Pr...    56   3e-10
CCMA_SHESR RecName: Full=Cytochrome c biogenesis ATP-binding exp...    56   3e-10
CCMA_SHESM RecName: Full=Cytochrome c biogenesis ATP-binding exp...    56   3e-10
CCMA_BRUSU RecName: Full=Cytochrome c biogenesis ATP-binding exp...    56   3e-10
CCMA_BRUME RecName: Full=Cytochrome c biogenesis ATP-binding exp...    56   3e-10
CCMA_BRUAB RecName: Full=Cytochrome c biogenesis ATP-binding exp...    56   3e-10
CCMA_BRUA2 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    56   3e-10
ABCG5_HUMAN RecName: Full=ATP-binding cassette sub-family G memb...    56   3e-10
AB9G_ARATH RecName: Full=ABC transporter G family member 9;     ...    56   3e-10
AB19B_ARATH RecName: Full=ABC transporter B family member 19;   ...    56   3e-10
Y385_SYNY3 RecName: Full=Putative ABC transporter ATP-binding pr...    56   4e-10
Y2548_BRUO2 RecName: Full=Putative peptide import ATP-binding pr...    56   4e-10
UVRA_CHLMU RecName: Full=UvrABC system protein A;         Short=...    56   4e-10
SSUB1_RHIL3 RecName: Full=Aliphatic sulfonates import ATP-bindin...    56   4e-10
PSTB1_STRR6 RecName: Full=Phosphate import ATP-binding protein p...    56   4e-10
PSTB1_STRPN RecName: Full=Phosphate import ATP-binding protein p...    56   4e-10
MSBA_PSESM RecName: Full=Lipid A export ATP-binding/permease pro...    56   4e-10
MSBA_METCA RecName: Full=Lipid A export ATP-binding/permease pro...    56   4e-10
MODC_BRUAB RecName: Full=Molybdenum import ATP-binding protein m...    56   4e-10
MODC_BRUA2 RecName: Full=Molybdenum import ATP-binding protein m...    56   4e-10
MACB_BURS3 RecName: Full=Macrolide export ATP-binding/permease p...    56   4e-10
LOLD_CHRSD RecName: Full=Lipoprotein-releasing system ATP-bindin...    56   4e-10
CYAB_BORPE RecName: Full=Cyclolysin secretion/processing ATP-bin...    56   4e-10
CFTR_DIDMA RecName: Full=Cystic fibrosis transmembrane conductan...    56   4e-10
CCMA_ZYMMO RecName: Full=Cytochrome c biogenesis ATP-binding exp...    56   4e-10
CCMA_RHOPA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    56   4e-10
AB6B_ARATH RecName: Full=ABC transporter B family member 6;     ...    56   4e-10
AB4G_ARATH RecName: Full=ABC transporter G family member 4;     ...    56   4e-10
YEJF_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    55   5e-10
UVRA_THEMA RecName: Full=UvrABC system protein A;         Short=...    55   5e-10
SSUB2_XANAC RecName: Full=Aliphatic sulfonates import ATP-bindin...    55   5e-10
PSTB1_BACLD RecName: Full=Phosphate import ATP-binding protein p...    55   5e-10
OPPD2_STAAW RecName: Full=Putative oligopeptide transport ATP-bi...    55   5e-10
NIKD_BRUME RecName: Full=Nickel import ATP-binding protein nikD;...    55   5e-10
NIKD_BRUAB RecName: Full=Nickel import ATP-binding protein nikD;...    55   5e-10
NIKD_BRUA2 RecName: Full=Nickel import ATP-binding protein nikD;...    55   5e-10
MSBA_SHEDO RecName: Full=Lipid A export ATP-binding/permease pro...    55   5e-10
MRP6_RAT RecName: Full=Multidrug resistance-associated protein 6...    55   5e-10
MACB_BURCH RecName: Full=Macrolide export ATP-binding/permease p...    55   5e-10
MACB_BURCA RecName: Full=Macrolide export ATP-binding/permease p...    55   5e-10
LOLD_METCA RecName: Full=Lipoprotein-releasing system ATP-bindin...    55   5e-10
CCMA_SILPO RecName: Full=Cytochrome c biogenesis ATP-binding exp...    55   5e-10
BROWN_DROME RecName: Full=Protein brown;                               55   5e-10
ABCX_CYAPA RecName: Full=Probable ATP-dependent transporter ycf16;     55   5e-10
AB36G_ARATH RecName: Full=ABC transporter G family member 36;   ...    55   5e-10
WBC30_ARATH RecName: Full=Putative white-brown complex homolog p...    55   7e-10
SSUB2_FRAAA RecName: Full=Aliphatic sulfonates import ATP-bindin...    55   7e-10
SAPD_HAEIN RecName: Full=Peptide transport system ATP-binding pr...    55   7e-10
PDH1_CANGA RecName: Full=ATP-binding cassette transporter CGR1;A...    55   7e-10
OPPD2_STAAS RecName: Full=Putative oligopeptide transport ATP-bi...    55   7e-10
OPPD2_STAAC RecName: Full=Putative oligopeptide transport ATP-bi...    55   7e-10
OPPD2_STAA8 RecName: Full=Putative oligopeptide transport ATP-bi...    55   7e-10
OPPD2_STAA3 RecName: Full=Putative oligopeptide transport ATP-bi...    55   7e-10
MSBA_NEIG1 RecName: Full=Lipid A export ATP-binding/permease pro...    55   7e-10
MSBA_HAEI8 RecName: Full=Lipid A export ATP-binding/permease pro...    55   7e-10
MODC_BRUSU RecName: Full=Molybdenum import ATP-binding protein m...    55   7e-10
HRTA_STAES RecName: Full=Putative hemin import ATP-binding prote...    55   7e-10
HRTA_STAEQ RecName: Full=Putative hemin import ATP-binding prote...    55   7e-10
CCMA_MANSM RecName: Full=Cytochrome c biogenesis ATP-binding exp...    55   7e-10
ARB1_YEAST RecName: Full=ABC transporter ATP-binding protein ARB...    55   7e-10
AB8B_ARATH RecName: Full=Putative ABC transporter B family membe...    55   7e-10
AB5F_ARATH RecName: Full=ABC transporter F family member 5;     ...    55   7e-10
AB25B_ARATH RecName: Full=ABC transporter B family member 25, mi...    55   7e-10
AB17G_ARATH RecName: Full=ABC transporter G family member 17;   ...    55   7e-10
AB14C_ARATH RecName: Full=ABC transporter C family member 14;   ...    55   7e-10
Y697_CHLMU RecName: Full=Probable metal transport system ATP-bin...    55   9e-10
OPPD_MYCGE RecName: Full=Oligopeptide transport ATP-binding prot...    55   9e-10
NIKD_BRUSU RecName: Full=Nickel import ATP-binding protein nikD;...    55   9e-10
MSBA_ACIAD RecName: Full=Lipid A export ATP-binding/permease pro...    55   9e-10
MODC_SHIDS RecName: Full=Molybdenum import ATP-binding protein m...    55   9e-10
MODC_SHIBS RecName: Full=Molybdenum import ATP-binding protein m...    55   9e-10
MODC_ECO57 RecName: Full=Molybdenum import ATP-binding protein m...    55   9e-10
LOLD_SILPO RecName: Full=Lipoprotein-releasing system ATP-bindin...    55   9e-10
LOLD_NEIG1 RecName: Full=Lipoprotein-releasing system ATP-bindin...    55   9e-10
EF3_CANGA RecName: Full=Elongation factor 3;         Short=EF-3;       55   9e-10
CCMA_ROSDO RecName: Full=Cytochrome c biogenesis ATP-binding exp...    55   9e-10
CCMA_RHILO RecName: Full=Cytochrome c biogenesis ATP-binding exp...    55   9e-10
ABCC9_MOUSE RecName: Full=ATP-binding cassette transporter sub-f...    55   9e-10
AB15G_ARATH RecName: Full=ABC transporter G family member 15;   ...    55   9e-10
AB11G_ARATH RecName: Full=ABC transporter G family member 11;   ...    55   9e-10
Y1136_SULTO RecName: Full=Putative ABC transporter ATP-binding p...    54   1e-09
PDR4_ORYSJ RecName: Full=Pleiotropic drug resistance protein 4;        54   1e-09
OPPD2_STAAN RecName: Full=Putative oligopeptide transport ATP-bi...    54   1e-09
OPPD2_STAAM RecName: Full=Putative oligopeptide transport ATP-bi...    54   1e-09
MODC_ECOUT RecName: Full=Molybdenum import ATP-binding protein m...    54   1e-09
MODC_ECOL5 RecName: Full=Molybdenum import ATP-binding protein m...    54   1e-09
MDLA_ECOLI RecName: Full=Multidrug resistance-like ATP-binding p...    54   1e-09
LOLD_NOVAD RecName: Full=Lipoprotein-releasing system ATP-bindin...    54   1e-09
CFTR_XENLA RecName: Full=Cystic fibrosis transmembrane conductan...    54   1e-09
CFTR_TRIVU RecName: Full=Cystic fibrosis transmembrane conductan...    54   1e-09
AB1F_ARATH RecName: Full=ABC transporter F family member 1;     ...    54   1e-09
SSUB_FRASC RecName: Full=Aliphatic sulfonates import ATP-binding...    54   1e-09
PDR15_YEAST RecName: Full=ATP-dependent permease PDR15;                54   1e-09
OPPD2_STAAB RecName: Full=Putative oligopeptide transport ATP-bi...    54   1e-09
MODC_SHISS RecName: Full=Molybdenum import ATP-binding protein m...    54   1e-09
MODC_SHIFL RecName: Full=Molybdenum import ATP-binding protein m...    54   1e-09
MODC_MANSM RecName: Full=Molybdenum import ATP-binding protein m...    54   1e-09
MODC_ECOLI RecName: Full=Molybdenum import ATP-binding protein m...    54   1e-09
MODC_ECOL6 RecName: Full=Molybdenum import ATP-binding protein m...    54   1e-09
CFTR_HORSE RecName: Full=Cystic fibrosis transmembrane conductan...    54   1e-09
CCMA_PSESM RecName: Full=Cytochrome c biogenesis ATP-binding exp...    54   1e-09
CCMA_PANCI RecName: Full=Cytochrome c biogenesis ATP-binding exp...    54   1e-09
AB35G_ARATH RecName: Full=ABC transporter G family member 35;   ...    54   1e-09
AARD_PROST RecName: Full=Transport ATP-binding protein aarD;           54   1e-09
YTHP_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    54   2e-09
YOX6_SCHPO RecName: Full=Uncharacterized ABC transporter ATP-bin...    54   2e-09
YBIT_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    54   2e-09
YBIT_ECOL6 RecName: Full=Uncharacterized ABC transporter ATP-bin...    54   2e-09
YBIT_ECO57 RecName: Full=Uncharacterized ABC transporter ATP-bin...    54   2e-09
Y334_MYCPN RecName: Full=Putative ABC transporter ATP-binding pr...    54   2e-09
WHITE_CERCA RecName: Full=Protein white;                               54   2e-09
TAP2_HUMAN RecName: Full=Antigen peptide transporter 2;         ...    54   2e-09
TAGH_ENTFA RecName: Full=Teichoic acids export ATP-binding prote...    54   2e-09
SSUB_RALEJ RecName: Full=Aliphatic sulfonates import ATP-binding...    54   2e-09
PHNC_BURMA RecName: Full=Phosphonates import ATP-binding protein...    54   2e-09
MSBA_PHOPR RecName: Full=Lipid A export ATP-binding/permease pro...    54   2e-09
MRP2_RABIT RecName: Full=Canalicular multispecific organic anion...    54   2e-09
LOLD_MARMM RecName: Full=Lipoprotein-releasing system ATP-bindin...    54   2e-09
HMUV_THEFY RecName: Full=Hemin import ATP-binding protein hmuV; ...    54   2e-09
EXPZ_BACSU RecName: Full=Nucleotide-binding protein expZ;              54   2e-09
CFTR_CANFA RecName: Full=Cystic fibrosis transmembrane conductan...    54   2e-09
CCMA_YERPN RecName: Full=Cytochrome c biogenesis ATP-binding exp...    54   2e-09
CCMA_YERPE RecName: Full=Cytochrome c biogenesis ATP-binding exp...    54   2e-09
CCMA_YERPA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    54   2e-09
CCMA_RICBR RecName: Full=Cytochrome c biogenesis ATP-binding exp...    54   2e-09
ABCX_GALSU RecName: Full=Probable ATP-dependent transporter ycf16;     54   2e-09
ABCG5_RAT RecName: Full=ATP-binding cassette sub-family G member...    54   2e-09
ABCC9_RABIT RecName: Full=ATP-binding cassette transporter sub-f...    54   2e-09
AB1E_ARATH RecName: Full=ABC transporter E family member 1;     ...    54   2e-09
AB12G_ARATH RecName: Full=ABC transporter G family member 12;   ...    54   2e-09
YGAD_BACSU RecName: Full=Putative multidrug export ATP-binding/p...    53   3e-09
Y134_MYCPN RecName: Full=Putative ABC transporter ATP-binding pr...    53   3e-09
UVRA_CHLPN RecName: Full=UvrABC system protein A;         Short=...    53   3e-09
SNQ2_YEAST RecName: Full=Protein SNQ2;                                 53   3e-09
RLI1_YEAST RecName: Full=Translation initiation factor RLI1;AltN...    53   3e-09
PHNC_BURPS RecName: Full=Phosphonates import ATP-binding protein...    53   3e-09
PHNC_BURP1 RecName: Full=Phosphonates import ATP-binding protein...    53   3e-09
MSBA_XYLFT RecName: Full=Lipid A export ATP-binding/permease pro...    53   3e-09
MRP3_HUMAN RecName: Full=Canalicular multispecific organic anion...    53   3e-09
CCMA_YERPS RecName: Full=Cytochrome c biogenesis ATP-binding exp...    53   3e-09
CBIO1_UREPA RecName: Full=Cobalt import ATP-binding protein cbiO...    53   3e-09
ATM1_CANAL RecName: Full=Iron-sulfur clusters transporter ATM1, ...    53   3e-09
ABCG8_MOUSE RecName: Full=ATP-binding cassette sub-family G memb...    53   3e-09
AB1G_ARATH RecName: Full=ABC transporter G family member 1;     ...    53   3e-09
AB16G_ARATH RecName: Full=ABC transporter G family member 16;   ...    53   3e-09
AB13C_ARATH RecName: Full=ABC transporter C family member 13;   ...    53   3e-09
VMR1_YEAST RecName: Full=ABC transporter ATP-binding protein/per...    53   3e-09
TAGH_STAHJ RecName: Full=Teichoic acids export ATP-binding prote...    53   3e-09
SSUB_RALSO RecName: Full=Aliphatic sulfonates import ATP-binding...    53   3e-09
SSUB2_RHOSR RecName: Full=Aliphatic sulfonates import ATP-bindin...    53   3e-09
PSTB2_SYNJB RecName: Full=Phosphate import ATP-binding protein p...    53   3e-09
MSBA_HAEIN RecName: Full=Lipid A export ATP-binding/permease pro...    53   3e-09
LOLD_ACIAD RecName: Full=Lipoprotein-releasing system ATP-bindin...    53   3e-09
HMUV_VIBVY RecName: Full=Hemin import ATP-binding protein hmuV; ...    53   3e-09
HMUV_IDILO RecName: Full=Hemin import ATP-binding protein hmuV; ...    53   3e-09
CFTR_RAT RecName: Full=Cystic fibrosis transmembrane conductance...    53   3e-09
CFTR_CALJA RecName: Full=Cystic fibrosis transmembrane conductan...    53   3e-09
CCMA_GLUOX RecName: Full=Cytochrome c biogenesis ATP-binding exp...    53   3e-09
AB5C_ARATH RecName: Full=ABC transporter C family member 5;     ...    53   3e-09
ZNUC2_VIBF1 RecName: Full=Zinc import ATP-binding protein znuC 2...    52   4e-09
YFMM_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    52   4e-09
Y433_MYCPN RecName: Full=Putative ABC transporter ATP-binding pr...    52   4e-09
SYRD_PSESY RecName: Full=ATP-binding protein syrD;                     52   4e-09
PHNC_PSEPF RecName: Full=Phosphonates import ATP-binding protein...    52   4e-09
MRP6_MOUSE RecName: Full=Multidrug resistance-associated protein...    52   4e-09
ELF1_SCHPO RecName: Full=mRNA export factor elf1;                      52   4e-09
EF3_CANAL RecName: Full=Elongation factor 3;         Short=EF-3;       52   4e-09
CFTR_ORNAN RecName: Full=Cystic fibrosis transmembrane conductan...    52   4e-09
CFTR_CERAE RecName: Full=Cystic fibrosis transmembrane conductan...    52   4e-09
CCMA_VIBCH RecName: Full=Cytochrome c biogenesis ATP-binding exp...    52   4e-09
CCMA_PHOPR RecName: Full=Cytochrome c biogenesis ATP-binding exp...    52   4e-09
CCMA_AGRT5 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    52   4e-09
ABCG5_MOUSE RecName: Full=ATP-binding cassette sub-family G memb...    52   4e-09
ABC2_SCHPO RecName: Full=ATP-binding cassette transporter abc2; ...    52   4e-09
AB4C_ARATH RecName: Full=ABC transporter C family member 4;     ...    52   4e-09
AB11I_ARATH RecName: Full=ABC transporter I family member 11, ch...    52   4e-09
YOJI_ECOLI RecName: Full=ABC transporter ATP-binding protein yojI;     52   6e-09
SSUB_SHIFL RecName: Full=Aliphatic sulfonates import ATP-binding...    52   6e-09
POTA_MYCPU RecName: Full=Spermidine/putrescine import ATP-bindin...    52   6e-09
MSBA_XYLFA RecName: Full=Lipid A export ATP-binding/permease pro...    52   6e-09
MSBA_NEIMA RecName: Full=Lipid A export ATP-binding/permease pro...    52   6e-09
CFTR_SAIBB RecName: Full=Cystic fibrosis transmembrane conductan...    52   6e-09
CFTR_PONAB RecName: Full=Cystic fibrosis transmembrane conductan...    52   6e-09
CFTR_MUSPF RecName: Full=Cystic fibrosis transmembrane conductan...    52   6e-09
CFTR_HUMAN RecName: Full=Cystic fibrosis transmembrane conductan...    52   6e-09
CFTR_GORGO RecName: Full=Cystic fibrosis transmembrane conductan...    52   6e-09
CFTR_DASNO RecName: Full=Cystic fibrosis transmembrane conductan...    52   6e-09
CFTR_CALMO RecName: Full=Cystic fibrosis transmembrane conductan...    52   6e-09
CFTR_ATEGE RecName: Full=Cystic fibrosis transmembrane conductan...    52   6e-09
CFTR_AOTNA RecName: Full=Cystic fibrosis transmembrane conductan...    52   6e-09
CCMA_ALCBS RecName: Full=Cytochrome c biogenesis ATP-binding exp...    52   6e-09
BTUD_ERWCT RecName: Full=Vitamin B12 import ATP-binding protein ...    52   6e-09
ABCCA_DICDI RecName: Full=ABC transporter C family member 10;Alt...    52   6e-09
ABCC9_HUMAN RecName: Full=ATP-binding cassette transporter sub-f...    52   6e-09
UVRA_UREPA RecName: Full=UvrABC system protein A;         Short=...    52   7e-09
PDR5_ORYSJ RecName: Full=Pleiotropic drug resistance protein 5;        52   7e-09
EXP8_STRPN RecName: Full=Putative ABC transporter ATP-binding pr...    52   7e-09
CFTR_LOXAF RecName: Full=Cystic fibrosis transmembrane conductan...    52   7e-09
CCMA_MARMM RecName: Full=Cytochrome c biogenesis ATP-binding exp...    52   7e-09
AMIE_STRR6 RecName: Full=Oligopeptide transport ATP-binding prot...    52   7e-09
AMIE_STRPN RecName: Full=Oligopeptide transport ATP-binding prot...    52   7e-09
ABCG5_DICDI RecName: Full=ABC transporter G family member 5;AltN...    52   7e-09
AB2F_ARATH RecName: Full=ABC transporter F family member 2;     ...    52   7e-09
AB17B_ARATH RecName: Full=ABC transporter B family member 17;   ...    52   7e-09
SSUB2_PARDP RecName: Full=Aliphatic sulfonates import ATP-bindin...    51   1e-08
PDR1_NICPL RecName: Full=Pleiotropic drug resistance protein 1;A...    51   1e-08
MRP5_RAT RecName: Full=Multidrug resistance-associated protein 5...    51   1e-08
MRP5_HUMAN RecName: Full=Multidrug resistance-associated protein...    51   1e-08
MODC_SALTY RecName: Full=Molybdenum import ATP-binding protein m...    51   1e-08
MODC_SALPA RecName: Full=Molybdenum import ATP-binding protein m...    51   1e-08
MODC_SALCH RecName: Full=Molybdenum import ATP-binding protein m...    51   1e-08
CFTR_PAPAN RecName: Full=Cystic fibrosis transmembrane conductan...    51   1e-08
CFTR_MICMU RecName: Full=Cystic fibrosis transmembrane conductan...    51   1e-08
CFTR_MACNE RecName: Full=Cystic fibrosis transmembrane conductan...    51   1e-08
CFTR_MACMU RecName: Full=Cystic fibrosis transmembrane conductan...    51   1e-08
CFTR_MACFU RecName: Full=Cystic fibrosis transmembrane conductan...    51   1e-08
CFTR_MACFA RecName: Full=Cystic fibrosis transmembrane conductan...    51   1e-08
CCMA_RHIME RecName: Full=Cytochrome c biogenesis ATP-binding exp...    51   1e-08
BROWN_DROVI RecName: Full=Protein brown;                               51   1e-08
ABCG6_DICDI RecName: Full=ABC transporter G family member 6;AltN...    51   1e-08
ABCF2_DICDI RecName: Full=ABC transporter F family member 2;           51   1e-08
AB5G_ARATH RecName: Full=ABC transporter G family member 5;     ...    51   1e-08
AB3G_ARATH RecName: Full=ABC transporter G family member 3;     ...    51   1e-08
AB39G_ARATH RecName: Full=ABC transporter G family member 39;   ...    51   1e-08
AB2E_ARATH RecName: Full=ABC transporter E family member 2;     ...    51   1e-08
YN99_YEAST RecName: Full=Uncharacterized ABC transporter ATP-bin...    51   1e-08
YKPA_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    51   1e-08
YHES_ECOLI RecName: Full=Uncharacterized ABC transporter ATP-bin...    51   1e-08
YHES_ECO57 RecName: Full=Uncharacterized ABC transporter ATP-bin...    51   1e-08
TLRC_STRFR RecName: Full=Tylosin resistance ATP-binding protein ...    51   1e-08
SAPF_HAEIN RecName: Full=Peptide transport system ATP-binding pr...    51   1e-08
PHNC_DECAR RecName: Full=Phosphonates import ATP-binding protein...    51   1e-08
MSBA_SHEFN RecName: Full=Lipid A export ATP-binding/permease pro...    51   1e-08
MDLA_BUCBP RecName: Full=Multidrug resistance-like ATP-binding p...    51   1e-08
HMUV_VIBVU RecName: Full=Hemin import ATP-binding protein hmuV; ...    51   1e-08
CCMA_WOLPM RecName: Full=Cytochrome c biogenesis ATP-binding exp...    51   1e-08
ABCC6_DICDI RecName: Full=ABC transporter C family member 6;AltN...    51   1e-08
UVRA_RICFE RecName: Full=UvrABC system protein A;         Short=...    50   2e-08
PSTB_STAS1 RecName: Full=Phosphate import ATP-binding protein ps...    50   2e-08
PHNC1_PSEAE RecName: Full=Phosphonates import ATP-binding protei...    50   2e-08
MSBA_PSEHT RecName: Full=Lipid A export ATP-binding/permease pro...    50   2e-08
MODC_SALTI RecName: Full=Molybdenum import ATP-binding protein m...    50   2e-08
YO075_YEAST RecName: Full=Uncharacterized ABC transporter ATP-bi...    50   2e-08
UVRA_THET8 RecName: Full=UvrABC system protein A;         Short=...    50   2e-08
PSTB_UREPA RecName: Full=Phosphate import ATP-binding protein ps...    50   2e-08
PHNC_FUSNN RecName: Full=Phosphonates import ATP-binding protein...    50   2e-08
PHNC1_PSEU2 RecName: Full=Phosphonates import ATP-binding protei...    50   2e-08
MSBA_BORPE RecName: Full=Lipid A export ATP-binding/permease pro...    50   2e-08
MSBA_BORPA RecName: Full=Lipid A export ATP-binding/permease pro...    50   2e-08
MSBA_BORBR RecName: Full=Lipid A export ATP-binding/permease pro...    50   2e-08
HRTA_STAAB RecName: Full=Putative hemin import ATP-binding prote...    50   2e-08
CFTR_RABIT RecName: Full=Cystic fibrosis transmembrane conductan...    50   2e-08
CFTR_PANTR RecName: Full=Cystic fibrosis transmembrane conductan...    50   2e-08
CFTR_COLGU RecName: Full=Cystic fibrosis transmembrane conductan...    50   2e-08
CCMA_PSEU2 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    50   2e-08
CCMA_LEGPH RecName: Full=Cytochrome c biogenesis ATP-binding exp...    50   2e-08
CCMA_LEGPA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    50   2e-08
ABCC1_DICDI RecName: Full=ABC transporter C family member 1;AltN...    50   2e-08
YOR1_YEAST RecName: Full=Oligomycin resistance ATP-dependent per...    50   3e-08
UVRA_RICCN RecName: Full=UvrABC system protein A;         Short=...    50   3e-08
THIQ_JANSC RecName: Full=Thiamine import ATP-binding protein thi...    50   3e-08
MSBA_MANSM RecName: Full=Lipid A export ATP-binding/permease pro...    50   3e-08
MSBA_DESPS RecName: Full=Lipid A export ATP-binding/permease pro...    50   3e-08
MRP5_MOUSE RecName: Full=Multidrug resistance-associated protein...    50   3e-08
MRP4_HUMAN RecName: Full=Multidrug resistance-associated protein...    50   3e-08
CFTR_MOUSE RecName: Full=Cystic fibrosis transmembrane conductan...    50   3e-08
CCMA_RHOP2 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    50   3e-08
CCMA_HAEIN RecName: Full=Cytochrome c biogenesis ATP-binding exp...    50   3e-08
CCMA_ERWCT RecName: Full=Cytochrome c biogenesis ATP-binding exp...    50   3e-08
ABCGG_DICDI RecName: Full=ABC transporter G family member 16;Alt...    50   3e-08
ABCC7_DICDI RecName: Full=ABC transporter C family member 7;AltN...    50   3e-08
AB10I_ARATH RecName: Full=ABC transporter I family member 10, ch...    50   3e-08
UVRA_MYCPE RecName: Full=UvrABC system protein A;         Short=...    49   4e-08
HRTA_STAAR RecName: Full=Putative hemin import ATP-binding prote...    49   4e-08
HMUV_PSEF5 RecName: Full=Hemin import ATP-binding protein hmuV; ...    49   4e-08
CYDC_ECOLI RecName: Full=ATP-binding/permease protein cydC;            49   4e-08
CFTR_BOVIN RecName: Full=Cystic fibrosis transmembrane conductan...    49   4e-08
CCMA_RICCN RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   4e-08
CCMA_RALEJ RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   4e-08
CCMA_LEGPL RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   4e-08
CCMA_GRABC RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   4e-08
YCFI_YEAST RecName: Full=Metal resistance protein YCF1;AltName: ...    49   5e-08
UVRA_RICBR RecName: Full=UvrABC system protein A;         Short=...    49   5e-08
UUP_BUCAI RecName: Full=ABC transporter ATP-binding protein uup;       49   5e-08
PHNC2_PSEAB RecName: Full=Phosphonates import ATP-binding protei...    49   5e-08
MRP3_MOUSE RecName: Full=Canalicular multispecific organic anion...    49   5e-08
MRP1_MOUSE RecName: Full=Multidrug resistance-associated protein...    49   5e-08
HRTA_STAAW RecName: Full=Putative hemin import ATP-binding prote...    49   5e-08
HRTA_STAAS RecName: Full=Putative hemin import ATP-binding prote...    49   5e-08
HRTA_STAAN RecName: Full=Putative hemin import ATP-binding prote...    49   5e-08
HRTA_STAAM RecName: Full=Putative hemin import ATP-binding prote...    49   5e-08
HRTA_STAAE RecName: Full=Putative hemin import ATP-binding prote...    49   5e-08
HRTA_STAAC RecName: Full=Putative hemin import ATP-binding prote...    49   5e-08
HRTA_STAA8 RecName: Full=Putative hemin import ATP-binding prote...    49   5e-08
HRTA_STAA3 RecName: Full=Putative hemin import ATP-binding prote...    49   5e-08
CFTR_PIG RecName: Full=Cystic fibrosis transmembrane conductance...    49   5e-08
CFTR_OTOGA RecName: Full=Cystic fibrosis transmembrane conductan...    49   5e-08
CFTR_MUNRE RecName: Full=Cystic fibrosis transmembrane conductan...    49   5e-08
CFTR_MUNMU RecName: Full=Cystic fibrosis transmembrane conductan...    49   5e-08
CFTR_HYLLE RecName: Full=Cystic fibrosis transmembrane conductan...    49   5e-08
CCMA_XANCP RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   5e-08
CCMA_XANC8 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   5e-08
CCMA_VIBF1 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   5e-08
CCMA_RICTY RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   5e-08
ABCG8_RAT RecName: Full=ATP-binding cassette sub-family G member...    49   5e-08
WHT3_CAEEL RecName: Full=ABC transporter ATP-binding protein/per...    49   6e-08
WHITE_ANOGA RecName: Full=Protein white;                               49   6e-08
PDR3_ORYSJ RecName: Full=Pleiotropic drug resistance protein 3;        49   6e-08
PDR3_ORYSI RecName: Full=Pleiotropic drug resistance protein 3;A...    49   6e-08
PDR1_SCHPO RecName: Full=ATP-binding cassette transporter pdr1; ...    49   6e-08
MRP3_RAT RecName: Full=Canalicular multispecific organic anion t...    49   6e-08
LAGD_LACLA RecName: Full=Lactococcin-G-processing and transport ...    49   6e-08
KPST1_ECOLX RecName: Full=Polysialic acid transport ATP-binding ...    49   6e-08
CCMA_LEGPN RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   6e-08
CCMA_HAEI8 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    49   6e-08
YCXD_CYAPA RecName: Full=Probable ABC transporter ATP-binding pr...    48   8e-08
Y318_BORBU RecName: Full=Uncharacterized ABC transporter ATP-bin...    48   8e-08
LOLD_BUCAI RecName: Full=Lipoprotein-releasing system ATP-bindin...    48   8e-08
EPIZ_STAEP RecName: Full=Uncharacterized protein in epiA 5'regio...    48   8e-08
EF3_PNECA RecName: Full=Elongation factor 3;         Short=EF-3;       48   8e-08
CCMA_BARHE RecName: Full=Cytochrome c biogenesis ATP-binding exp...    48   8e-08
ABCE1_MOUSE RecName: Full=ATP-binding cassette sub-family E memb...    48   8e-08
ABCE1_HUMAN RecName: Full=ATP-binding cassette sub-family E memb...    48   8e-08
ABC1_ENCCU RecName: Full=Probable ABC transporter ECU01_0200/ECU...    48   8e-08
Y685_MYCPN RecName: Full=Putative ABC transporter ATP-binding pr...    48   1e-07
Y303_MYCGE RecName: Full=Putative ABC transporter ATP-binding pr...    48   1e-07
UVRA_RHIME RecName: Full=UvrABC system protein A;         Short=...    48   1e-07
UVRA_MYCPU RecName: Full=UvrABC system protein A;         Short=...    48   1e-07
UVRA_MICLU RecName: Full=UvrABC system protein A;         Short=...    48   1e-07
SSUB2_PSEAB RecName: Full=Aliphatic sulfonates import ATP-bindin...    48   1e-07
SSUB1_PSEAE RecName: Full=Aliphatic sulfonates import ATP-bindin...    48   1e-07
MSBA_HAEDU RecName: Full=Lipid A export ATP-binding/permease pro...    48   1e-07
MRP9_HUMAN RecName: Full=Multidrug resistance-associated protein...    48   1e-07
MRP2_MOUSE RecName: Full=Canalicular multispecific organic anion...    48   1e-07
LOLD_NEIMB RecName: Full=Lipoprotein-releasing system ATP-bindin...    48   1e-07
LOLD_NEIMA RecName: Full=Lipoprotein-releasing system ATP-bindin...    48   1e-07
LOLD_BLOFL RecName: Full=Lipoprotein-releasing system ATP-bindin...    48   1e-07
CFTR_RHIFE RecName: Full=Cystic fibrosis transmembrane conductan...    48   1e-07
ABCCD_DICDI RecName: Full=ABC transporter C family member 13;Alt...    48   1e-07
ABCCC_DICDI RecName: Full=ABC transporter C family member 12;Alt...    48   1e-07
AB8G_ARATH RecName: Full=ABC transporter G family member 8;     ...    48   1e-07
Y354_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bin...    47   1e-07
MRP7_MOUSE RecName: Full=Multidrug resistance-associated protein...    47   1e-07
LCN3_LACLA RecName: Full=Lacticin-481/lactococcin-DR transport/p...    47   1e-07
HMUV_BORPE RecName: Full=Hemin import ATP-binding protein hmuV; ...    47   1e-07
CFTR_SHEEP RecName: Full=Cystic fibrosis transmembrane conductan...    47   1e-07
CFTR_ATEAB RecName: Full=Cystic fibrosis transmembrane conductan...    47   1e-07
CCMA_XANOR RecName: Full=Cytochrome c biogenesis ATP-binding exp...    47   1e-07
CCMA_XANOM RecName: Full=Cytochrome c biogenesis ATP-binding exp...    47   1e-07
UVRA_HELPJ RecName: Full=UvrABC system protein A;         Short=...    47   2e-07
PDR11_YEAST RecName: Full=ATP-dependent permease PDR11;                47   2e-07
MODC_PSEPK RecName: Full=Molybdenum import ATP-binding protein m...    47   2e-07
MCHF_ECOLX RecName: Full=Probable microcin-H47 secretion/process...    47   2e-07
CCMA_XANC5 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    47   2e-07
CCMA_RHOPS RecName: Full=Cytochrome c biogenesis ATP-binding exp...    47   2e-07
ABCX_ODOSI RecName: Full=Probable ATP-dependent transporter ycf16;     47   2e-07
AB6I_ARATH RecName: Full=ABC transporter I family member 6, chlo...    47   2e-07
AB2G_ARATH RecName: Full=ABC transporter G family member 2;     ...    47   2e-07
UVRA_RHILO RecName: Full=UvrABC system protein A;         Short=...    47   2e-07
UUP2_HAEIN RecName: Full=ABC transporter ATP-binding protein uup-2;    47   2e-07
SSUB1_FRAAA RecName: Full=Aliphatic sulfonates import ATP-bindin...    47   2e-07
MSBA_HAES1 RecName: Full=Lipid A export ATP-binding/permease pro...    47   2e-07
HRTA_STAS1 RecName: Full=Putative hemin import ATP-binding prote...    47   2e-07
CCMA_XANAC RecName: Full=Cytochrome c biogenesis ATP-binding exp...    47   2e-07
CCMA_NITWN RecName: Full=Cytochrome c biogenesis ATP-binding exp...    47   2e-07
CCMA_BRAJA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    47   2e-07
ABCF1_RAT RecName: Full=ATP-binding cassette sub-family F member...    47   2e-07
Y468A_MYCGE RecName: Full=Putative ABC transporter ATP-binding p...    46   3e-07
UVRA_RICTY RecName: Full=UvrABC system protein A;         Short=...    46   3e-07
UVRA_RICPR RecName: Full=UvrABC system protein A;         Short=...    46   3e-07
UVRA_PSEPK RecName: Full=UvrABC system protein A;         Short=...    46   3e-07
PDR1_ORYSJ RecName: Full=Probable pleiotropic drug resistance pr...    46   3e-07
EF3B_YEAST RecName: Full=Elongation factor 3B;         Short=EF-...    46   3e-07
CCMA_SILST RecName: Full=Cytochrome c biogenesis ATP-binding exp...    46   3e-07
CCMA_RICPR RecName: Full=Cytochrome c biogenesis ATP-binding exp...    46   3e-07
CCMA_METCA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    46   3e-07
CCMA_JANSC RecName: Full=Cytochrome c biogenesis ATP-binding exp...    46   3e-07
ABCX_ANTSP RecName: Full=Probable ATP-dependent transporter ycf16;     46   3e-07
YDIF_BACSU RecName: Full=Uncharacterized ABC transporter ATP-bin...    46   4e-07
Y664_HAEIN RecName: Full=Probable ABC transporter ATP-binding pr...    46   4e-07
UVRA_AGRT5 RecName: Full=UvrABC system protein A;         Short=...    46   4e-07
SSUB_MYCSS RecName: Full=Aliphatic sulfonates import ATP-binding...    46   4e-07
NIKE_PSEPK RecName: Full=Nickel import ATP-binding protein nikE;...    46   4e-07
EF3_ASHGO RecName: Full=Elongation factor 3;         Short=EF-3;       46   4e-07
CCMA_HAES1 RecName: Full=Cytochrome c biogenesis ATP-binding exp...    46   4e-07
ABCF1_PANTR RecName: Full=ATP-binding cassette sub-family F memb...    46   4e-07
ABCF1_HUMAN RecName: Full=ATP-binding cassette sub-family F memb...    46   4e-07
ABCC5_DICDI RecName: Full=ABC transporter C family member 5;AltN...    46   4e-07
AB3C_ARATH RecName: Full=ABC transporter C family member 3;     ...    46   4e-07
UVRA_STRCO RecName: Full=UvrABC system protein A;         Short=...    45   5e-07
UVRA_HELPY RecName: Full=UvrABC system protein A;         Short=...    45   5e-07
TAGH_STAAW RecName: Full=Teichoic acids export ATP-binding prote...    45   5e-07
TAGH_STAAU RecName: Full=Teichoic acids export ATP-binding prote...    45   5e-07
TAGH_STAAS RecName: Full=Teichoic acids export ATP-binding prote...    45   5e-07
TAGH_STAAN RecName: Full=Teichoic acids export ATP-binding prote...    45   5e-07
TAGH_STAAM RecName: Full=Teichoic acids export ATP-binding prote...    45   5e-07
TAGH_STAAC RecName: Full=Teichoic acids export ATP-binding prote...    45   5e-07
TAGH_STAAB RecName: Full=Teichoic acids export ATP-binding prote...    45   5e-07
TAGH_STAA8 RecName: Full=Teichoic acids export ATP-binding prote...    45   5e-07
TAGH_STAA3 RecName: Full=Teichoic acids export ATP-binding prote...    45   5e-07
CCMA_SODGM RecName: Full=Cytochrome c biogenesis ATP-binding exp...    45   5e-07
CCMA_HAHCH RecName: Full=Cytochrome c biogenesis ATP-binding exp...    45   5e-07
CCMA_BORPA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    45   5e-07
AUS1_YEAST RecName: Full=ATP-dependent permease AUS1;                  45   5e-07
ABCF1_PIG RecName: Full=ATP-binding cassette sub-family F member 1;    45   5e-07
WHITE_ANOAL RecName: Full=Protein white;                               45   7e-07
TAGH_STAAR RecName: Full=Teichoic acids export ATP-binding prote...    45   7e-07
PRTD_ERWCH RecName: Full=Proteases secretion ATP-binding protein...    45   7e-07
L259_DROME RecName: Full=Probable multidrug resistance-associate...    45   7e-07
HFAC_CAUCR RecName: Full=Holdfast attachment protein C;         ...    45   7e-07
CTRD_NEIMB RecName: Full=Capsule polysaccharide export ATP-bindi...    45   7e-07
CTRD_NEIMA RecName: Full=Capsule polysaccharide export ATP-bindi...    45   7e-07
CCMA_BORBR RecName: Full=Cytochrome c biogenesis ATP-binding exp...    45   7e-07
CCMA_BARQU RecName: Full=Cytochrome c biogenesis ATP-binding exp...    45   7e-07
ABCCB_HUMAN RecName: Full=ATP-binding cassette transporter sub-f...    45   7e-07
AB20G_ARATH RecName: Full=ABC transporter G family member 20;   ...    45   7e-07
UVRA_MYCPN RecName: Full=UvrABC system protein A;         Short=...    45   9e-07
UVRA_BRUSU RecName: Full=UvrABC system protein A;         Short=...    45   9e-07
UVRA_BRUME RecName: Full=UvrABC system protein A;         Short=...    45   9e-07
UVRA_BRUAB RecName: Full=UvrABC system protein A;         Short=...    45   9e-07
UVRA_BRUA2 RecName: Full=UvrABC system protein A;         Short=...    45   9e-07
PHNC1_RALEH RecName: Full=Phosphonates import ATP-binding protei...    45   9e-07
MSBA_SODGM RecName: Full=Lipid A export ATP-binding/permease pro...    45   9e-07
MSBA_BLOPB RecName: Full=Lipid A export ATP-binding/permease pro...    45   9e-07
MRP9_RAT RecName: Full=Multidrug resistance-associated protein 9...    45   9e-07
MODC_RHOFD RecName: Full=Molybdenum import ATP-binding protein m...    45   9e-07
EF3A_YEAST RecName: Full=Elongation factor 3A;         Short=EF-...    45   9e-07
CCMA_RHIET RecName: Full=Cytochrome c biogenesis ATP-binding exp...    45   9e-07
CCMA_RHIEC RecName: Full=Cytochrome c biogenesis ATP-binding exp...    45   9e-07
BTUD_YERPS RecName: Full=Vitamin B12 import ATP-binding protein ...    45   9e-07
BTUD_YERPE RecName: Full=Vitamin B12 import ATP-binding protein ...    45   9e-07
BTUD_YERE8 RecName: Full=Vitamin B12 import ATP-binding protein ...    45   9e-07
ABC1_SCHPO RecName: Full=ATP-binding cassette transporter abc1;        45   9e-07
YJQ1_SCHPO RecName: Full=Uncharacterized ABC transporter ATP-bin...    44   1e-06
Y2469_DEIRA RecName: Full=Putative ABC transporter ATP-binding p...    44   1e-06
UVRA_XANAC RecName: Full=UvrABC system protein A;         Short=...    44   1e-06
UVRA_VIBVY RecName: Full=UvrABC system protein A;         Short=...    44   1e-06
UVRA_VIBVU RecName: Full=UvrABC system protein A;         Short=...    44   1e-06
UVRA_BORBU RecName: Full=UvrABC system protein A;         Short=...    44   1e-06
SSUB2_NOCFA RecName: Full=Aliphatic sulfonates import ATP-bindin...    44   1e-06
GCN20_YEAST RecName: Full=Protein GCN20;                               44   1e-06
EF3_SCHPO RecName: Full=Elongation factor 3;         Short=EF-3;       44   1e-06
Y742_STRCO RecName: Full=Uncharacterized ABC transporter ATP-bin...    44   2e-06
UVRA_XANCP RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_STAES RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_STAEQ RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_SHIFL RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_ECOLI RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_ECOL6 RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_ECO57 RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_BACSU RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
SUNT_BPSPC RecName: Full=Sublancin-168-processing and transport ...    44   2e-06
SUNT_BACSU RecName: Full=SPBc2 prophage-derived sublancin-168-pr...    44   2e-06
PHNC1_PSE14 RecName: Full=Phosphonates import ATP-binding protei...    44   2e-06
NFT1_YEAST RecName: Full=ABC transporter NFT1;AltName: Full=New ...    44   2e-06
MRP9_MOUSE RecName: Full=Multidrug resistance-associated protein...    44   2e-06
LOLD_DESVH RecName: Full=Lipoprotein-releasing system ATP-bindin...    44   2e-06
CCMA_PASMU RecName: Full=Cytochrome c biogenesis ATP-binding exp...    44   2e-06
CCMA_NITEU RecName: Full=Cytochrome c biogenesis ATP-binding exp...    44   2e-06
ABCG3_MOUSE RecName: Full=ATP-binding cassette sub-family G memb...    44   2e-06
ABC4_SCHPO RecName: Full=ATP-binding cassette transporter abc4; ...    44   2e-06
AB6G_ARATH RecName: Full=ABC transporter G family member 6;     ...    44   2e-06
UVRA_STAAW RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_STAAS RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_STAAR RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_STAAN RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_STAAM RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_STAAC RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_LEPIN RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_LEPIC RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_HAEDU RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
UVRA_DEIRA RecName: Full=UvrABC system protein A;         Short=...    44   2e-06
MSBA_PHOLL RecName: Full=Lipid A export ATP-binding/permease pro...    44   2e-06
MSBA_ERWCT RecName: Full=Lipid A export ATP-binding/permease pro...    44   2e-06
MSBA_BLOFL RecName: Full=Lipid A export ATP-binding/permease pro...    44   2e-06
MRP1_MACFA RecName: Full=Multidrug resistance-associated protein...    44   2e-06
Y036_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bin...    43   3e-06
UVRA_MYCGE RecName: Full=UvrABC system protein A;         Short=...    43   3e-06
UVRA_METTH RecName: Full=UvrABC system protein A;         Short=...    43   3e-06
MRP1_HUMAN RecName: Full=Multidrug resistance-associated protein...    43   3e-06
CYDD_HAEIN RecName: Full=ATP-binding/permease protein cydD;            43   3e-06
CFTR_CARPS RecName: Full=Cystic fibrosis transmembrane conductan...    43   3e-06
ABCC8_CRICR RecName: Full=ATP-binding cassette transporter sub-f...    43   3e-06
AB2D_ARATH RecName: Full=ABC transporter D family member 2, chlo...    43   3e-06
AB28B_ARATH RecName: Full=ABC transporter B family member 28;   ...    43   3e-06
AB1D_ARATH RecName: Full=ABC transporter D family member 1;     ...    43   3e-06
UVRA_VIBCH RecName: Full=UvrABC system protein A;         Short=...    43   3e-06
NEW1_YEAST RecName: Full=[NU+] prion formation protein 1;              43   3e-06
DPPD_SHIFL RecName: Full=Dipeptide transport ATP-binding protein...    43   3e-06
DPPD_ECOLI RecName: Full=Dipeptide transport ATP-binding protein...    43   3e-06
DPPD_ECO57 RecName: Full=Dipeptide transport ATP-binding protein...    43   3e-06
CYDC_BACSU RecName: Full=ATP-binding/permease protein cydC;            43   3e-06
CVAB_ECOLX RecName: Full=Colicin V secretion/processing ATP-bind...    43   3e-06
CCMA_RALEH RecName: Full=Cytochrome c biogenesis ATP-binding exp...    43   3e-06
BPT1_YEAST RecName: Full=Bile pigment transporter 1;                   43   3e-06
ABCC9_DICDI RecName: Full=ABC transporter C family member 9;AltN...    43   3e-06
ABCC8_HUMAN RecName: Full=ATP-binding cassette transporter sub-f...    43   3e-06
ABCC2_DICDI RecName: Full=ABC transporter C family member 2;AltN...    43   3e-06
AB1I_ARATH RecName: Full=ABC transporter I family member 1;     ...    43   3e-06
UVRA_VIBPA RecName: Full=UvrABC system protein A;         Short=...    42   4e-06
UVRA_SALTY RecName: Full=UvrABC system protein A;         Short=...    42   4e-06
UVRA_SALTI RecName: Full=UvrABC system protein A;         Short=...    42   4e-06
HMUV_RHOSR RecName: Full=Hemin import ATP-binding protein hmuV; ...    42   4e-06
CCMA_RICFE RecName: Full=Cytochrome c biogenesis ATP-binding exp...    42   4e-06
Y182_SYNY3 RecName: Full=Uncharacterized ABC transporter ATP-bin...    42   6e-06
UVRA_ZYMMO RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_VITST RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_TREPA RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_STRAW RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_NEIMB RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_NEIMA RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_NEIGO RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_MYCLE RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_LACLA RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_CLOAB RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
UVRA_BACHD RecName: Full=UvrABC system protein A;         Short=...    42   6e-06
MRP1_CHICK RecName: Full=Multidrug resistance-associated protein...    42   6e-06
CCMA_MAGSA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    42   6e-06
AB22G_ARATH RecName: Full=ABC transporter G family member 22;   ...    42   6e-06
Y1252_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bi...    42   8e-06
UVRA_XYLFT RecName: Full=UvrABC system protein A;         Short=...    42   8e-06
UVRA_XYLFA RecName: Full=UvrABC system protein A;         Short=...    42   8e-06
UVRA_PSEAE RecName: Full=UvrABC system protein A;         Short=...    42   8e-06
P29_MYCHR RecName: Full=Probable ABC transporter ATP-binding pro...    42   8e-06
MSBA_YERPS RecName: Full=Lipid A export ATP-binding/permease pro...    42   8e-06
MSBA_YERPN RecName: Full=Lipid A export ATP-binding/permease pro...    42   8e-06
MSBA_YERPE RecName: Full=Lipid A export ATP-binding/permease pro...    42   8e-06
MSBA_YERPA RecName: Full=Lipid A export ATP-binding/permease pro...    42   8e-06
HMUV_STRCO RecName: Full=Hemin import ATP-binding protein hmuV; ...    42   8e-06
ABCC8_RAT RecName: Full=ATP-binding cassette transporter sub-fam...    42   8e-06
Y658_HAEIN RecName: Full=Uncharacterized ABC transporter ATP-bin...    41   1e-05
UVRA_MYCTU RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
UVRA_MYCBO RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
UVRA_LACPL RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
BEXA_HAEIN RecName: Full=ATP-binding protein bexA;                     41   1e-05
APRD_PSEAE RecName: Full=Alkaline protease secretion ATP-binding...    41   1e-05
AB2C_ARATH RecName: Full=ABC transporter C family member 2;     ...    41   1e-05
AB10C_ARATH RecName: Full=ABC transporter C family member 10;   ...    41   1e-05
UVRA_YERPE RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
UVRA_STRP8 RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
UVRA_STRP6 RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
UVRA_STRP3 RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
UVRA_STRP1 RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
UVRA_LISIN RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
UVRA_CLOPE RecName: Full=UvrABC system protein A;         Short=...    41   1e-05
CFTR_SQUAC RecName: Full=Cystic fibrosis transmembrane conductan...    41   1e-05
CCMA_SHIDS RecName: Full=Cytochrome c biogenesis ATP-binding exp...    41   1e-05
ZNUC_BUCAP RecName: Full=Zinc import ATP-binding protein znuC;  ...    40   2e-05
UVRA_STRR6 RecName: Full=UvrABC system protein A;         Short=...    40   2e-05
UVRA_STRPN RecName: Full=UvrABC system protein A;         Short=...    40   2e-05
UVRA_OCEIH RecName: Full=UvrABC system protein A;         Short=...    40   2e-05
MSBA_SHISS RecName: Full=Lipid A export ATP-binding/permease pro...    40   2e-05
MSBA_SHIFL RecName: Full=Lipid A export ATP-binding/permease pro...    40   2e-05
MSBA_SHIDS RecName: Full=Lipid A export ATP-binding/permease pro...    40   2e-05
MSBA_SHIBS RecName: Full=Lipid A export ATP-binding/permease pro...    40   2e-05
MSBA_ECOUT RecName: Full=Lipid A export ATP-binding/permease pro...    40   2e-05
MSBA_ECOLI RecName: Full=Lipid A export ATP-binding/permease pro...    40   2e-05
MSBA_ECOL6 RecName: Full=Lipid A export ATP-binding/permease pro...    40   2e-05
MSBA_ECOL5 RecName: Full=Lipid A export ATP-binding/permease pro...    40   2e-05
MSBA_ECO57 RecName: Full=Lipid A export ATP-binding/permease pro...    40   2e-05
MDR_PLAFF RecName: Full=Multidrug resistance protein;         EC...    40   2e-05
UVRA_SYNY3 RecName: Full=UvrABC system protein A;         Short=...    40   2e-05
UVRA_STRMU RecName: Full=UvrABC system protein A;         Short=...    40   2e-05
CCMA2_PSEAE RecName: Full=Cytochrome c biogenesis ATP-binding ex...    40   2e-05
CCMA1_RALME RecName: Full=Cytochrome c biogenesis ATP-binding ex...    40   2e-05
ABCD2_RAT RecName: Full=ATP-binding cassette sub-family D member...    40   2e-05
AB12C_ARATH RecName: Full=ABC transporter C family member 12;   ...    40   2e-05
UVRA_LISMO RecName: Full=UvrABC system protein A;         Short=...    40   3e-05
UVRA_CLOTE RecName: Full=UvrABC system protein A;         Short=...    40   3e-05
MSBA_SALTY RecName: Full=Lipid A export ATP-binding/permease pro...    40   3e-05
MSBA_SALTI RecName: Full=Lipid A export ATP-binding/permease pro...    40   3e-05
MSBA_SALPA RecName: Full=Lipid A export ATP-binding/permease pro...    40   3e-05
MSBA_SALCH RecName: Full=Lipid A export ATP-binding/permease pro...    40   3e-05
MRP1_BOVIN RecName: Full=Multidrug resistance-associated protein...    40   3e-05
MODC_ALCBS RecName: Full=Molybdenum import ATP-binding protein m...    40   3e-05
ABCD2_MOUSE RecName: Full=ATP-binding cassette sub-family D memb...    40   3e-05
ABCD2_HUMAN RecName: Full=ATP-binding cassette sub-family D memb...    40   3e-05
ABCC3_DICDI RecName: Full=ABC transporter C family member 3;AltN...    40   3e-05
AB1C_ARATH RecName: Full=ABC transporter C family member 1;     ...    40   3e-05
Y2353_MYCBO RecName: Full=Uncharacterized ABC transporter ATP-bi...    39   4e-05
Y2326_MYCTU RecName: Full=Uncharacterized ABC transporter ATP-bi...    39   4e-05
PDR15_ORYSJ RecName: Full=Pleiotropic drug resistance protein 15;      39   4e-05
MSRA_STAEP RecName: Full=Erythromycin resistance ATP-binding pro...    39   4e-05
MSBA_WIGBR RecName: Full=Lipid A export ATP-binding/permease pro...    39   4e-05
CCMA_DECAR RecName: Full=Cytochrome c biogenesis ATP-binding exp...    39   4e-05
UVRA_LISMF RecName: Full=UvrABC system protein A;         Short=...    39   5e-05
UVRA_HAEIN RecName: Full=UvrABC system protein A;         Short=...    39   5e-05
UVRA_PASMU RecName: Full=UvrABC system protein A;         Short=...    39   6e-05
UUP_BUCAP RecName: Full=ABC transporter ATP-binding protein uup;       39   6e-05
AB29B_ARATH RecName: Full=ABC transporter B family member 29;   ...    39   6e-05
ABCF3_MOUSE RecName: Full=ATP-binding cassette sub-family F memb...    38   8e-05
YMEB_LACLA RecName: Full=Uncharacterized ABC transporter ATP-bin...    38   1e-04
MRP1_CANFA RecName: Full=Multidrug resistance-associated protein...    38   1e-04
CCMA_NITHX RecName: Full=Cytochrome c biogenesis ATP-binding exp...    38   1e-04
AB15C_ARATH RecName: Full=Putative ABC transporter C family memb...    38   1e-04
AB11C_ARATH RecName: Full=ABC transporter C family member 11;   ...    38   1e-04
PHNC1_PSESM RecName: Full=Phosphonates import ATP-binding protei...    37   1e-04
KPST5_ECOLX RecName: Full=Polysialic acid transport ATP-binding ...    37   2e-04
CHVD_RHIRD RecName: Full=ATP-binding protein chvD;Flags: Fragment;     37   2e-04
MODC1_BRAJA RecName: Full=Molybdenum import ATP-binding protein ...    37   2e-04
ABCD1_MOUSE RecName: Full=ATP-binding cassette sub-family D memb...    37   2e-04
ABCD1_HUMAN RecName: Full=ATP-binding cassette sub-family D memb...    37   2e-04
ABCC8_DICDI RecName: Full=ABC transporter C family member 8;AltN...    37   2e-04
TAGC_DICDI RecName: Full=Prestalk-specific protein tagC;        ...    36   3e-04
MRP1_RAT RecName: Full=Multidrug resistance-associated protein 1...    36   3e-04
CCMA_HYPNA RecName: Full=Cytochrome c biogenesis ATP-binding exp...    36   3e-04
YB89_SCHPO RecName: Full=Uncharacterized ABC transporter ATP-bin...    36   4e-04
CCMA_HAEDU RecName: Full=Cytochrome c biogenesis ATP-binding exp...    36   4e-04
UVRA_BRAJA RecName: Full=UvrABC system protein A;         Short=...    35   5e-04
CCMA_RHOFD RecName: Full=Cytochrome c biogenesis ATP-binding exp...    35   5e-04
CCMA_NITOC RecName: Full=Cytochrome c biogenesis ATP-binding exp...    35   5e-04
ABCD3_RAT RecName: Full=ATP-binding cassette sub-family D member...    35   5e-04
ABCCF_DICDI RecName: Full=ABC transporter C family member 15;Alt...    35   5e-04
UVRA_PARDE RecName: Full=UvrABC system protein A;         Short=...    35   7e-04
PLSB_PSEAE RecName: Full=Glycerol-3-phosphate acyltransferase;  ...    35   7e-04
PLSB_PSEA8 RecName: Full=Glycerol-3-phosphate acyltransferase;  ...    35   7e-04
PLSB_PSEA7 RecName: Full=Glycerol-3-phosphate acyltransferase;  ...    35   7e-04
AB9C_ARATH RecName: Full=ABC transporter C family member 9;     ...    35   7e-04
YD061_YEAST RecName: Full=Uncharacterized ABC transporter ATP-bi...    35   0.001
Y121_METJA RecName: Full=Uncharacterized ABC transporter ATP-bin...    35   0.001
PXA2_YEAST RecName: Full=Peroxisomal long-chain fatty acid impor...    35   0.001
PLSB_PSEAB RecName: Full=Glycerol-3-phosphate acyltransferase;  ...    35   0.001
AB6C_ARATH RecName: Full=ABC transporter C family member 6;     ...    35   0.001

>BRAF_PSEAE RecName: Full=High-affinity branched-chain amino acid
           transport ATP-binding protein braF;
          Length = 255

 Score =  250 bits (639), Expect = 8e-69
 Identities = 123/251 (49%), Positives = 175/251 (69%), Gaps = 1/251 (0%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+S L+  FGG+LAV  V+  V++  V S+IGPNGAGKTT+FN +TG Y P  G IRL
Sbjct: 5   ILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRL 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE + GL  H++ARKG+ RTFQN+++   MTA+EN++V  H  L+ N +  + + P+ R
Sbjct: 65  DGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFR 124

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R++    E+AA  +  V L  + N  A  ++YG  +RLEIAR +  +PRIL LDEPAAG 
Sbjct: 125 RSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGL 184

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           NPKET ++  L+ K+ ++  +TV+L+EHDMK+VM+ISD I+V+N G  L +G+   +RDN
Sbjct: 185 NPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRDN 244

Query: 242 PEVIAAYLGTA 252
           P+VI AYLG A
Sbjct: 245 PDVIKAYLGEA 255


>LIVG_SALTY RecName: Full=High-affinity branched-chain amino acid
           transport ATP-binding protein livG;AltName: Full=LIV-I
           protein G;
          Length = 255

 Score =  230 bits (586), Expect = 1e-62
 Identities = 118/251 (47%), Positives = 165/251 (65%), Gaps = 1/251 (0%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL ++ L   FGG+LAV NVS  + +  + S+IGPNGAGKTT+FN +TG Y P  G I L
Sbjct: 5   LLAVNGLMMRFGGLLAVNNVSLELREREIVSLIGPNGAGKTTVFNCLTGFYKPTGGTITL 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
               + GL   Q+AR G+ RTFQ++++   MT IEN++V  H  L   L   +L+ P+ R
Sbjct: 65  RERHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPAFR 124

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           RA +   + AA  +  +GL  + N +AS ++YG  +RLEIAR +  +P IL LDEPAAG 
Sbjct: 125 RAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGL 184

Query: 183 NPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           NPKET E+D L+ ++ +    T++L+EHDMK+VM ISDRI V+N G  L  G+  ++R+N
Sbjct: 185 NPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEEIRNN 244

Query: 242 PEVIAAYLGTA 252
           P+VI AYLG A
Sbjct: 245 PDVIRAYLGEA 255


>LIVG_SALTI RecName: Full=High-affinity branched-chain amino acid
           transport ATP-binding protein livG;AltName: Full=LIV-I
           protein G;
          Length = 255

 Score =  230 bits (586), Expect = 1e-62
 Identities = 118/251 (47%), Positives = 165/251 (65%), Gaps = 1/251 (0%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL ++ L   FGG+LAV NVS  + +  + S+IGPNGAGKTT+FN +TG Y P  G I L
Sbjct: 5   LLAVNGLMMRFGGLLAVNNVSLELREREIVSLIGPNGAGKTTVFNCLTGFYKPTGGTITL 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
               + GL   Q+AR G+ RTFQ++++   MT IEN++V  H  L   L   +L+ P+ R
Sbjct: 65  RERHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPAFR 124

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           RA +   + AA  +  +GL  + N +AS ++YG  +RLEIAR +  +P IL LDEPAAG 
Sbjct: 125 RAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGL 184

Query: 183 NPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           NPKET E+D L+ ++ +    T++L+EHDMK+VM ISDRI V+N G  L  G+  ++R+N
Sbjct: 185 NPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEEIRNN 244

Query: 242 PEVIAAYLGTA 252
           P+VI AYLG A
Sbjct: 245 PDVIRAYLGEA 255


>LIVG_SHIFL RecName: Full=High-affinity branched-chain amino acid
           transport ATP-binding protein livG;AltName: Full=LIV-I
           protein G;
          Length = 255

 Score =  229 bits (583), Expect = 3e-62
 Identities = 118/251 (47%), Positives = 164/251 (65%), Gaps = 1/251 (0%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL ++ L   FGG+LAV NV+  +    + S+IGPNGAGKTT+FN +TG Y P  G I L
Sbjct: 5   LLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILL 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             + + GL   Q+AR G+ RTFQ++++   MT IEN++V  H  L   L   +L+ PS R
Sbjct: 65  RDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSFR 124

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           RA +   + AA  +  +GL  + N +AS ++YG  +RLEIAR +  +P IL LDEPAAG 
Sbjct: 125 RAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGL 184

Query: 183 NPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           NPKET E+D L+ ++ +    T++L+EHDMK+VM ISDRI V+N G  L  G+   +R+N
Sbjct: 185 NPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIRNN 244

Query: 242 PEVIAAYLGTA 252
           P+VI AYLG A
Sbjct: 245 PDVIRAYLGEA 255


>LIVG_ECOLI RecName: Full=High-affinity branched-chain amino acid
           transport ATP-binding protein livG;AltName: Full=LIV-I
           protein G;
          Length = 255

 Score =  229 bits (583), Expect = 3e-62
 Identities = 118/251 (47%), Positives = 164/251 (65%), Gaps = 1/251 (0%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL ++ L   FGG+LAV NV+  +    + S+IGPNGAGKTT+FN +TG Y P  G I L
Sbjct: 5   LLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILL 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             + + GL   Q+AR G+ RTFQ++++   MT IEN++V  H  L   L   +L+ PS R
Sbjct: 65  RDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSFR 124

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           RA +   + AA  +  +GL  + N +AS ++YG  +RLEIAR +  +P IL LDEPAAG 
Sbjct: 125 RAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGL 184

Query: 183 NPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           NPKET E+D L+ ++ +    T++L+EHDMK+VM ISDRI V+N G  L  G+   +R+N
Sbjct: 185 NPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIRNN 244

Query: 242 PEVIAAYLGTA 252
           P+VI AYLG A
Sbjct: 245 PDVIRAYLGEA 255


>LIVG_ECO57 RecName: Full=High-affinity branched-chain amino acid
           transport ATP-binding protein livG;AltName: Full=LIV-I
           protein G;
          Length = 255

 Score =  229 bits (583), Expect = 3e-62
 Identities = 118/251 (47%), Positives = 164/251 (65%), Gaps = 1/251 (0%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL ++ L   FGG+LAV NV+  +    + S+IGPNGAGKTT+FN +TG Y P  G I L
Sbjct: 5   LLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILL 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             + + GL   Q+AR G+ RTFQ++++   MT IEN++V  H  L   L   +L+ PS R
Sbjct: 65  RDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSFR 124

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           RA +   + AA  +  +GL  + N +AS ++YG  +RLEIAR +  +P IL LDEPAAG 
Sbjct: 125 RAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGL 184

Query: 183 NPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           NPKET E+D L+ ++ +    T++L+EHDMK+VM ISDRI V+N G  L  G+   +R+N
Sbjct: 185 NPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIRNN 244

Query: 242 PEVIAAYLGTA 252
           P+VI AYLG A
Sbjct: 245 PDVIRAYLGEA 255


>LIVG_ARCFU RecName: Full=Probable branched-chain amino acid
           transport ATP-binding protein livG;
          Length = 257

 Score =  151 bits (381), Expect = 7e-39
 Identities = 83/250 (33%), Positives = 145/250 (58%), Gaps = 3/250 (1%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           M +L+  +LSK F G+ A+  V+  V++G +  VIGPNG+GKTT  N ++G Y   +G++
Sbjct: 1   MKILQTQNLSKFFDGLKALNRVNIGVEKGSITLVIGPNGSGKTTFINTVSGFYRADEGKV 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              G+ ++   PH+++R G+ RTFQ  Q    MT +EN+++      +R       R+  
Sbjct: 61  FFEGKDITNKPPHEISRLGIVRTFQIPQPLKKMTVLENLLIAPEGYGERIFHSVSGRW-- 118

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           L+  + ++ E A  ++ ++ L+   +SEA  +S G LK LE+ARA+    ++L +DEP A
Sbjct: 119 LKEEEEIV-EKAFRILEFLKLDHLWDSEAQNLSGGQLKLLEVARAMMKDAKLLIMDEPIA 177

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           G NP  +  +     ++   G++ ++VEH + +V+  +D I V+  G  + EG   D+ +
Sbjct: 178 GVNPVLSHSMLERFVELKKMGVSFLIVEHRLDIVLKYTDHIYVMANGSVIAEGKEEDILN 237

Query: 241 NPEVIAAYLG 250
           NP+V+  YLG
Sbjct: 238 NPKVVEVYLG 247


>RBSA1_THEMA RecName: Full=Ribose import ATP-binding protein rbsA 1;
                   EC=3.6.3.17;
          Length = 520

 Score =  137 bits (345), Expect = 1e-34
 Identities = 79/232 (34%), Positives = 126/232 (54%), Gaps = 6/232 (2%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           M +L+   + K F GV+AV NV F V +  + S+IG NGAGK+TL  ++TG+  P  GEI
Sbjct: 12  MEILKAKGIVKRFPGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEI 71

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            + GE V   +P    +KG+    Q L +C NMT  EN+       L    V+   R  S
Sbjct: 72  LVNGERVEFHSPVDAFKKGISVIHQELNLCDNMTVAENIF------LAYEAVRGQKRTLS 125

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
            R  +  +   + EL+  +G +   ++    ++    + +EI +AL  +PRI+F+DEP +
Sbjct: 126 SRVDENYMYTRSKELLDLIGAKFSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTS 185

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
               +ET  +  ++  +   GI+VV V H +  VM ISDRI+V+  G+++ E
Sbjct: 186 SLTVEETERLFEIIEMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGE 237



 Score = 77.0 bits (188), Expect = 2e-16
 Identities = 63/231 (27%), Positives = 105/231 (45%), Gaps = 23/231 (9%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V+NVSF V +G V    G  GAG+T    L+ G+     G+I + G  V    P    + 
Sbjct: 284 VKNVSFEVRKGEVLGFAGLVGAGRTETMLLVFGVNQKESGDIYVNGRKVEIKNPEDAIKM 343

Query: 79  GMG-----RTFQNLQICMNMTAIENVMVGGHLSLDR-NLVKSMLRFPSLRRADAVLREHA 132
           G+G     R  Q L   + MT  +N+++     + R  LV         R+ + +  ++ 
Sbjct: 344 GIGLIPEDRKLQGL--VLRMTVKDNIVLPSLKKISRWGLVLDE------RKEEEISEDYV 395

Query: 133 AELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDN 192
             L +       +    S    G  +++ +A+ LA    IL  DEP  G +    AEI  
Sbjct: 396 KRLSIKTPSIYQITENLSG---GNQQKVVLAKWLATNADILIFDEPTRGIDVGAKAEIHR 452

Query: 193 LVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           ++R++A  G  V+++  ++  ++N+SDRI+V      + EG    V DN E
Sbjct: 453 MIRELAAQGKAVIMISSELPEILNLSDRIVV------MWEGEITAVLDNRE 497


>LIVG_METJA RecName: Full=Probable branched-chain amino acid
           transport ATP-binding protein livG;
          Length = 257

 Score =  135 bits (340), Expect = 4e-34
 Identities = 79/254 (31%), Positives = 143/254 (56%), Gaps = 6/254 (2%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           M +L   ++ K FG   A+  VS SV++G V  +IGPNG+GK+TL N+ITG     +G +
Sbjct: 5   MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRV 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
               + ++   P +L   G+ RTFQ  Q    MT +EN+++ G ++   + + S+     
Sbjct: 65  YFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLI-GEINPGESPLNSLFYKKW 123

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + + ++ E A +++ ++ L    + +A  +S G +K +EI RAL   P+++ +DEP A
Sbjct: 124 IPKEEEMV-EKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIA 182

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG----SAR 236
           G  P    +I N V ++   GIT +++EH + +V+N  D + V+  G+ + EG      +
Sbjct: 183 GVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIK 242

Query: 237 DVRDNPEVIAAYLG 250
           +V  +P+V+  Y+G
Sbjct: 243 NVLSDPKVVEIYIG 256


>LPTB_HAEIN RecName: Full=Lipopolysaccharide export system
           ATP-binding protein lptB;         EC=3.6.3.-;
          Length = 241

 Score =  130 bits (328), Expect = 1e-32
 Identities = 76/250 (30%), Positives = 137/250 (54%), Gaps = 14/250 (5%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           M++L   +L+K++     V +VS +V+   +  ++GPNGAGKTT F ++ G+     G+I
Sbjct: 1   MSILTAENLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKI 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            + GE +S L  H  A++G+G   Q   I   +T  EN+M    L + ++L       P 
Sbjct: 61  VIDGEDISLLPMHNRAQRGIGYLPQEASIFRRLTVYENLMAV--LEIRKDLT------PQ 112

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
            RR      E A EL+    +    ++   A+S G  +R+EIARALAA P+ + LDEP A
Sbjct: 113 QRR------EKADELIEEFNISHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFA 166

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           G +P   ++I  ++  + + G+ V++ +H+++  +++ +R  ++  G+ +  G+   V +
Sbjct: 167 GVDPISVSDIKKIITDLRNRGLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEQVMN 226

Query: 241 NPEVIAAYLG 250
           + +V   YLG
Sbjct: 227 DEQVKRVYLG 236


>RBSA2_PASMU RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 519

 Score =  128 bits (322), Expect = 5e-32
 Identities = 74/252 (29%), Positives = 132/252 (52%), Gaps = 21/252 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+  ++K FG   A+Q+V  S+ +G +++++G NGAGK+TL  ++ G YT   GEI +
Sbjct: 28  LLEMKGIAKRFGTFYALQDVDLSIYRGEIHALMGENGAGKSTLMKILAGAYTASAGEILI 87

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHL----SLDRNLVKSMLRF 118
            GE     +P    + G+   +Q + +  N+T  EN+ +G  +     LDR         
Sbjct: 88  DGEPFPISSPKDAIKAGITLIYQEIHLSPNLTVAENIFLGCEIKTLFGLDRK-------- 139

Query: 119 PSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
                    + E + +++  +G +     + S+++    +++EIARAL  K RIL +DEP
Sbjct: 140 --------TMAEESQKVLDRLGAQFLATQKVSSLTIAEQQQVEIARALYRKSRILVMDEP 191

Query: 179 AAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
            A  + +ET  +  LV+K+ D G+ ++ + H M  +  ++DR+ VL  G K      RD 
Sbjct: 192 TAALSSRETERLFALVKKLRDEGMAIIYISHRMAEIYELADRVSVLRDG-KYVGSLTRDN 250

Query: 239 RDNPEVIAAYLG 250
            D+  ++   +G
Sbjct: 251 LDSATLVQMMVG 262



 Score = 63.5 bits (153), Expect = 2e-12
 Identities = 52/237 (21%), Positives = 109/237 (45%), Gaps = 22/237 (9%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           +++ S  V  G +  + G  GAG++ L +L+ G+     G+I L G  +S  +P +    
Sbjct: 292 LKDASLVVRAGEIVGLSGLVGAGRSELAHLLFGVKRATKGKIYLSGGEISFSSPREA--- 348

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADA-VLREHAAELMV 137
                     I  ++  +        L LD N++K++      R A   V+ ++  +   
Sbjct: 349 ----------IAHHVALLPENRKEEGLFLDLNILKNVTMATLERDATMLVIDQNKGKQTT 398

Query: 138 YVGLEAY------LNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEID 191
              +E         N   S +S G  +++ ++R  A +P++  +DEP  G +    +EI 
Sbjct: 399 QAAIEGLKMRVPSANVNVSGLSGGNQQKVLLSRWAAIEPKLFIMDEPTRGVDVGAKSEIY 458

Query: 192 NLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAY 248
            ++ ++A  G+ ++++  ++  ++ +SDR+ V+  G  + E    D+  N E I A+
Sbjct: 459 RMMIEMAKKGVAILMISSELPEIVGMSDRVYVMREGYTVGELEGDDI--NQERIMAF 513


>METN1_BURPS RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 344

 Score =  128 bits (321), Expect = 6e-32
 Identities = 84/257 (32%), Positives = 145/257 (56%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++EI +LS+ F G    + A+ NV+ ++ QG V+ +IG +GAGK+TL   I  +  P +G
Sbjct: 1   MIEIRNLSQRFEGPRGWIEALHNVNLTIPQGEVFGIIGRSGAGKSTLVRTINLLTRPSEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG  ++ L+  +L  AR+ +G  FQ+  +  + T  +NV +              L
Sbjct: 61  SVFVGGRDLTQLSAAELRGARRDIGMIFQHFNLLSSRTVFDNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               ++RA   +      L+  VGL A  +   + +S G  +R+ IARALA+KP++L  D
Sbjct: 108 ELAGVKRAQ--IEATVLPLLDLVGLAAQKDRYPAQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+R+I  + G+T+VL+ H M+++ ++ DR+ VL+ GR + EG+ 
Sbjct: 166 EATSALDPETTRAILDLLRRINRELGLTIVLITHQMEVIKDVCDRVAVLDAGRVVEEGNV 225

Query: 236 RDV--RDNPEVIAAYLG 250
            DV  R + EV  A +G
Sbjct: 226 IDVFMRPHHEVTRALIG 242


>METN1_BURP1 RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 344

 Score =  128 bits (321), Expect = 6e-32
 Identities = 84/257 (32%), Positives = 145/257 (56%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++EI +LS+ F G    + A+ NV+ ++ QG V+ +IG +GAGK+TL   I  +  P +G
Sbjct: 1   MIEIRNLSQRFEGPRGWIEALHNVNLTIPQGEVFGIIGRSGAGKSTLVRTINLLTRPSEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG  ++ L+  +L  AR+ +G  FQ+  +  + T  +NV +              L
Sbjct: 61  SVFVGGRDLTQLSAAELRGARRDIGMIFQHFNLLSSRTVFDNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               ++RA   +      L+  VGL A  +   + +S G  +R+ IARALA+KP++L  D
Sbjct: 108 ELAGVKRAQ--IEATVLPLLDLVGLAAQKDRYPAQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+R+I  + G+T+VL+ H M+++ ++ DR+ VL+ GR + EG+ 
Sbjct: 166 EATSALDPETTRAILDLLRRINRELGLTIVLITHQMEVIKDVCDRVAVLDAGRVVEEGNV 225

Query: 236 RDV--RDNPEVIAAYLG 250
            DV  R + EV  A +G
Sbjct: 226 IDVFMRPHHEVTRALIG 242


>METN1_BURMA RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 344

 Score =  128 bits (321), Expect = 6e-32
 Identities = 84/257 (32%), Positives = 145/257 (56%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++EI +LS+ F G    + A+ NV+ ++ QG V+ +IG +GAGK+TL   I  +  P +G
Sbjct: 1   MIEIRNLSQRFEGPRGWIEALHNVNLTIPQGEVFGIIGRSGAGKSTLVRTINLLTRPSEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG  ++ L+  +L  AR+ +G  FQ+  +  + T  +NV +              L
Sbjct: 61  SVFVGGRDLTQLSAAELRGARRDIGMIFQHFNLLSSRTVFDNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               ++RA   +      L+  VGL A  +   + +S G  +R+ IARALA+KP++L  D
Sbjct: 108 ELAGVKRAQ--IEATVLPLLDLVGLAAQKDRYPAQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+R+I  + G+T+VL+ H M+++ ++ DR+ VL+ GR + EG+ 
Sbjct: 166 EATSALDPETTRAILDLLRRINRELGLTIVLITHQMEVIKDVCDRVAVLDAGRVVEEGNV 225

Query: 236 RDV--RDNPEVIAAYLG 250
            DV  R + EV  A +G
Sbjct: 226 IDVFMRPHHEVTRALIG 242


>RBSA2_THEMA RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 523

 Score =  125 bits (315), Expect = 3e-31
 Identities = 68/248 (27%), Positives = 136/248 (54%), Gaps = 12/248 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE  +++KTF GV+AV NV+  + +G V +++G NGAGK+TL  ++ G+Y   +G+I L
Sbjct: 12  LLEARNITKTFPGVIAVNNVTLQIYKGEVCALVGENGAGKSTLMKILAGVYPDYEGQIFL 71

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V    P +    G+    Q L +  N+++ EN+ +      +  +++    F    
Sbjct: 72  EGKEVRFRNPREAQENGIALIPQELDLVPNLSSAENIFLSREPVNEFGVIEYQKMF---- 127

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                  E A++L   +G+     ++   +S    + + IA+AL+   +I+ +DEP +  
Sbjct: 128 -------EQASKLFSKLGVNIDPKTKVEDLSTSQQQMVAIAKALSLDAKIIIMDEPTSAI 180

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
             +ET ++ N++R + + G +V+ + H ++ +  I+DR++V+  GRK+ EG   +  D+ 
Sbjct: 181 GKRETEQLFNIIRSLKNEGKSVIYISHRLEEIFEIADRVVVMRDGRKVGEGPIEEF-DHD 239

Query: 243 EVIAAYLG 250
           +++   +G
Sbjct: 240 KLVRLMVG 247



 Score = 70.5 bits (171), Expect = 2e-14
 Identities = 57/235 (24%), Positives = 108/235 (45%), Gaps = 10/235 (4%)

Query: 17  LAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTP-CDGEIRLGGELVSGLAPHQL 75
           L V +VSF V +G V  + G  GAG+T L   I G +    +G++ +GG+ +   +P   
Sbjct: 281 LLVDDVSFYVRKGEVLGIYGLVGAGRTELLEAIFGAHPGRTEGKVFIGGKEIKIHSPRDA 340

Query: 76  ARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHA 132
            + G+G   ++ +   + + M+ + N+ +    S+   L+         +    ++R   
Sbjct: 341 VKNGIGLVPEDRKTAGLILQMSVLHNITLP---SVVMKLIVRKFGLIDSQLEKEIVRSFI 397

Query: 133 AELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDN 192
            +L +       +      +S G  +++ +A+ LA KP++L LDEP  G +    +EI  
Sbjct: 398 EKLNIKTPSPYQI---VENLSGGNQQKVVLAKWLAIKPKVLLLDEPTRGIDVNAKSEIYK 454

Query: 193 LVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAA 247
           L+                +  ++ +SDRILV++ GRK  E    +V +   + AA
Sbjct: 455 LIXXXXXXXXXXXXXXXXLPEILAMSDRILVMSEGRKTAEFLREEVTEEDLLKAA 509


>LPTB_SHIFL RecName: Full=Lipopolysaccharide export system
           ATP-binding protein lptB;         EC=3.6.3.-;
          Length = 241

 Score =  125 bits (315), Expect = 3e-31
 Identities = 74/250 (29%), Positives = 127/250 (50%), Gaps = 14/250 (5%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           MA L   +L+K + G   V++VS +V+ G +  ++GPNGAGKTT F ++ GI     G  
Sbjct: 1   MATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNX 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
                  S L  H  AR+G+G   Q   I   ++  +N+M    +  D +  +       
Sbjct: 61  XXXXXXXSLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQR------ 114

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                    + A ELM    +E   +S   ++S G  +R+EIARALAA P+ + LDEP A
Sbjct: 115 --------EDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFA 166

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           G +P    +I  ++  + DSG+ V++ +H+++  + + +R  +++ G  +  G+  ++  
Sbjct: 167 GVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQ 226

Query: 241 NPEVIAAYLG 250
           +  V   YLG
Sbjct: 227 DEHVKRVYLG 236


>LPTB_ECOLI RecName: Full=Lipopolysaccharide export system
           ATP-binding protein lptB;         EC=3.6.3.-;
          Length = 241

 Score =  125 bits (315), Expect = 3e-31
 Identities = 74/250 (29%), Positives = 127/250 (50%), Gaps = 14/250 (5%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           MA L   +L+K + G   V++VS +V+ G +  ++GPNGAGKTT F ++ GI     G  
Sbjct: 1   MATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNX 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
                  S L  H  AR+G+G   Q   I   ++  +N+M    +  D +  +       
Sbjct: 61  XXXXXXXSLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQR------ 114

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                    + A ELM    +E   +S   ++S G  +R+EIARALAA P+ + LDEP A
Sbjct: 115 --------EDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFA 166

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           G +P    +I  ++  + DSG+ V++ +H+++  + + +R  +++ G  +  G+  ++  
Sbjct: 167 GVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQ 226

Query: 241 NPEVIAAYLG 250
           +  V   YLG
Sbjct: 227 DEHVKRVYLG 236


>LPTB_ECOL6 RecName: Full=Lipopolysaccharide export system
           ATP-binding protein lptB;         EC=3.6.3.-;
          Length = 241

 Score =  125 bits (315), Expect = 3e-31
 Identities = 74/250 (29%), Positives = 127/250 (50%), Gaps = 14/250 (5%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           MA L   +L+K + G   V++VS +V+ G +  ++GPNGAGKTT F ++ GI     G  
Sbjct: 1   MATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNX 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
                  S L  H  AR+G+G   Q   I   ++  +N+M    +  D +  +       
Sbjct: 61  XXXXXXXSLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQR------ 114

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                    + A ELM    +E   +S   ++S G  +R+EIARALAA P+ + LDEP A
Sbjct: 115 --------EDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFA 166

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           G +P    +I  ++  + DSG+ V++ +H+++  + + +R  +++ G  +  G+  ++  
Sbjct: 167 GVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQ 226

Query: 241 NPEVIAAYLG 250
           +  V   YLG
Sbjct: 227 DEHVKRVYLG 236


>LPTB_ECO57 RecName: Full=Lipopolysaccharide export system
           ATP-binding protein lptB;         EC=3.6.3.-;
          Length = 241

 Score =  125 bits (315), Expect = 3e-31
 Identities = 74/250 (29%), Positives = 127/250 (50%), Gaps = 14/250 (5%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           MA L   +L+K + G   V++VS +V+ G +  ++GPNGAGKTT F ++ GI     G  
Sbjct: 1   MATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNX 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
                  S L  H  AR+G+G   Q   I   ++  +N+M    +  D +  +       
Sbjct: 61  XXXXXXXSLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQR------ 114

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                    + A ELM    +E   +S   ++S G  +R+EIARALAA P+ + LDEP A
Sbjct: 115 --------EDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFA 166

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           G +P    +I  ++  + DSG+ V++ +H+++  + + +R  +++ G  +  G+  ++  
Sbjct: 167 GVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQ 226

Query: 241 NPEVIAAYLG 250
           +  V   YLG
Sbjct: 227 DEHVKRVYLG 236


>RBSA_BACLD RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 493

 Score =  125 bits (314), Expect = 4e-31
 Identities = 75/247 (30%), Positives = 129/247 (52%), Gaps = 12/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +++ D+ K FG    +  VSF + +G V++++G NGAGK+TL NL+TG++    G I + 
Sbjct: 3   IKMKDIFKAFGQNQVLSGVSFELQEGEVHALMGENGAGKSTLMNLLTGLHKLDSGTIEID 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+      P +  + G+    Q L I   MT +EN+ +G  LS       S L F + ++
Sbjct: 63  GKETYFSDPKEAEQNGIAFIHQELNIWPEMTVLENLFIGRELS-------SKLGFLNNKK 115

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
             A+ +E    L V + LE     EA   S G  + +EIA+AL    +++ +DEP A   
Sbjct: 116 MKALAKEQLERLGVSISLE----KEAGDCSVGQQQMIEIAKALMTDAKVIIMDEPTAALT 171

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E  ++  ++R +  +G+++V + H M+ +  I DRI V+  G+ +      D  D  E
Sbjct: 172 EREIEKLFGVIRALKKNGVSIVYISHRMEEIFTICDRITVMRDGKTVDTKRIPDT-DFHE 230

Query: 244 VIAAYLG 250
           V+   +G
Sbjct: 231 VVKKMVG 237



 Score = 80.9 bits (198), Expect = 1e-17
 Identities = 65/244 (26%), Positives = 116/244 (47%), Gaps = 28/244 (11%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+   SK   GV   QN+SFSV  G +  + G  GAG+T L   + G+     G+I +
Sbjct: 255 VLEVKQASKK--GVF--QNISFSVRSGEIVGISGLMGAGRTELMRAVFGLDPLDSGDIFI 310

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLS------LDRNLVK 113
            G+  +   P    +KG+G   +N +   + ++ +  EN+ +    S      +D+   K
Sbjct: 311 EGKKAALKKPSDAVQKGIGFITENRKDEGLVLDTSIRENIALPNLASFSPKGWIDK---K 367

Query: 114 SMLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRIL 173
           S   F  L      ++  + E            + A  +S G  +++ IA+ +   P++L
Sbjct: 368 SEQEFVDLLIKRLTIKTESPE------------THARNLSGGNQQKVVIAKWIGIGPKVL 415

Query: 174 FLDEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
            LDEP  G +     EI  L+ ++ D G+ +V+V  ++  ++ +SDR+LV++ G    E 
Sbjct: 416 ILDEPTRGVDVGAKREIYQLMNELTDRGVAIVMVSSELPEILGMSDRVLVIHEGTLSGEL 475

Query: 234 SARD 237
           S  D
Sbjct: 476 SRND 479


>METN_BURTA RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 344

 Score =  124 bits (312), Expect = 7e-31
 Identities = 83/257 (32%), Positives = 144/257 (56%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++EI +LS+ F G    + A+ NV+ ++ QG V+ +IG +GAGK+TL   I  +  P +G
Sbjct: 1   MIEIRNLSQRFEGPRGWIEALHNVNLTIPQGEVFGIIGRSGAGKSTLVRTINLLTRPSEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G  ++ L+  +L  AR+ +G  FQ+  +  + T   NV +              L
Sbjct: 61  NVFVDGRDLTQLSAGELRGARRDIGMIFQHFNLLSSRTVFGNVALP-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               ++RA+  +      L+  VGL A  +   + +S G  +R+ IARALA+KP++L  D
Sbjct: 108 ELAGVKRAE--IEATVLPLLDLVGLAAQKDRYPAQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+R+I  + G+T+VL+ H M+++ ++ DR+ VL+ GR + EG+ 
Sbjct: 166 EATSALDPETTRAILDLLRRINRELGLTIVLITHQMEVIKDVCDRVAVLDAGRVVEEGNV 225

Query: 236 RDV--RDNPEVIAAYLG 250
            DV  R + EV  A +G
Sbjct: 226 IDVFMRPHHEVTRALIG 242


>METN_BRUSU RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 369

 Score =  124 bits (311), Expect = 9e-31
 Identities = 77/244 (31%), Positives = 131/244 (53%), Gaps = 18/244 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+ D+ + FG   A+  VS SV +G +  +IG +GAGK+TL   + G+  P  G I +
Sbjct: 30  IVEMKDVRRMFGETAAINGVSLSVARGEILGIIGRSGAGKSTLIRCVNGLEKPDTGSIHI 89

Query: 63  GGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            G  ++ L    L   R+ +G  FQ+  +    TA +N+ +              L+   
Sbjct: 90  EGREITSLDEDALRPVRRRIGMVFQHFNLLSAKTAAQNIAL-------------PLKIAG 136

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + +A+ + R   AEL+  VGL    +   + +S G  +R+ IARALAA+P +L  DE  +
Sbjct: 137 MPKAERIKR--VAELLELVGLSDKASHYPAQLSGGQKQRVGIARALAAEPAVLLSDEATS 194

Query: 181 GFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             +P+ T  I  L++ I A  G+T++L+ H+M ++  I+DR++VL++G    EG    V 
Sbjct: 195 ALDPETTQSILALLKDINAKLGLTILLITHEMDVIRRIADRVIVLDHGLIAEEGPVWKVF 254

Query: 240 DNPE 243
            NP+
Sbjct: 255 ANPQ 258


>METN_BRUME RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 369

 Score =  124 bits (311), Expect = 9e-31
 Identities = 77/244 (31%), Positives = 131/244 (53%), Gaps = 18/244 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+ D+ + FG   A+  VS SV +G +  +IG +GAGK+TL   + G+  P  G I +
Sbjct: 30  IVEMKDVRRMFGETAAINGVSLSVARGEILGIIGRSGAGKSTLIRCVNGLEKPDTGSIHI 89

Query: 63  GGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            G  ++ L    L   R+ +G  FQ+  +    TA +N+ +              L+   
Sbjct: 90  EGREITSLDEDALRPVRRRIGMVFQHFNLLSAKTAAQNIAL-------------PLKIAG 136

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + +A+ + R   AEL+  VGL    +   + +S G  +R+ IARALAA+P +L  DE  +
Sbjct: 137 MPKAERIKR--VAELLELVGLSDKASHYPAQLSGGQKQRVGIARALAAEPAVLLSDEATS 194

Query: 181 GFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             +P+ T  I  L++ I A  G+T++L+ H+M ++  I+DR++VL++G    EG    V 
Sbjct: 195 ALDPETTQSILALLKDINAKLGLTILLITHEMDVIRRIADRVIVLDHGLIAEEGPVWKVF 254

Query: 240 DNPE 243
            NP+
Sbjct: 255 ANPQ 258


>METN_BRUAB RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 369

 Score =  124 bits (311), Expect = 9e-31
 Identities = 77/244 (31%), Positives = 131/244 (53%), Gaps = 18/244 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+ D+ + FG   A+  VS SV +G +  +IG +GAGK+TL   + G+  P  G I +
Sbjct: 30  IVEMKDVRRMFGETAAINGVSLSVARGEILGIIGRSGAGKSTLIRCVNGLEKPDTGSIHI 89

Query: 63  GGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            G  ++ L    L   R+ +G  FQ+  +    TA +N+ +              L+   
Sbjct: 90  EGREITSLDEDALRPVRRRIGMVFQHFNLLSAKTAAQNIAL-------------PLKIAG 136

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + +A+ + R   AEL+  VGL    +   + +S G  +R+ IARALAA+P +L  DE  +
Sbjct: 137 MPKAERIKR--VAELLELVGLSDKASHYPAQLSGGQKQRVGIARALAAEPAVLLSDEATS 194

Query: 181 GFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             +P+ T  I  L++ I A  G+T++L+ H+M ++  I+DR++VL++G    EG    V 
Sbjct: 195 ALDPETTQSILALLKDINAKLGLTILLITHEMDVIRRIADRVIVLDHGLIAEEGPVWKVF 254

Query: 240 DNPE 243
            NP+
Sbjct: 255 ANPQ 258


>METN_BRUA2 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 369

 Score =  124 bits (311), Expect = 9e-31
 Identities = 77/244 (31%), Positives = 131/244 (53%), Gaps = 18/244 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+ D+ + FG   A+  VS SV +G +  +IG +GAGK+TL   + G+  P  G I +
Sbjct: 30  IVEMKDVRRMFGETAAINGVSLSVARGEILGIIGRSGAGKSTLIRCVNGLEKPDTGSIHI 89

Query: 63  GGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            G  ++ L    L   R+ +G  FQ+  +    TA +N+ +              L+   
Sbjct: 90  EGREITSLDEDALRPVRRRIGMVFQHFNLLSAKTAAQNIAL-------------PLKIAG 136

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + +A+ + R   AEL+  VGL    +   + +S G  +R+ IARALAA+P +L  DE  +
Sbjct: 137 MPKAERIKR--VAELLELVGLSDKASHYPAQLSGGQKQRVGIARALAAEPAVLLSDEATS 194

Query: 181 GFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             +P+ T  I  L++ I A  G+T++L+ H+M ++  I+DR++VL++G    EG    V 
Sbjct: 195 ALDPETTQSILALLKDINAKLGLTILLITHEMDVIRRIADRVIVLDHGLIAEEGPVWKVF 254

Query: 240 DNPE 243
            NP+
Sbjct: 255 ANPQ 258


>METN_BACSU RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 341

 Score =  124 bits (311), Expect = 9e-31
 Identities = 78/248 (31%), Positives = 134/248 (54%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ + D+SK +    G V AVQNVS S+ +G ++ +IG +GAGK++L  L+ G+  P  G
Sbjct: 1   MINLQDVSKVYKSKHGDVNAVQNVSLSIKKGEIFGIIGYSGAGKSSLIRLLNGLEKPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G  ++ +    L  AR  +   FQ+  +  + T  +N+M               L
Sbjct: 61  TVEVAGTKINEVNGRGLRKARHEISMIFQHFNLLWSRTVRDNIMF-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               +++++ + R  A EL+  VGLE    S  S +S G  +R+ IARALA  P++L  D
Sbjct: 108 EIAGVKKSERIKR--ANELIKLVGLEGKEKSYPSQLSGGQKQRVGIARALANNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+  I +  G+T+VL+ H+M ++  I +R+ V+  G+ + EG  
Sbjct: 166 EATSALDPQTTDSILDLLSDINERLGLTIVLITHEMHVIRKICNRVAVMENGKVVEEGEV 225

Query: 236 RDVRDNPE 243
            DV  NP+
Sbjct: 226 LDVFKNPK 233


>YUFO_BACSU RecName: Full=Uncharacterized ABC transporter
           ATP-binding protein yufO;
          Length = 510

 Score =  124 bits (310), Expect = 1e-30
 Identities = 69/239 (28%), Positives = 127/239 (53%), Gaps = 12/239 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+ ++ K F G++A  N++  V +G +++++G NGAGK+TL N++ G+Y P  GEIR+
Sbjct: 4   VIEMLNIRKAFPGIVANDNINLQVKKGEIHALLGENGAGKSTLMNVLFGLYQPERGEIRV 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V   +P++    G+G   Q+  +    T  EN+++G          K   +F  + 
Sbjct: 64  RGEKVHINSPNKANDLGIGMVHQHFMLVDTFTVAENIILG----------KEPKKFGRID 113

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R  A   +   ++    GL+ +  ++A+ +S G  +R EI + L     IL  DEP A  
Sbjct: 114 RKRA--GQEVQDISDRYGLQIHPEAKAADISVGMQQRAEILKTLYRGADILIFDEPTAVL 171

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
            P E  E+  +++ +   G +++L+ H +K +M I DR+ V+  G+ +     RD   +
Sbjct: 172 TPHEIKELMQIMKNLVKEGKSIILITHKLKEIMEICDRVTVIRKGKGIKTLDVRDTNQD 230



 Score = 72.4 bits (176), Expect = 4e-15
 Identities = 49/217 (22%), Positives = 104/217 (47%), Gaps = 10/217 (4%)

Query: 15  GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQ 74
           G+  V+++S SV  G +  + G +G G++ L   +TG+     G I L G+ +  L P +
Sbjct: 269 GIETVRDLSLSVKAGEIVGIAGVDGNGQSELIEAVTGLRKTDSGTITLNGKQIQNLTPRK 328

Query: 75  LARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREH 131
           +   G+G   Q+     + ++    EN+++  +     + +  + +    ++A +++ E+
Sbjct: 329 ITESGIGHIPQDRHKHGLVLDFPIGENILLQSYYKKPYSALGVLHKGEMYKKARSLITEY 388

Query: 132 AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEID 191
                     + Y  + A A+S G  ++  I R +   P +L   +P  G +      + 
Sbjct: 389 DVRTP-----DEY--THARALSGGNQQKAIIGREIDRNPDLLIAAQPTRGLDVGAIEFVH 441

Query: 192 NLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
             + +  D+G  V+L+  +++ +MN+SDRI V+  GR
Sbjct: 442 KKLIEQRDAGKAVLLLSFELEEIMNLSDRIAVIFEGR 478


>RBSA_BACSK RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 499

 Score =  124 bits (310), Expect = 1e-30
 Identities = 66/225 (29%), Positives = 125/225 (55%), Gaps = 10/225 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+S +SK+F G   ++NVSF++++G +++++G NGAGK+TL  ++TGIY   +G +R+
Sbjct: 2   IVEMSQISKSFSGNQVLKNVSFTLEKGEIHALMGENGAGKSTLMKILTGIYPRDEGVVRV 61

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V+   P    + G+    Q L I   ++  EN+ +G   ++ +      L+     
Sbjct: 62  KGKEVAYTHPKDAEKDGIAVIHQELNILPELSVAENLFLGNEYTVGKT---GWLKTKK-- 116

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                + E+A + +  +GL+   +  A A+S G  + +EIA+AL     I+ +DEP A  
Sbjct: 117 -----MNEYAEQQLAELGLKVKASDRAGALSVGKQQLIEIAKALMTNADIIIMDEPTAAL 171

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
             +E   +  ++R + + G+T V + H M+ + ++  RI VL  G
Sbjct: 172 TDREIDTLFTVIRGLQEKGVTFVYISHRMEEIFSLCQRITVLRDG 216



 Score = 65.1 bits (157), Expect = 6e-13
 Identities = 49/209 (23%), Positives = 98/209 (46%), Gaps = 6/209 (2%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++V+F V +G ++ + G  GAG++ +   I G      G I +  + V    P      G
Sbjct: 269 ESVTFEVREGEIFGIAGLMGAGRSEVVESIFGYRHLHSGTIEIDQKPVVFKRPVDAIENG 328

Query: 80  MGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYV 139
           +    ++ +       I N  V  +LS+      S     S  +  A+ +E   +L V  
Sbjct: 329 IAFVPEDRK---TKGLIVNFSVRDNLSITNLATVSSGNMMSSTKEQALYQELVKKLGVRT 385

Query: 140 GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIAD 199
                 + +A ++S G  +++ IA+ L  KP++L LDEP  G +     EI  ++ ++A 
Sbjct: 386 SGP---HQKAKSLSGGNQQKVVIAKWLGMKPKVLILDEPTRGVDVGAKKEIYTIMNELAK 442

Query: 200 SGITVVLVEHDMKMVMNISDRILVLNYGR 228
            G+ +++V  ++  ++ +S R+ V+  G+
Sbjct: 443 QGVAIIMVSSELPEIIGMSTRVAVMFEGK 471


>Y3926_AZOC5 RecName: Full=Probable ABC transporter ATP-binding
           protein AZC_3926;AltName: Full=ORF1;
          Length = 281

 Score =  123 bits (309), Expect = 2e-30
 Identities = 77/242 (31%), Positives = 125/242 (51%), Gaps = 15/242 (6%)

Query: 9   LSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVS 68
           L+K++GG   V++VS  V +G    ++GPNGAGKTT+F +ITG+     G I L G  V+
Sbjct: 50  LAKSYGGRKVVRDVSLDVRRGEAVGLLGPNGAGKTTVFYMITGLVKADQGRIELDGHDVT 109

Query: 69  GLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
            +  ++ AR G+G   Q   I   ++  +N+  G  L +           P+ +R     
Sbjct: 110 PMPMYRRARLGIGYLPQEASIFRGLSVEDNI--GAVLEITE---------PNRKRRXXXX 158

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
                   +         S + A+S G  +R+EIARALA++P  + LDEP AG +P    
Sbjct: 159 XXXXXXFKI----THVRKSPSIALSGGERRRVEIARALASRPAFMLLDEPFAGIDPIAVG 214

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAY 248
           +I  LVR +   GI V++ +H+++  + + DR  +++ G  L EG    +  +P+V   Y
Sbjct: 215 DIQALVRHLTTRGIGVLITDHNVRETLGLIDRAYIIHSGTVLMEGDPESIVASPDVRRLY 274

Query: 249 LG 250
           LG
Sbjct: 275 LG 276


>RBSA_ANAVT RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 517

 Score =  123 bits (309), Expect = 2e-30
 Identities = 67/226 (29%), Positives = 121/226 (53%), Gaps = 12/226 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+  ++K F GV A+Q V+ ++  G V++++G NGAGK+TL  ++ G Y   +GEIR+
Sbjct: 18  VLEMQGIAKRFHGVPALQGVNLTIYPGEVHALMGENGAGKSTLMKILAGAYIADEGEIRI 77

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V    P    + G+   +Q L +  N+T  EN+ +G  L+  + L +  +      
Sbjct: 78  NGKGVKITDPGTARQAGINLIYQELNVAPNLTVTENIFMGSELTRGQFLDRKAMEL---- 133

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                    A +++  +G           ++    +++EIARAL    RIL +DEP A  
Sbjct: 134 --------EAQQVLASLGASFAPTDIVGTLAIAEQQQVEIARALKDNSRILVMDEPTAAL 185

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           + +ET  +  ++RK+ + GI ++ + H M+ +  ++DRI VL  G+
Sbjct: 186 SDRETERLFEVIRKLRNDGIAIIYISHRMEEIYALADRISVLRDGQ 231



 Score = 77.0 bits (188), Expect = 2e-16
 Identities = 60/219 (27%), Positives = 109/219 (49%), Gaps = 16/219 (7%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           VQ  SF +  G +  + G  GAG+T +  LI G      GE+ L G+ +   +P      
Sbjct: 283 VQPASFQLRAGEILGLAGLVGAGRTEVSRLIFGADRKVSGEVFLNGKKLEIHSPSDAIAV 342

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR--ADAVLREHAA 133
           G+G   ++ +   + + M++ +N+ +   L  D NL   ++ + S+ +   DAV   H  
Sbjct: 343 GIGYVPEDRKDQGLFLEMSSRKNIGLN-RLKQDANL--GIVNWGSVNKIATDAVENFHIR 399

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
                    A L   A  +S G  ++L +AR LA  PR+L LDEP  G +    +EI  +
Sbjct: 400 L--------ANLEIRAVDLSGGNQQKLLLARWLAINPRVLMLDEPTRGVDIGAKSEIYRI 451

Query: 194 VRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
           +  ++  G+ +++V  ++  ++ +SDR+LV+  G+ + E
Sbjct: 452 ISDLSAQGVAILMVSSELPEIVGLSDRVLVMREGQLVGE 490


>NODI_RHIEC RecName: Full=Nod factor export ATP-binding protein I;  
                 EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 316

 Score =  123 bits (309), Expect = 2e-30
 Identities = 86/253 (33%), Positives = 130/253 (51%), Gaps = 20/253 (7%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           M  ++ SD+SKT+G    V  +SF V  G  + ++GPNGAGK+T+  +I G+  P  G+I
Sbjct: 15  MTAIDFSDVSKTYGDKAVVSALSFRVSPGECFGLLGPNGAGKSTIARMILGMTAPDAGKI 74

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            + G  V   A  +LARKG+G   Q   +    T  EN+           LV S     +
Sbjct: 75  TVLGVPVPAQA--RLARKGIGVVPQFDNLEPEFTVRENL-----------LVYSRYFGMN 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
            R+ +AV+    + L+ +  LE+ +N+  S +S G  +RL +ARAL   P++L +DEP  
Sbjct: 122 TRKVEAVM----SSLLEFARLESKVNARVSELSGGMKRRLTLARALINDPQLLVMDEPTT 177

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           G +P     I   +R +   G T++L  H M+    + DR+ VL  GR + EG   D+ D
Sbjct: 178 GLDPHARHLIWERLRSLLTRGKTIILTTHFMEEAERLCDRLCVLEGGRSIAEGRPHDLID 237

Query: 241 ---NPEVIAAYLG 250
                EVI  Y G
Sbjct: 238 ELIGCEVIEIYGG 250


>METN1_BURCH RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 344

 Score =  122 bits (307), Expect = 3e-30
 Identities = 84/257 (32%), Positives = 140/257 (54%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ +LS+ F G    V A+ NV+ ++ QG V+ +IG +GAGK+TL   I  +  P +G
Sbjct: 1   MIELRNLSQRFPGPGGWVEALHNVNLTIPQGEVFGIIGRSGAGKSTLVRTINLLTRPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG  ++ L+   L  AR+ +G  FQ+  +  + T  +NV +              L
Sbjct: 61  NVVVGGRDLTLLSAGALREARREIGMIFQHFNLLSSRTVFDNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                 RAD  +      L+  VGL A  +   S +S G  +R+ IARALA++P++L  D
Sbjct: 108 ELAGASRAD--IEAAVLPLLDLVGLSAQKDRYPSQISGGQKQRVGIARALASQPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+++I  + G+T+VL+ H M+++  + DR+ VL+ GR + EG  
Sbjct: 166 EATSALDPETTRSILDLLKRINRELGLTIVLITHQMEVIKQVCDRVAVLDAGRVVEEGRV 225

Query: 236 RDVRDNP--EVIAAYLG 250
            DV   P  EV  A +G
Sbjct: 226 IDVFLQPHHEVTRALIG 242


>METN1_BURCA RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 344

 Score =  122 bits (307), Expect = 3e-30
 Identities = 84/257 (32%), Positives = 140/257 (54%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ +LS+ F G    V A+ NV+ ++ QG V+ +IG +GAGK+TL   I  +  P +G
Sbjct: 1   MIELRNLSQRFPGPGGWVEALHNVNLTIPQGEVFGIIGRSGAGKSTLVRTINLLTRPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG  ++ L+   L  AR+ +G  FQ+  +  + T  +NV +              L
Sbjct: 61  NVVVGGRDLTLLSAGALREARREIGMIFQHFNLLSSRTVFDNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                 RAD  +      L+  VGL A  +   S +S G  +R+ IARALA++P++L  D
Sbjct: 108 ELAGASRAD--IEAAVLPLLDLVGLSAQKDRYPSQISGGQKQRVGIARALASQPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+++I  + G+T+VL+ H M+++  + DR+ VL+ GR + EG  
Sbjct: 166 EATSALDPETTRSILDLLKRINRELGLTIVLITHQMEVIKQVCDRVAVLDAGRVVEEGRV 225

Query: 236 RDVRDNP--EVIAAYLG 250
            DV   P  EV  A +G
Sbjct: 226 IDVFLQPHHEVTRALIG 242


>POTA_FUSNN RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 376

 Score =  122 bits (306), Expect = 3e-30
 Identities = 80/252 (31%), Positives = 131/252 (51%), Gaps = 25/252 (9%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + I +++K+F GV  +++++  ++QG  +S+IGP+G GKTTL  +I G  +P  G I LG
Sbjct: 6   INIVNVNKSFDGVQILKDINLKIEQGEFFSIIGPSGCGKTTLLRMIAGFISPDSGAIYLG 65

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP-SLR 122
            E +  L P+    + +   FQ   +  ++   ENV                  FP  L+
Sbjct: 66  DENIVNLPPN---LRNVNTIFQKYALFPHLNVFENV-----------------AFPLRLK 105

Query: 123 RAD-AVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           + D   + E   + +  VGLE +   + S +S G  +R+ IARAL  KP +L LDEP + 
Sbjct: 106 KVDEKTINEEVNKYLKLVGLEEHSTKKVSQLSGGQQQRISIARALINKPGVLLLDEPLSA 165

Query: 182 FNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
            + K    +   +  I D  GIT + + HD +  ++ISDRI V+N G+ L  G+  +V +
Sbjct: 166 LDAKLRQNLLIELDLIHDEVGITFIFITHDQQEALSISDRIAVMNAGKVLQVGTPAEVYE 225

Query: 241 NP--EVIAAYLG 250
            P    +A +LG
Sbjct: 226 APADTFVADFLG 237


>RBSA_YERPS RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 507

 Score =  122 bits (305), Expect = 4e-30
 Identities = 69/226 (30%), Positives = 122/226 (53%), Gaps = 12/226 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ +++K+FG   A++ V  +V  G +++++G NGAGK+TL  ++ G YT   GEI +
Sbjct: 6   LLEMRNITKSFGKFQALKGVDLTVFSGEIHALMGENGAGKSTLMKILAGAYTTTSGEILI 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G   S   P      G+   +Q +Q+  N+T  EN+ +G  LS          R   ++
Sbjct: 66  EGRPWSIKGPKDALNAGISLIYQEMQLAPNLTVAENIFLGSELS----------RGGLVQ 115

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R + V++  A  ++  +G +   +     ++    +++EIARAL    RIL +DEP A  
Sbjct: 116 RKEMVMQTQA--VIDRLGAQFKASDLVMGLTIAEQQQVEIARALHRNSRILVMDEPTAAL 173

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           + +ET  +  L+ ++ D G+ ++ + H M  V  +SDR+ VL  G+
Sbjct: 174 STRETHRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQ 219



 Score = 81.3 bits (199), Expect = 9e-18
 Identities = 58/213 (27%), Positives = 109/213 (51%), Gaps = 12/213 (5%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           VQ VS  V  G +  + G  GAG++ L  LI G+     G I + G  +   +P +  R 
Sbjct: 271 VQAVSLQVRSGEIVGLAGLVGAGRSELAQLIFGVRKATGGTIEIDGVPLVIHSPREAIRH 330

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           G+G   +N +   + + + A +N+ +    +L+R+    +L     ++A A+  +    L
Sbjct: 331 GIGFLTENRKEQGLFLELAAQDNITMA---TLERDACYGLL---DRKKARAISDDAINRL 384

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            + V    +    A  +S G  ++L I+R +A  PRIL LDEP  G +    +EI  ++ 
Sbjct: 385 NIRV---PHAQVRAGGLSGGNQQKLLISRWVAISPRILILDEPTRGVDVGAKSEIYRIMS 441

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           ++A  G+ ++++  ++  V+ +SDR+ V++ GR
Sbjct: 442 QMAREGVAILMISSELPEVVGMSDRVYVMHEGR 474


>RBSA_YERPN RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 507

 Score =  122 bits (305), Expect = 4e-30
 Identities = 69/226 (30%), Positives = 122/226 (53%), Gaps = 12/226 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ +++K+FG   A++ V  +V  G +++++G NGAGK+TL  ++ G YT   GEI +
Sbjct: 6   LLEMRNITKSFGKFQALKGVDLTVFSGEIHALMGENGAGKSTLMKILAGAYTTTSGEILI 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G   S   P      G+   +Q +Q+  N+T  EN+ +G  LS          R   ++
Sbjct: 66  EGRPWSIKGPKDALNAGISLIYQEMQLAPNLTVAENIFLGSELS----------RGGLVQ 115

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R + V++  A  ++  +G +   +     ++    +++EIARAL    RIL +DEP A  
Sbjct: 116 RKEMVMQTQA--VIDRLGAQFKASDLVMGLTIAEQQQVEIARALHRNSRILVMDEPTAAL 173

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           + +ET  +  L+ ++ D G+ ++ + H M  V  +SDR+ VL  G+
Sbjct: 174 STRETHRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQ 219



 Score = 81.3 bits (199), Expect = 9e-18
 Identities = 58/213 (27%), Positives = 109/213 (51%), Gaps = 12/213 (5%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           VQ VS  V  G +  + G  GAG++ L  LI G+     G I + G  +   +P +  R 
Sbjct: 271 VQAVSLQVRSGEIVGLAGLVGAGRSELAQLIFGVRKATGGTIEIDGVPLVIHSPREAIRH 330

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           G+G   +N +   + + + A +N+ +    +L+R+    +L     ++A A+  +    L
Sbjct: 331 GIGFLTENRKEQGLFLELAAQDNITMA---TLERDACYGLL---DRKKARAISDDAINRL 384

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            + V    +    A  +S G  ++L I+R +A  PRIL LDEP  G +    +EI  ++ 
Sbjct: 385 NIRV---PHAQVRAGGLSGGNQQKLLISRWVAISPRILILDEPTRGVDVGAKSEIYRIMS 441

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           ++A  G+ ++++  ++  V+ +SDR+ V++ GR
Sbjct: 442 QMAREGVAILMISSELPEVVGMSDRVYVMHEGR 474


>RBSA_YERPE RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 507

 Score =  122 bits (305), Expect = 4e-30
 Identities = 69/226 (30%), Positives = 122/226 (53%), Gaps = 12/226 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ +++K+FG   A++ V  +V  G +++++G NGAGK+TL  ++ G YT   GEI +
Sbjct: 6   LLEMRNITKSFGKFQALKGVDLTVFSGEIHALMGENGAGKSTLMKILAGAYTTTSGEILI 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G   S   P      G+   +Q +Q+  N+T  EN+ +G  LS          R   ++
Sbjct: 66  EGRPWSIKGPKDALNAGISLIYQEMQLAPNLTVAENIFLGSELS----------RGGLVQ 115

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R + V++  A  ++  +G +   +     ++    +++EIARAL    RIL +DEP A  
Sbjct: 116 RKEMVMQTQA--VIDRLGAQFKASDLVMGLTIAEQQQVEIARALHRNSRILVMDEPTAAL 173

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           + +ET  +  L+ ++ D G+ ++ + H M  V  +SDR+ VL  G+
Sbjct: 174 STRETHRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQ 219



 Score = 81.3 bits (199), Expect = 9e-18
 Identities = 58/213 (27%), Positives = 109/213 (51%), Gaps = 12/213 (5%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           VQ VS  V  G +  + G  GAG++ L  LI G+     G I + G  +   +P +  R 
Sbjct: 271 VQAVSLQVRSGEIVGLAGLVGAGRSELAQLIFGVRKATGGTIEIDGVPLVIHSPREAIRH 330

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           G+G   +N +   + + + A +N+ +    +L+R+    +L     ++A A+  +    L
Sbjct: 331 GIGFLTENRKEQGLFLELAAQDNITMA---TLERDACYGLL---DRKKARAISDDAINRL 384

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            + V    +    A  +S G  ++L I+R +A  PRIL LDEP  G +    +EI  ++ 
Sbjct: 385 NIRV---PHAQVRAGGLSGGNQQKLLISRWVAISPRILILDEPTRGVDVGAKSEIYRIMS 441

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           ++A  G+ ++++  ++  V+ +SDR+ V++ GR
Sbjct: 442 QMAREGVAILMISSELPEVVGMSDRVYVMHEGR 474


>RBSA_YERPA RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 507

 Score =  122 bits (305), Expect = 4e-30
 Identities = 69/226 (30%), Positives = 122/226 (53%), Gaps = 12/226 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ +++K+FG   A++ V  +V  G +++++G NGAGK+TL  ++ G YT   GEI +
Sbjct: 6   LLEMRNITKSFGKFQALKGVDLTVFSGEIHALMGENGAGKSTLMKILAGAYTTTSGEILI 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G   S   P      G+   +Q +Q+  N+T  EN+ +G  LS          R   ++
Sbjct: 66  EGRPWSIKGPKDALNAGISLIYQEMQLAPNLTVAENIFLGSELS----------RGGLVQ 115

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R + V++  A  ++  +G +   +     ++    +++EIARAL    RIL +DEP A  
Sbjct: 116 RKEMVMQTQA--VIDRLGAQFKASDLVMGLTIAEQQQVEIARALHRNSRILVMDEPTAAL 173

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           + +ET  +  L+ ++ D G+ ++ + H M  V  +SDR+ VL  G+
Sbjct: 174 STRETHRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQ 219



 Score = 81.3 bits (199), Expect = 9e-18
 Identities = 58/213 (27%), Positives = 109/213 (51%), Gaps = 12/213 (5%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           VQ VS  V  G +  + G  GAG++ L  LI G+     G I + G  +   +P +  R 
Sbjct: 271 VQAVSLQVRSGEIVGLAGLVGAGRSELAQLIFGVRKATGGTIEIDGVPLVIHSPREAIRH 330

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           G+G   +N +   + + + A +N+ +    +L+R+    +L     ++A A+  +    L
Sbjct: 331 GIGFLTENRKEQGLFLELAAQDNITMA---TLERDACYGLL---DRKKARAISDDAINRL 384

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            + V    +    A  +S G  ++L I+R +A  PRIL LDEP  G +    +EI  ++ 
Sbjct: 385 NIRV---PHAQVRAGGLSGGNQQKLLISRWVAISPRILILDEPTRGVDVGAKSEIYRIMS 441

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           ++A  G+ ++++  ++  V+ +SDR+ V++ GR
Sbjct: 442 QMAREGVAILMISSELPEVVGMSDRVYVMHEGR 474


>RBSA_LACC3 RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 500

 Score =  121 bits (304), Expect = 6e-30
 Identities = 62/235 (26%), Positives = 125/235 (53%), Gaps = 11/235 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+  ++K+FG    ++ V F+V+ G V++++G NGAGK+TL N++TG+Y    GEI + 
Sbjct: 3   IEMKKITKSFGANRVLEGVDFTVESGEVHALMGENGAGKSTLMNILTGLYQANSGEILVD 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+  +   P +  + G+    Q +   + M+ ++N+ +   L     L+           
Sbjct: 63  GQPTTYSGPMEAEQHGISFIHQEMNNFLEMSVVDNMFLNKELRTKFGLMD---------- 112

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +  +RE AA  +  +G +  +      +S G  + +EIA++L    +I+ +DEP A   
Sbjct: 113 -NKAMREQAAHYLSLLGAKLDVEQPIGNLSVGRQQMVEIAKSLMTDAKIIIMDEPTAALT 171

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
             E  ++  +VR++ + G+  + + H M+ +  I+D++ V+  G  +TE + +DV
Sbjct: 172 ETEIDQLFGVVRRLKEKGVGFIYISHRMEEIFEIADKVTVMRDGLSITEYATKDV 226



 Score = 68.6 bits (166), Expect = 6e-14
 Identities = 54/213 (25%), Positives = 105/213 (49%), Gaps = 14/213 (6%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VSF+V QG +    G  GAG+T +   I GI     GEI L G+ V    P    R  
Sbjct: 268 KDVSFTVHQGEILGFSGLMGAGRTEIMRAIFGIDKYQSGEILLDGKPVKIRDPQDAIRHN 327

Query: 80  MGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELM 136
           +G   +N +   + +  +  +N+++    S+D  +   ++        D    E    LM
Sbjct: 328 IGFLTENRKDEGLILEDSLHDNIVLP---SIDGFVKHGLV-------DDKATDEFVRMLM 377

Query: 137 VYVGLEAY-LNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
             + ++A   +  A ++S G  +++ +A+ + +  ++L LDEP  G +     EI +L+ 
Sbjct: 378 KRLTVKAMGPDVSAGSLSGGNQQKVVLAKWIGSGSKVLILDEPTRGVDVGAKREIYDLMN 437

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           ++ D  + ++++  D+  V+ +SDRI V+  G+
Sbjct: 438 ELTDRHVAIIMISSDLPEVLGMSDRIAVVYEGK 470


>METN_LEIXX RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 340

 Score =  121 bits (304), Expect = 6e-30
 Identities = 77/258 (29%), Positives = 140/258 (54%), Gaps = 23/258 (8%)

Query: 2   ALLEISDLSKTFGG---VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           A +E   ++K+FG      A+  +  ++D+G ++ +IG +GAGK+TL  LI  +  P  G
Sbjct: 3   AHIEFRGVTKSFGSGDTPAALDGLDLTIDRGEIFCIIGYSGAGKSTLVRLINALEHPSSG 62

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G  ++ L   +L   R G+G  FQ   +  + T   N+     ++          
Sbjct: 63  SVVVDGRDLTALRERELCGVRAGIGMIFQQFNLFRSRTVFGNIAYPLKIA---------- 112

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
            +P+ +R     ++  AEL+ +VGL     +    +S G  +R+ IARALA  P IL  D
Sbjct: 113 GWPADKR-----KQRVAELLAFVGLTEKAWAYPEQLSGGQKQRVGIARALATNPGILLAD 167

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA++  L++++ A+ G+T+V++ H+M++V +I+DR+ VL  GR +  G+ 
Sbjct: 168 EATSSLDPETTADVLALLKRVNAELGVTIVVITHEMEVVRSIADRVAVLEAGRVIETGTV 227

Query: 236 RDVRDNPEVIAA--YLGT 251
            +V  NP+   A  ++GT
Sbjct: 228 FEVFSNPQTTTARRFVGT 245


>METN_BORPE RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 362

 Score =  121 bits (304), Expect = 6e-30
 Identities = 87/259 (33%), Positives = 132/259 (50%), Gaps = 24/259 (9%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I +LSKT+    G   A++ ++  + QG V+ +IGP+GAGK+TL   I  +  P  G
Sbjct: 1   MIHIENLSKTYATPHGRFEALRGINLHIQQGEVFGIIGPSGAGKSTLVQCINLLERPDQG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I +GG+ + GL   QL   R+ +G  FQ   +    T   NV +              L
Sbjct: 61  SIAIGGQALVGLGEAQLRNQRRRIGMVFQGFNLLARRTVYGNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               + RA+   R     L+  VGLE   +   S +S G  +R+ IARALA  P +L  D
Sbjct: 108 EIAGVARAEIPAR--VERLLALVGLEHLRDRYPSQISGGQKQRVGIARALANDPDVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+R I   +G+TVV++ H M++V  I DR+ VL++G  +  GS 
Sbjct: 166 EATSALDPETTHNILALLRDINRKTGVTVVMITHQMEVVREICDRVAVLSHGEVVELGST 225

Query: 236 RDVRDNP--EVIAAYLGTA 252
           R+V   P  EV  A +  A
Sbjct: 226 REVFAAPRHEVTRAMVSAA 244


>METN_BORPA RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 362

 Score =  121 bits (304), Expect = 6e-30
 Identities = 87/259 (33%), Positives = 132/259 (50%), Gaps = 24/259 (9%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I +LSKT+    G   A++ ++  + QG V+ +IGP+GAGK+TL   I  +  P  G
Sbjct: 1   MIHIENLSKTYATPHGRFEALRGINLHIQQGEVFGIIGPSGAGKSTLVQCINLLERPDQG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I +GG+ + GL   QL   R+ +G  FQ   +    T   NV +              L
Sbjct: 61  SIAIGGQALVGLGEAQLRNQRRRIGMVFQGFNLLARRTVYGNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               + RA+   R     L+  VGLE   +   S +S G  +R+ IARALA  P +L  D
Sbjct: 108 EIAGVARAEIPAR--VERLLALVGLEHLRDRYPSQISGGQKQRVGIARALANDPDVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+R I   +G+TVV++ H M++V  I DR+ VL++G  +  GS 
Sbjct: 166 EATSALDPETTHNILALLRDINRKTGVTVVMITHQMEVVREICDRVAVLSHGEVVELGST 225

Query: 236 RDVRDNP--EVIAAYLGTA 252
           R+V   P  EV  A +  A
Sbjct: 226 REVFAAPRHEVTRAMVSAA 244


>METN_BORBR RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 362

 Score =  121 bits (304), Expect = 6e-30
 Identities = 87/259 (33%), Positives = 132/259 (50%), Gaps = 24/259 (9%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I +LSKT+    G   A++ ++  + QG V+ +IGP+GAGK+TL   I  +  P  G
Sbjct: 1   MIHIENLSKTYATPHGRFEALRGINLHIQQGEVFGIIGPSGAGKSTLVQCINLLERPDQG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I +GG+ + GL   QL   R+ +G  FQ   +    T   NV +              L
Sbjct: 61  SIAIGGQALVGLGEAQLRNQRRRIGMVFQGFNLLARRTVYGNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               + RA+   R     L+  VGLE   +   S +S G  +R+ IARALA  P +L  D
Sbjct: 108 EIAGVARAEIPAR--VERLLALVGLEHLRDRYPSQISGGQKQRVGIARALANDPDVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+R I   +G+TVV++ H M++V  I DR+ VL++G  +  GS 
Sbjct: 166 EATSALDPETTHNILALLRDINRKTGVTVVMITHQMEVVREICDRVAVLSHGEVVELGST 225

Query: 236 RDVRDNP--EVIAAYLGTA 252
           R+V   P  EV  A +  A
Sbjct: 226 REVFAAPRHEVTRAMVSAA 244


>METN1_BURCM RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 344

 Score =  121 bits (304), Expect = 6e-30
 Identities = 84/257 (32%), Positives = 139/257 (54%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ +LS+ F G    V A+ NV+ ++ QG V+ +IG +GAGK+TL   I  +  P +G
Sbjct: 1   MIELRNLSQRFPGPTGWVDALHNVNLTIPQGEVFGIIGRSGAGKSTLVRTINLLTRPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG  ++ L    L  AR+ +G  FQ+  +  + T  +NV +              L
Sbjct: 61  NVVVGGRDLTLLPAGALREARREIGMIFQHFNLLSSRTVFDNVALP-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                 RAD  +      L+  VGL A  +   + +S G  +R+ IARALA+KP++L  D
Sbjct: 108 ELAGAGRAD--IEAAVLPLLDLVGLSAQKDRYPAQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+++I  + G+T+VL+ H M+++  + DR+ VL+ GR + EG  
Sbjct: 166 EATSALDPETTRSILDLLKRINRELGLTIVLITHQMEVIKQVCDRVAVLDAGRVVEEGRV 225

Query: 236 RDVRDNP--EVIAAYLG 250
            DV   P  EV  A +G
Sbjct: 226 IDVFLQPHHEVTRALIG 242


>METN1_BACSK RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 346

 Score =  121 bits (304), Expect = 6e-30
 Identities = 75/248 (30%), Positives = 129/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   ++KTF      V A+ NV+  V +G +Y VIG +GAGK+TL      +  P  G
Sbjct: 1   MIEFKQVTKTFHSGNQTVTALDNVNLHVARGEIYGVIGFSGAGKSTLIRSANLLERPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           E+ + G  ++ L   +L  A++ +G  FQ+  +  + T  +NV     L+          
Sbjct: 61  EVLINGVNLATLKSRELQKAKRNIGMIFQHFNLLQSKTVFDNVATPLKLT---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                R   A +R+   EL+ +VGL    ++    +S G  +R+ IARALA  P +L  D
Sbjct: 111 -----RTPKADIRKRVTELLSFVGLSDKADNYPEQLSGGQKQRIGIARALATNPEVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T+ I +L++KI  +  IT++++ H+M ++  I D++ V+  GR + EGS 
Sbjct: 166 EATSALDPDTTSSILHLLKKINIEYNITILMITHEMSVIREICDKVAVMEKGRIIEEGSV 225

Query: 236 RDVRDNPE 243
             +  NP+
Sbjct: 226 LSIFSNPQ 233


>YTFR_ECOLI RecName: Full=Uncharacterized ABC transporter
           ATP-binding protein ytfR;
          Length = 500

 Score =  121 bits (303), Expect = 8e-30
 Identities = 71/225 (31%), Positives = 117/225 (52%), Gaps = 12/225 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L    LSK F GV A+ NV FS+ +G + +++G NGAGK+TL   +TG+Y    G I L
Sbjct: 9   ILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYHADRGTIWL 68

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ +S        + G+G  +Q + +  NM+  +N+ +G          +   RF  LR
Sbjct: 69  EGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIG----------REPKRFGLLR 118

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R +  + + A ELM   G    +    +  S    + + I RA+    ++L LDEP A  
Sbjct: 119 RKE--MEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASL 176

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           + +E   + +L+R++ D G++++ V H +  V  +SDRI VL  G
Sbjct: 177 DTQEVELLFDLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNG 221



 Score = 47.4 bits (111), Expect = 1e-07
 Identities = 46/226 (20%), Positives = 94/226 (41%), Gaps = 14/226 (6%)

Query: 11  KTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGL 70
           K +G    +      V  G +  + G  G+G+T    +I GI     G   + G+  +  
Sbjct: 268 KNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGTALIKGKPQNLR 327

Query: 71  APHQLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           +PHQ +  G+G   ++ +   I    +  EN+++   L   R  ++ + R      A+  
Sbjct: 328 SPHQASVLGIGFCPEDRKTDGIIAAASVRENIILA--LQAQRGWLRPISRKEQQEIAERF 385

Query: 128 LREHAAELMVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKE 186
           +R+        +G+      +    +S G  +++ ++R L  +P+ L LDEP  G +   
Sbjct: 386 IRQ--------LGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTRPQFLILDEPTRGIDVGA 437

Query: 187 TAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
            AEI  L+  +   G                +DR++++   +++ E
Sbjct: 438 HAEIIRLIETLCADGXXXXXXXXXXXXXXGYADRVIIMRDRKQVAE 483


>YTFR_ECO57 RecName: Full=Uncharacterized ABC transporter
           ATP-binding protein ytfR;
          Length = 500

 Score =  121 bits (303), Expect = 8e-30
 Identities = 71/225 (31%), Positives = 117/225 (52%), Gaps = 12/225 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L    LSK F GV A+ NV FS+ +G + +++G NGAGK+TL   +TG+Y    G I L
Sbjct: 9   ILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYHADRGTIWL 68

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ +S        + G+G  +Q + +  NM+  +N+ +G          +   RF  LR
Sbjct: 69  EGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIG----------REPKRFGLLR 118

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R +  + + A ELM   G    +    +  S    + + I RA+    ++L LDEP A  
Sbjct: 119 RKE--MEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASL 176

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           + +E   + +L+R++ D G++++ V H +  V  +SDRI VL  G
Sbjct: 177 DTQEVELLFDLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNG 221



 Score = 46.6 bits (109), Expect = 2e-07
 Identities = 46/226 (20%), Positives = 94/226 (41%), Gaps = 14/226 (6%)

Query: 11  KTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGL 70
           K +G    +      V  G +  + G  G+G+T    +I GI     G   + G+  +  
Sbjct: 268 KNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGTALIKGKPQNLR 327

Query: 71  APHQLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           +PHQ +  G+G   ++ +   I    +  EN+++   L   R  ++ + R      A+  
Sbjct: 328 SPHQASVLGIGFCPEDRKTDGIIAAASVRENIILA--LQARRGWLRPISRKEQQEIAERF 385

Query: 128 LREHAAELMVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKE 186
           +R+        +G+      +    +S G  +++ ++R L  +P+ L LDEP  G +   
Sbjct: 386 IRQ--------LGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTRPQFLILDEPTRGIDVGA 437

Query: 187 TAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
            AEI  L+  +   G                +DR++++   +++ E
Sbjct: 438 HAEIIRLIETLCADGXXXXXXXXXXXXXXGYADRVIIMRDRKQVAE 483


>RBSA_HAHCH RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 501

 Score =  120 bits (302), Expect = 1e-29
 Identities = 73/237 (30%), Positives = 123/237 (51%), Gaps = 11/237 (4%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +LL +  +SK F GV A+ ++SF +  G +++++G NGAGK+TL  ++ G+Y    G I 
Sbjct: 3   SLLSLEHISKGFPGVRALNDISFELQSGEIHALLGENGAGKSTLMKILCGVYKQDAGRIL 62

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + G  V     H     G+G  FQ   +   + A+EN+ +G  L   RN +        L
Sbjct: 63  IDGAPVDFRHYHDATDAGVGVIFQEFSLIPYLNAVENIFLGREL---RNAL------GML 113

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           R+ D  +R  A ++   + +   L++    +S    + +EIA+AL+   RIL LDEP A 
Sbjct: 114 RKKD--MRAQAEKICQRLDVNIDLDAPVDHLSVAEQQFVEIAKALSLDARILVLDEPTAT 171

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
             P E   +  ++R++   G+ +V + H M+ +  I DRI VL  G K+ +    +V
Sbjct: 172 LTPNEAEHLFRVMRELKAQGVGMVFISHHMEEIYEICDRITVLRDGEKIGDREVGEV 228



 Score = 61.2 bits (147), Expect = 9e-12
 Identities = 56/225 (24%), Positives = 97/225 (43%), Gaps = 27/225 (12%)

Query: 23  SFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGMGR 82
           SF V +G +    G  G+G+T     + G    C  E+ + GE  +   P +  R+G+G 
Sbjct: 275 SFQVRKGEILGFAGLVGSGRTETALAMIGALPACRKEVSVEGEPAAMKTPAEALRRGIGL 334

Query: 83  TFQN---------LQICMNMTAIENVMVGGHLS-LDRNLVKSMLRFPSLRRADAVLREHA 132
             ++           I  N+T      V G  S +DR     +    S     A +R  A
Sbjct: 335 LPESRKKEGLILPFSIRENITLNNLAKVSGAASVIDRKRESEVAETLS-----AKVRVKA 389

Query: 133 AELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDN 192
            +    VG           +S G  +++ IAR L    ++L  DEP  G +     EI  
Sbjct: 390 PDCETPVG----------NLSGGNQQKVVIARWLNNDCKVLIFDEPTRGIDVGAKTEIYR 439

Query: 193 LVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR--KLTEGSA 235
           L++++   G++++++  ++  V+ +SDR+ V   G   K+ EG A
Sbjct: 440 LMKQLTAQGVSIIMISSELPEVVGVSDRVAVFRQGSIVKILEGDA 484


>RBSA_BACSU RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 493

 Score =  120 bits (302), Expect = 1e-29
 Identities = 71/247 (28%), Positives = 128/247 (51%), Gaps = 12/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ D+ KTFG    +  VSF +  G V++++G NGAGK+TL N++TG++    G+I + 
Sbjct: 3   IEMKDIHKTFGKNQVLSGVSFQLMPGEVHALMGENGAGKSTLMNILTGLHKADKGQISIN 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G       P +  + G+    Q L I   MT +EN+ +G  +S       S L     R+
Sbjct: 63  GNETYFSNPKEAEQHGIAFIHQELNIWPEMTVLENLFIGKEIS-------SKLGVLQTRK 115

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
             A+ +E   +L V + L+     EA   S G  + +EIA+AL     ++ +DEP A   
Sbjct: 116 MKALAKEQFDKLSVSLSLD----QEAGECSVGQQQMIEIAKALMTNAEVIIMDEPTAALT 171

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E +++  ++  +  +G+++V + H M+ +  I DRI ++  G+ +   +  +  D  E
Sbjct: 172 EREISKLFEVITALKKNGVSIVYISHRMEEIFAICDRITIMRDGKTVDTTNISET-DFDE 230

Query: 244 VIAAYLG 250
           V+   +G
Sbjct: 231 VVKKMVG 237



 Score = 75.9 bits (185), Expect = 4e-16
 Identities = 56/224 (25%), Positives = 109/224 (48%), Gaps = 18/224 (8%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VSF V  G +  V G  GAG+T +   + G+     GEI + G+  +   P +  +KG
Sbjct: 268 EDVSFYVRSGEIVGVSGLMGAGRTEMMRALFGVDRLDTGEIWIAGKKTAIKNPQEAVKKG 327

Query: 80  MGRTFQNLQ---ICMNMTAIENVMVGGHLSLD-RNLV--KSMLRFPSLRRADAVLREHAA 133
           +G   +N +   + ++ +  EN+ +    S   + L+  K    F  L      ++  + 
Sbjct: 328 LGFITENRKDEGLLLDTSIRENIALPNLSSFSPKGLIDHKREAEFVDLLIKRLTIKTASP 387

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           E            + A  +S G  +++ IA+ +   P++L LDEP  G +     EI  L
Sbjct: 388 E------------THARHLSGGNQQKVVIAKWIGIGPKVLILDEPTRGVDVGAKREIYTL 435

Query: 194 VRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
           + ++ + G+ +++V  ++  ++ +SDRI+V++ GR   E  AR+
Sbjct: 436 MNELTERGVAIIMVSSELPEILGMSDRIIVVHEGRISGEIHARE 479


>RBSA1_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA 1;
                   EC=3.6.3.17;
          Length = 499

 Score =  120 bits (302), Expect = 1e-29
 Identities = 71/238 (29%), Positives = 123/238 (51%), Gaps = 12/238 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+  ++K F GV+A+  V F +  G V+ ++G NGAGK+TL  +++G Y P  GEI +
Sbjct: 4   LLEMRGITKRFPGVVALDGVDFELLPGEVHVLLGENGAGKSTLIKILSGAYRPDGGEILM 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V   +  +  R G+   +Q   +   +T  EN+ +G          +   RF  + 
Sbjct: 64  DGRPVEIRSAAEARRLGISTIYQEFNLVPQLTVAENIHLG----------RQPRRFGVVD 113

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R    +   A EL+  +G+     +  + +     + +EIA+AL  + R+L +DEP A  
Sbjct: 114 R--GAMERAARELLERLGIRVDPRARVADLGVARRQMVEIAKALGLRARVLIMDEPTAAL 171

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           + +E  ++  +VR++ + G+ VV + H ++ V  I +R+ VL  GR +   SA   RD
Sbjct: 172 SEREVRQLFRIVRRLKEEGVGVVFISHHLEEVAEIGERVTVLRDGRLVGRVSADAGRD 229



 Score = 62.8 bits (151), Expect = 3e-12
 Identities = 55/229 (24%), Positives = 97/229 (42%), Gaps = 13/229 (5%)

Query: 29  GIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGMGRTFQNLQ 88
           G +  V G  GAG+T L   I G+     GE+ + G  +    P +  R+G+G   ++ Q
Sbjct: 277 GEIVGVAGLVGAGRTELARAIFGLDPADSGEVLVEGRPLEAPGPQEARRRGVGFVTEDRQ 336

Query: 89  ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA---ELMVYVGLEA-Y 144
                       +   LS+  NL  + L                    E++  + +    
Sbjct: 337 ---------GQGIVPPLSVAENLALASLEXXXXXXXXXXXXXXXXXXXEIVQSLRIRTPS 387

Query: 145 LNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIADSGITV 204
           L  E   +S G  ++  I R + A  R+L +DEP  G +     EI  L+ ++ + G  +
Sbjct: 388 LEQEIRYLSGGNQQKAVIGRWMLAGSRVLIMDEPTRGVDVGAKVEIYELMNRLTEEGAGI 447

Query: 205 VLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYLGTAA 253
           +++  +M  V+ +SDR+LV++ GR   E  A +      +  A  G+ A
Sbjct: 448 LMISSEMPEVLGMSDRVLVMSGGRITGELPAEEATQERVMGLATAGSEA 496


>METN3_OCEIH RecName: Full=Methionine import ATP-binding protein
           metN 3;         EC=3.6.3.-;
          Length = 341

 Score =  120 bits (302), Expect = 1e-29
 Identities = 75/247 (30%), Positives = 133/247 (53%), Gaps = 22/247 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E  +++KTF      V AV+ VS ++++G +Y +IG +GAGK+TL  L+  +  P +G
Sbjct: 1   MIEFQNVTKTFTLGKRKVEAVKEVSLTIEKGDIYGIIGFSGAGKSTLLRLVNMLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G  V  L+  QL   R+ +G  FQN  +  + T      V G+++    L  +  
Sbjct: 61  SVHIQGTDVGKLSAKQLRERRRNIGMIFQNFNLFQSRT------VAGNIAYPLKLAGT-- 112

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                  + +V+ +  +EL+ +VGL          +S G  +R+ IARALA  P IL  D
Sbjct: 113 -------SKSVVTKRVSELLQFVGLSDKAKDYPDQLSGGQKQRVGIARALATSPDILICD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T++I  L++K+  D GIT++L+ H+M ++ +I D++ V+  G+ +  G+ 
Sbjct: 166 EATSALDPNTTSDILKLLKKVNRDLGITILLITHEMGVIQSICDKVAVMEDGKVIENGNV 225

Query: 236 RDVRDNP 242
            D    P
Sbjct: 226 FDTFTKP 232


>METN_PROAC RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 365

 Score =  120 bits (301), Expect = 1e-29
 Identities = 77/233 (33%), Positives = 130/233 (55%), Gaps = 18/233 (7%)

Query: 14  GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPH 73
           G V A+ +VS ++ +G + +VIG +GAGK+TL  LI G+ TP  G + + G  VS L+  
Sbjct: 31  GTVRALDDVSLAIKRGSISAVIGHSGAGKSTLVRLINGLETPTRGRVLVDGTDVSQLSDK 90

Query: 74  QL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREH 131
            +   R  +G  FQ   +  + T  +NV                L+    ++AD   ++ 
Sbjct: 91  AMRPLRADIGMIFQQFNLFGSRTIYDNVAY-------------PLKLAHWKKADE--KKR 135

Query: 132 AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEID 191
             EL+ +VGL +        +S G  +R+ IARALA KP IL  DE  +  +P+ TA++ 
Sbjct: 136 ITELLSFVGLTSKAWDHPDQLSGGQKQRVGIARALATKPSILLADESTSALDPETTADVL 195

Query: 192 NLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           +L++++ A+ G+TVV++ H+M++V +I+ ++ VL  G  +  GSAR V  +P+
Sbjct: 196 SLLKRVNAELGVTVVVITHEMEVVRSIAQQVSVLAAGHLVESGSARQVFAHPQ 248


>POTA_OENOB RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 367

 Score =  120 bits (300), Expect = 2e-29
 Identities = 80/259 (30%), Positives = 137/259 (52%), Gaps = 33/259 (12%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           L+E  ++S  +G    ++ V   +++G  Y+++GP+G+GK+T+ +LI+G   P  G+I +
Sbjct: 9   LIEFKNVSLDYGETKVLKKVDLEIEEGKFYTLLGPSGSGKSTILSLISGRLQPTGGDILI 68

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHL------SLDRNLVKSML 116
            G+ V+ L  +Q   + +   FQN  +  NM   +NV  G  +       +D+ LVKSML
Sbjct: 69  EGKNVNSLPSNQ---RKVNTVFQNYALFPNMNVYDNVAFGPSIKGFSKKKIDQ-LVKSML 124

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           +                     V L+ + + E S +S G  +R+ IARALA +P++L LD
Sbjct: 125 KL--------------------VKLDDFSDREISEISGGQQQRVAIARALANQPKVLLLD 164

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           EP +  + K   E+ + +R++    GIT + V HD +  + +SD I V+N G+    GS 
Sbjct: 165 EPLSALDYKLRKEMQSELRELQQRLGITFIFVTHDQEEALAMSDWIFVINDGKVEQSGSP 224

Query: 236 RDVRDNP--EVIAAYLGTA 252
            D+ D P    +A ++G A
Sbjct: 225 VDIYDEPINHFVANFIGEA 243


>POTA_MYCMS RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 351

 Score =  120 bits (300), Expect = 2e-29
 Identities = 76/253 (30%), Positives = 136/253 (53%), Gaps = 21/253 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+ +++K + G + ++ +SF+V +G   +++GP+G GKTT+  +I G   P  GEI  
Sbjct: 5   ILELRNVTKEYDGQVVLKGISFNVKEGEFITLLGPSGCGKTTILKIIGGSQKPNSGEILF 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             +    L P  + ++     FQ+  +  ++   +NV  G  L++ +             
Sbjct: 65  EDK---NLIPIPINKRQFNTIFQSYALFPHLNVFDNVAFG--LTIKKT------------ 107

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           + D + RE   ++   VGLE Y N +   +S G  +R+ IARAL  KP++L LDEP A  
Sbjct: 108 KKDIIEREVMRQIR-QVGLEGYENKKIDELSGGQKQRIAIARALVMKPKVLLLDEPMAAL 166

Query: 183 NPKETAEI-DNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K    + + L R   D GIT ++V HD +  +++SDRI+V+N G     G+  ++ + 
Sbjct: 167 DVKLRKTMQEELKRLQQDIGITFIMVSHDQEEALSMSDRIVVMNQGTIQQIGTPEEIYNE 226

Query: 242 PE--VIAAYLGTA 252
           PE   +A ++G++
Sbjct: 227 PENAWVANFIGSS 239


>METN1_BURS3 RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 344

 Score =  120 bits (300), Expect = 2e-29
 Identities = 82/257 (31%), Positives = 140/257 (54%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ +LS+ F G    V A++N++ ++ QG V+ +IG +GAGK+TL   I  +  P +G
Sbjct: 1   MIELRNLSQRFPGPGGWVEALRNINLTIPQGEVFGIIGRSGAGKSTLVRTINLLTRPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG  ++ L    L  AR+ +G  FQ+  +  + T  +NV +              L
Sbjct: 61  NVVVGGRDLTMLPAGALREARREIGMIFQHFNLLSSRTVFDNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                 RA+  +      L+  VGL A  +   S +S G  +R+ IARALA++P++L  D
Sbjct: 108 ELAGASRAE--IDAAVLPLLDLVGLSAQKDRYPSQISGGQKQRVGIARALASQPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+++I  + G+T+VL+ H M+++  + DR+ VL+ GR + EG  
Sbjct: 166 EATSALDPETTRSILDLLKRINRELGLTIVLITHQMEVIKQVCDRVAVLDAGRVVEEGRV 225

Query: 236 RDVRDNP--EVIAAYLG 250
            DV   P  EV  A +G
Sbjct: 226 IDVFLQPHHEVTRALIG 242


>POTA_MYCCT RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 351

 Score =  119 bits (299), Expect = 2e-29
 Identities = 76/253 (30%), Positives = 136/253 (53%), Gaps = 21/253 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+ +++K + G + ++ +SF+V +G   +++GP+G GKTT+  +I G   P  GEI  
Sbjct: 5   ILELRNVTKEYDGQVVLKGISFNVKEGEFITLLGPSGCGKTTILKIIGGSQKPNSGEILF 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             +    L P  + ++     FQ+  +  ++   +NV  G  L++ +             
Sbjct: 65  EDK---NLIPIPINKRQFNTIFQSYALFPHLNVFDNVAFG--LTIKKT------------ 107

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           + D + RE   ++   VGLE Y N +   +S G  +R+ IARAL  KP++L LDEP A  
Sbjct: 108 KKDIIEREVMRQIR-QVGLEGYENKKIDELSGGQKQRVAIARALVMKPKVLLLDEPMAAL 166

Query: 183 NPKETAEI-DNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K    + + L R   D GIT ++V HD +  +++SDRI+V+N G     G+  ++ + 
Sbjct: 167 DVKLRKTMQEELKRLQQDIGITFIMVSHDQEEALSMSDRIVVMNQGTIQQIGTPEEIYNE 226

Query: 242 PE--VIAAYLGTA 252
           PE   +A ++G++
Sbjct: 227 PENAWVANFIGSS 239


>PHNC_THIDA RecName: Full=Phosphonates import ATP-binding protein
           phnC;         EC=3.6.3.28;
          Length = 259

 Score =  119 bits (299), Expect = 2e-29
 Identities = 81/242 (33%), Positives = 130/242 (53%), Gaps = 14/242 (5%)

Query: 1   MALLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           M+ + I  ++K F  G  A++ +   +  G    V+GP+GAGK+TL  L+ G+ TP  G 
Sbjct: 1   MSAISIQSVTKRFPNGFEALKGIDTEIQTGSFTVVLGPSGAGKSTLLRLMNGLETPTTGA 60

Query: 60  IRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR 117
           +R+ GE V G   H+L   R  +   FQ   +   ++ + NV+ G      R+ V S+  
Sbjct: 61  VRIDGETVDG---HRLRHIRSKVAMVFQQFNLVERLSVVTNVLTGR--LAQRSWVGSV-- 113

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           F   R+ D  +   A E +  VGL     S A  +S G  +R+ IARALA +P+++  DE
Sbjct: 114 FYLFRQEDLGI---AREALARVGLTDKAWSRADKLSGGQQQRVGIARALAQRPKVILADE 170

Query: 178 PAAGFNPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR 236
           P A  +P  + EI  L+R+I D  GITVV+  H + +    +DRI+ +N GR + +G+  
Sbjct: 171 PVASLDPVSSEEIMALLREICDRDGITVVVNLHQVDLAKRFADRIIGMNAGRVVFDGTPA 230

Query: 237 DV 238
           ++
Sbjct: 231 EL 232


>METN2_LACPL RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 343

 Score =  119 bits (299), Expect = 2e-29
 Identities = 76/248 (30%), Positives = 132/248 (53%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E  D++KTF    G V AVQ+V+  ++ G +Y ++G +GAGK+TL  ++ G+ TP  G
Sbjct: 1   MIEFKDVTKTFDAKQGAVHAVQDVNLKIEDGHIYGIVGYSGAGKSTLVRMLNGLETPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +    ++ L+  +L   R+ +G  FQ+  +  + T +EN+M               L
Sbjct: 61  SVVIDDVNITTLSGAKLRAQRQKIGMIFQHFNLLWSRTVLENIMF-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               L + DA  R+ A  L   VGL     +  S +S G  +R+ IARALA  P+IL  D
Sbjct: 108 EIAGLSKVDA--RKKAEHLADLVGLAGRETAYPSELSGGQKQRVGIARALANDPQILLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T E+ +L+  I     +T+VL+ H+M ++  I+D + V+  G+ + +G  
Sbjct: 166 EATSALDPQTTDEVLDLLLSINQKLHLTIVLITHEMHVIRKIADHVAVMEAGKIVEQGPV 225

Query: 236 RDVRDNPE 243
            +V   P+
Sbjct: 226 LEVFKRPQ 233


>RBSA2_STRCO RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 517

 Score =  119 bits (298), Expect = 3e-29
 Identities = 71/238 (29%), Positives = 120/238 (50%), Gaps = 12/238 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL I  + KTF GV+A+ +V F + +G V+ ++G NGAGK+TL  +++G YTP  G I  
Sbjct: 9   LLRIEGIRKTFPGVVALDSVDFDLRRGEVHVLLGENGAGKSTLIKMLSGAYTPDAGRILA 68

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
           GGE V         R G+   +Q   +  ++T  EN+ +G             L     +
Sbjct: 69  GGEEVRIHGAQDSERLGIATIYQEFNLVPDLTVAENIFLGRQ--------PRRLGMIDRK 120

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R DA     A  L+  VG+     +    +    L+ +EIA+AL+   R+L +DEP A  
Sbjct: 121 RMDA----DAEVLLKRVGVNVSPRARVRELGIARLQMVEIAKALSLDARVLIMDEPTAVL 176

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
             +E  ++  +VR++ + G+ +V + H ++ +  + DR+ V+  GR + +  A    D
Sbjct: 177 TSEEVDKLFAIVRRLREDGVGIVFITHHLEEIAALGDRVTVIRDGRSVGQVPASTPED 234


>METN1_BURXL RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 344

 Score =  119 bits (298), Expect = 3e-29
 Identities = 83/257 (32%), Positives = 137/257 (53%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++EI ++S+ F G    V A+ NV+ S+  G V+ +IG +GAGK+TL   I  +  P +G
Sbjct: 1   MIEIRNISQRFAGPRGSVEALHNVNLSIPAGEVFGIIGRSGAGKSTLVRTINLLTRPSEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I + G  ++ L   QL  AR+ +G  FQ+  +  + T   NV +              L
Sbjct: 61  NIVVNGRDLTTLPAAQLREARREIGMIFQHFNLLSSRTVYGNVALP-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               ++R +  +  +   L+  VGL A  +   + +S G  +R+ IARALA+KP++L  D
Sbjct: 108 ELAGMKRDE--IEANVLPLLELVGLTAQKDRYPAQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+R+I  +  +T+VL+ H M ++  + DR+ VL+ GR + EG  
Sbjct: 166 EATSALDPETTRSILDLLRRINRELNLTIVLITHQMDVIKQVCDRVAVLDAGRVVEEGKV 225

Query: 236 RDVRDNP--EVIAAYLG 250
            DV   P  EV  A +G
Sbjct: 226 IDVFLQPHHEVTRALIG 242


>RBSA_SILST RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 511

 Score =  119 bits (297), Expect = 4e-29
 Identities = 78/248 (31%), Positives = 132/248 (53%), Gaps = 13/248 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L+IS+L+K+FG V A++ V F + +G ++++ G NGAGK+TL N+I GI  P  GEIRL
Sbjct: 6   ILQISNLTKSFGPVKALKGVDFELRRGEIHAIAGENGAGKSTLMNIIDGILQPDSGEIRL 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V   +P    + G+G   Q + +C +++  EN+ +        N  +S L     +
Sbjct: 66  DGTPVEIPSPAAAQKMGIGFVHQEIALCPDVSVAENIFMAA-----TNSSRSFLM--DYK 118

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             +A  RE  A+L     ++  +     ++S   L  +EIA+AL    R+L LDEP A  
Sbjct: 119 GIEAKAREVFAQLS---SIDPSVLVRDLSISNQQL--VEIAKALTLDCRVLILDEPTAAL 173

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
              E   +  ++R++AD GI+++ + H M  + +  DR+ V   GR +T      +    
Sbjct: 174 TEAEAQVLFKIMRRLADQGISLIYISHRMVEIFDNCDRVSVFRDGRYVTTQDVAKITP-A 232

Query: 243 EVIAAYLG 250
           +V+ A +G
Sbjct: 233 DVVRAMVG 240



 Score = 72.8 bits (177), Expect = 3e-15
 Identities = 59/230 (25%), Positives = 112/230 (48%), Gaps = 25/230 (10%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGE----------LVSGL 70
           +VSFS+ +G +    G  GAG++ +   +  +     G + L GE          + +G+
Sbjct: 275 DVSFSLHKGEILGFAGLIGAGRSEIAKGVCALEGQVTGRLWLNGEPLALRDYQDSIDAGI 334

Query: 71  APHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLRE 130
                 RKG G  F ++ I  N++A++   V   L L       +     + +AD + R+
Sbjct: 335 VYLSEDRKGDG-VFLDMSIASNVSALKVEQVASALGL-------IQPGREIEQADRLGRK 386

Query: 131 HAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEI 190
               L +  G    L    S++S G  +++ +A+ L+  PR++FLDEP  G +    AEI
Sbjct: 387 ----LNLKCGT---LQDPVSSLSGGNQQKVALAKMLSVNPRLIFLDEPTRGVDVGAKAEI 439

Query: 191 DNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
             ++R +A+ G  +V++  ++  ++ + DR+LV++ G    E S  D+ +
Sbjct: 440 YRILRDLAEEGAGIVVISSELPELIGLCDRVLVIHEGCLSGEVSGPDMTE 489


>CBIO_METTH RecName: Full=Putative cobalt import ATP-binding protein
           cbiO;         EC=3.6.3.-;
          Length = 311

 Score =  119 bits (297), Expect = 4e-29
 Identities = 75/245 (30%), Positives = 128/245 (52%), Gaps = 16/245 (6%)

Query: 3   LLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           ++E+ DLS ++  G  A++ ++  V++G   +VIGPNGAGK+TLF  + GI  P  GE+ 
Sbjct: 1   MIELRDLSYSYPDGTPALRGINMKVERGERVAVIGPNGAGKSTLFLHLNGILKPAAGEVI 60

Query: 62  LGGELVSGLAPHQLA-RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
           + GE V       +  R+ +G  FQN    +    +   +  G ++L             
Sbjct: 61  IDGERVDYSKDELIKIRQKVGIVFQNPDDQLFSPTVREDVAFGPMNLGL----------- 109

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
               +  + E  AE +  VG+  Y N     +S G  KR+ IA  LA KP I+ LDEP  
Sbjct: 110 ---PEDEVEERVAESLEKVGMSGYENRAPHHLSGGEKKRVAIAGILAMKPEIMVLDEPTT 166

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           G +P+    I  ++ +++  GITV++  HD++++   ++R+ VLN G  + EG+  ++  
Sbjct: 167 GLDPETADGIIRILLELSREGITVMISSHDVEIISQFAERVFVLNSGELIAEGTPLEIFR 226

Query: 241 NPEVI 245
           + E+I
Sbjct: 227 DAELI 231


>RBSA3_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA 3;
                   EC=3.6.3.17;
          Length = 513

 Score =  118 bits (296), Expect = 5e-29
 Identities = 69/236 (29%), Positives = 119/236 (50%), Gaps = 12/236 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LEI ++SK FG V A+  VSFS+++G V+++ G NGAGK+TL N+I G+  P +G++ +
Sbjct: 7   VLEIRNVSKHFGAVKALTEVSFSLEKGEVHALCGENGAGKSTLMNIIAGVLQPTEGDVLV 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V   +P      G+G   Q + +C + T  EN+     ++         + +  L 
Sbjct: 67  DGAPVKVTSPAVAQSLGLGLVHQEIALCPDATVAENMF----MAATNRRRSPFMNYGRLE 122

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R   V+    A + V          +   +S  + + +EIA+AL    R+L  DEP A  
Sbjct: 123 RDAQVVMNRLAPIDV--------RRKVGDLSISSQQLVEIAKALTLDCRVLIFDEPTAAL 174

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
              ET  +  ++R +   GI+++ + H M  + ++ DR+ V   GR ++     DV
Sbjct: 175 TESETQVLFAIIRDLKAQGISIIYISHRMAEIFSLCDRVTVFRDGRYVSMEKVADV 230



 Score = 76.6 bits (187), Expect = 2e-16
 Identities = 57/216 (26%), Positives = 111/216 (51%), Gaps = 27/216 (12%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLA---- 76
           +V+F + +G +  V G  G+G+T +   I G+    DG+++L G+ +   +  Q A    
Sbjct: 276 DVNFDLRKGEILGVGGLIGSGRTEIAEGICGLRPVIDGKVQLHGQRLRARSYAQAAQAGV 335

Query: 77  ------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLRE 130
                 RKG G  F +L I  N+  ++   + G L L  +            +A+A   +
Sbjct: 336 VYLSEDRKGSG-IFLDLSIAQNIAVLDLKSLTGPLGLLNS------------KAEA---D 379

Query: 131 HAAELMVYVGLE-AYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
            A  L+  +G+    ++   S++S G  +++ IA+ LA  P+++ +DEP  G +    +E
Sbjct: 380 RAHNLVRRLGVRMGGIDMPVSSLSGGNQQKVAIAKQLAVDPKVILMDEPTRGIDVGAKSE 439

Query: 190 IDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLN 225
           I  L+R +A SGI +V++  ++  ++ + DR+LV++
Sbjct: 440 IHRLLRDLARSGIGIVVISSELPELLGLCDRVLVIH 475


>RBSA1_BURCM RecName: Full=Ribose import ATP-binding protein rbsA 1;
                   EC=3.6.3.17;
          Length = 517

 Score =  118 bits (296), Expect = 5e-29
 Identities = 71/226 (31%), Positives = 121/226 (53%), Gaps = 9/226 (3%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIY-TPCDGEIR 61
           LLE+  +SKTF  V A+ NVS +V  G ++S++G NGAGK+TL  +++G Y     GEI 
Sbjct: 10  LLEMRRISKTFPAVRALDNVSLTVYPGEIHSLMGENGAGKSTLMKILSGAYRADAGGEIL 69

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + GE +    P      G+   +Q L +  N+T  EN+ VG      R L +   R+ ++
Sbjct: 70  IDGERIDVDGPLAARDAGVAVIYQELCLAPNLTVAENIYVG------RELRRGNRRWGTI 123

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
            RA   +     +++  +G     ++    +S    + +EIARA+  + RIL +DEP   
Sbjct: 124 DRA--AMARGCEDVLARLGAPFGPDTLVGTLSIAEQQLVEIARAVHTRARILVMDEPTTP 181

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            + +ET  +  L+R++ + G+ ++ + H M  +  +SDR+ VL  G
Sbjct: 182 LSSRETEHLFGLIRQLREEGLAIIYISHRMAEIYELSDRVSVLRDG 227



 Score = 66.2 bits (160), Expect = 3e-13
 Identities = 52/214 (24%), Positives = 92/214 (42%), Gaps = 16/214 (7%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V+  S  +  G V  + G  GAG+T L  LI G      G+++LG       +P      
Sbjct: 281 VRGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRTRGDVKLGDRAFGAHSPRDAIDA 340

Query: 79  GM-----GRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
           G+      R  Q L + M++    N+ V                               A
Sbjct: 341 GLVYLTEDRKRQGLFLDMSVRDNINISVCNXXXXXXXXXXXXXXXXXXXXI--------A 392

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
            L + V      N    A+S G  +++ ++R L  KPR+L LDEP  G +    +EI  +
Sbjct: 393 SLSIRV---PNANVNVGALSGGNQQKVLLSRLLETKPRVLILDEPTRGVDIGAKSEIYRI 449

Query: 194 VRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           + ++A +G+ V+++  ++  ++ ++DR+LV+  G
Sbjct: 450 INELARAGVGVIVISSELPEIIGVADRVLVMREG 483


>PHNC1_RHOP2 RecName: Full=Phosphonates import ATP-binding protein
           phnC 1;         EC=3.6.3.28;
          Length = 280

 Score =  118 bits (296), Expect = 5e-29
 Identities = 82/252 (32%), Positives = 132/252 (52%), Gaps = 13/252 (5%)

Query: 3   LLEISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L I +L K +  G  A+++VS S+  G +  +IGP+GAGK+TL   +  +  P  G IR
Sbjct: 1   MLRIENLDKRYKTGDRALKDVSLSIGAGDIVGLIGPSGAGKSTLIRCVNRLVQPTGGSIR 60

Query: 62  LGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           LG   ++ L   +L  AR+ MG  FQ   +   +T +ENV+  G L           RFP
Sbjct: 61  LGDTELTRLGGTELRKARRRMGMIFQEFALIERLTVMENVL-SGRLGYVGFWASWFRRFP 119

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
              +AD    + A  L+  VGL   ++  A A+S G  +R+ IARALA  P +L +DEP 
Sbjct: 120 ---QADV---QRAFALLARVGLSEQVDKRADALSGGQRQRVGIARALAQDPELLLIDEPT 173

Query: 180 AGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           A  +PK + ++  L+ ++ A+ G+  ++  HD+ +      RI+ L  G  + +G A  +
Sbjct: 174 ASLDPKTSRQVMRLITELCAERGLAAIVNIHDVALAQLFLPRIVGLRAGEVVYDGPASGL 233

Query: 239 RDNPEVIAAYLG 250
              P+V+    G
Sbjct: 234 --TPDVLTRIYG 243


>XYLG_HAES1 RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 504

 Score =  118 bits (295), Expect = 6e-29
 Identities = 78/243 (32%), Positives = 127/243 (52%), Gaps = 22/243 (9%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD--GEI 60
           LLE+ +++K FG V+A+ N+S S++ G + S+ G NG+GK+TL  ++ GIY   D  GEI
Sbjct: 4   LLEMKNITKKFGDVVALNNISISLETGEILSLCGENGSGKSTLMKVLCGIYPSGDYEGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLD--RNLVKSMLRF 118
              GE ++         KG+    Q L +  NM+ +EN+ +G  ++     N  K  LR 
Sbjct: 64  YFSGEKLTAKNIKDTEEKGISIIHQELTLVKNMSVLENMFLGNEITQAGITNDNKMYLRC 123

Query: 119 PSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
            +L              +  V L+   N++ SA+  G  + +EIA+AL  + R+L LDEP
Sbjct: 124 KTL--------------LEQVQLDIDPNTKVSALGLGQQQLVEIAKALNKQVRLLILDEP 169

Query: 179 AAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVL----NYGRKLTEGS 234
            A    KET  + NL++ +    I  + + H +  V  ISD+I V+    + G +L +G 
Sbjct: 170 TASLTEKETDILLNLIKGLQAHNIACIYISHKLNEVKAISDKICVIRDGEHIGTQLAQGI 229

Query: 235 ARD 237
           + D
Sbjct: 230 SED 232



 Score = 59.3 bits (142), Expect = 4e-11
 Identities = 53/223 (23%), Positives = 99/223 (44%), Gaps = 30/223 (13%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVS------GLA 71
           V N +F + +G +  V G  G+G+T +   I G Y     G I L  + V        +A
Sbjct: 277 VDNANFILRKGEILGVAGLVGSGRTEMAQCIFGSYVGKYQGNIFLNNQKVKINKCAEAIA 336

Query: 72  PHQLA----RKGMGRTFQNLQICMNMTAIENVMVGG--HLSLDRNLVKSMLRFPSLRRAD 125
            H +     RK  G       I   M+  +N+ +         + ++   L    + ++ 
Sbjct: 337 NHIVMVPEDRKKHG-------IIPIMSVGKNITLSSLSQFCFGKKVINEPLEETIINQSI 389

Query: 126 AVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPK 185
           A L+   +   + +G           +S G  ++  +A+ L   P IL LDEP  G +  
Sbjct: 390 AKLKVKTSSPELAIG----------RLSGGNQQKAILAKCLLLHPNILILDEPTRGIDVG 439

Query: 186 ETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
              EI  L+ ++A  G++++++  ++  V+ ISDR+LV++ G+
Sbjct: 440 AKYEIYKLINQLAQEGMSIIVISSELPEVLGISDRVLVMHQGK 482


>METN_XYLFA RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 334

 Score =  118 bits (295), Expect = 6e-29
 Identities = 75/248 (30%), Positives = 134/248 (54%), Gaps = 23/248 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           +++  D  K +G     V A+Q ++  +  G V+ +IG +GAGK+T+  +I  +  P  G
Sbjct: 1   MIQFKDSYKHYGANGREVTALQPLNLEIHAGEVFGIIGHSGAGKSTMLRMINRLEEPSGG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L    L   R+ +G  FQ+  +  + TA       G+++    L  +  
Sbjct: 61  HLLINGQDITVLDRMGLRALRRQIGMIFQHFNLLSSYTA-------GNVAFPLKLTGA-- 111

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                  +DA +    AEL+ +VGLEA+ N+  + +S G  +R+ IARALA +P+IL  D
Sbjct: 112 -------SDAKINARVAELLAWVGLEAHANTYPAQLSGGQKQRVGIARALATRPQILLCD 164

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  +  L+ +I  + G+T+VL+ H+M ++  I DR+ VL+ GR +  G  
Sbjct: 165 EVTSALDPQTTTTVLQLLARINRELGLTIVLITHEMDVIRRICDRVAVLDTGRLVETGLV 224

Query: 236 RDVRDNPE 243
            DV  +P+
Sbjct: 225 TDVFLHPQ 232


>METN_RALSO RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 350

 Score =  118 bits (295), Expect = 6e-29
 Identities = 81/258 (31%), Positives = 140/258 (54%), Gaps = 25/258 (9%)

Query: 3   LLEISDLSKTFGG-----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           ++E+  +S+ F G     V A+++V  S+D+G ++ +IG +GAGK+TL  +I  +  P  
Sbjct: 1   MIELKGISQHFRGAGGTDVHALRDVDLSIDKGEIFGIIGRSGAGKSTLVRVINLLNRPTS 60

Query: 58  GEIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSM 115
           G + + G+ ++ L    L  AR+ +G  FQ+  +  + T  +NV           L   +
Sbjct: 61  GTVTVAGQSLTALNADGLRQARRKIGMIFQHFNLLSSRTVYDNVA----------LPLEL 110

Query: 116 LRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
              P  R     +RE    L+  VGL+A+ +   + +S G  +R+ IARALA++P +L  
Sbjct: 111 AGTPRER-----IREIVLPLLELVGLDAHKDRYPAQISGGQKQRVGIARALASQPDVLLS 165

Query: 176 DEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           DE  +  +P+ T  I +L+RKI  + G+T+VL+ H M+++  + DR+ VL+ GR +  G 
Sbjct: 166 DEATSALDPETTRSILDLLRKINRELGLTIVLITHQMEVIKQVCDRVAVLDAGRVVELGR 225

Query: 235 ARDVRDNP--EVIAAYLG 250
             DV   P  +V  A +G
Sbjct: 226 VIDVFLKPRHDVTRALIG 243


>METN2_ERWCT RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 338

 Score =  118 bits (295), Expect = 6e-29
 Identities = 75/230 (32%), Positives = 120/230 (52%), Gaps = 18/230 (7%)

Query: 17  LAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLA--PHQ 74
           LAV NVS  + +G VY ++G +GAGK+TL   I  +  P  G + + G L+S LA  P +
Sbjct: 20  LAVDNVSLHIQRGEVYGIVGTSGAGKSTLLRTINLLQRPTSGRVLVNGVLISELAGQPLR 79

Query: 75  LARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAE 134
             R+ +G  FQ+  +    T  ENV                L+      A+  LR    E
Sbjct: 80  EQRQKIGMIFQHFNLMQTRTVTENVAFS-------------LKAAGKSNAEITLR--VPE 124

Query: 135 LMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           ++  VGL    +S  + +S G  +R+ IARA+A  P +L  DEP +  + + +A I  L+
Sbjct: 125 ILSLVGLSDKASSYPAQLSGGQKQRVGIARAIANDPEVLLCDEPTSALDLETSAAILALL 184

Query: 195 RKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           ++I +  GIT+VL+ H+M ++  + DR+ V+  GR + EG   D+   P+
Sbjct: 185 KEINEKLGITIVLISHEMSVIKAVCDRVAVMTGGRVVEEGDVFDIFATPQ 234


>RGMG_THETN RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein;       
           EC=3.6.3.17;
          Length = 501

 Score =  117 bits (294), Expect = 8e-29
 Identities = 63/236 (26%), Positives = 133/236 (56%), Gaps = 12/236 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           L+ + ++SK F GV A++NV+F + +G V++++G NGAGK+TL  +++G+Y+   G+I  
Sbjct: 5   LIRMENISKEFPGVKALKNVNFEIKKGEVHALVGENGAGKSTLIKILSGVYSKDSGKIYF 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V   +P +  + G+    Q L +C+++T  +N+ +G      R  VK+ +     +
Sbjct: 65  DGREVEINSPKEAQQLGISVIHQELNLCLHLTVAQNIFLG------REFVKNGVIDEKKQ 118

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             +A  ++   +L V +    Y+ +    +S    + +EIA+A++ + +++ +DEP +  
Sbjct: 119 NEEA--KKILEKLNVNIDPAEYVKN----LSVSRQQMVEIAKAISMEAKVIIMDEPTSAI 172

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           + KET E+  ++ ++   G +++ + H ++ +  I DR+ VL  G  +   + RD+
Sbjct: 173 SEKETEELFKVIGELKKQGKSIIYISHRLEELNRIVDRVTVLRDGEHIITANFRDL 228



 Score = 61.2 bits (147), Expect = 9e-12
 Identities = 48/231 (20%), Positives = 108/231 (46%), Gaps = 19/231 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+  LS+       ++++SF + +G +    G  GAG+T +   I G      GEI +
Sbjct: 257 ILEVHGLSQG----TRLKDISFDLYEGEILGFAGLVGAGRTEVARAIFGADKFDKGEILI 312

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQI---CMNMTAIENVMVGGHLSLDR--NLVKSMLR 117
            G+ V   +P    + G+    ++ ++    +N++ + N+ +    ++D   N++  +  
Sbjct: 313 NGKKVEINSPIDAIKNGLAYVPEDRKLTGLALNLSVLANITLA---TMDNVVNMLSVINS 369

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
               +  + ++R+   +          L      +S G  +++ + R L  +P+I   DE
Sbjct: 370 VKERKIGEKIIRDLKIKT-------PSLFQRVQNLSGGNQQKVIVGRWLLREPQIYIFDE 422

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P  G +     EI N++  +   G  ++++  ++  +M I+DR++V+  GR
Sbjct: 423 PTRGIDVGAKIEIYNILNNLKQEGKGIIVISSELPEIMGITDRVVVMCEGR 473


>RGMG2_BURS3 RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 2;       
           EC=3.6.3.17;
          Length = 527

 Score =  117 bits (294), Expect = 8e-29
 Identities = 70/236 (29%), Positives = 122/236 (51%), Gaps = 11/236 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+  + K+F GV+A+  V F V +G V++++G NGAGK+TL  +I G+YTP  GEI +
Sbjct: 37  VLEVRGVGKSFPGVVALDGVQFRVRRGTVHALMGENGAGKSTLMKIIAGVYTPDQGEILI 96

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V    P     +G+    Q L +   MT  EN+ +       R   K+  RF  + 
Sbjct: 97  NGEPVVLNGPLDALDRGIAMIHQELNLMPYMTVAENIWI-------RREPKN--RFGLID 147

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
              A LR   AEL   + ++    ++   ++  + + +EIA+A++    +L +DEP +  
Sbjct: 148 H--AALRRQTAELFERLSIDIDPETDVRTLTVASRQMVEIAKAVSFDSDVLIMDEPTSAL 205

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
             KE   +  ++R++ + G  +V + H M  +  I+D   V   G+ +   ++ DV
Sbjct: 206 TDKEVTHLFRIIRQLREQGKGIVYITHKMNELFEIADEFSVFRDGKYIGTHASSDV 261



 Score = 85.9 bits (211), Expect = 4e-19
 Identities = 63/219 (28%), Positives = 106/219 (48%), Gaps = 25/219 (11%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VSF +  G +  V G  G+G++ +   + G+     GEIR+ G+ V    P Q  + G
Sbjct: 303 RDVSFELRAGEILGVAGLVGSGRSNVAEALFGVVPATSGEIRIDGKPVRITTPGQAMKHG 362

Query: 80  MG---------RTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLRE 130
           M            F NL +  NM A               L    ++F  +R+A   L+ 
Sbjct: 363 MAFLTEDRKDTGCFLNLDLLANMEAAV-------------LSNRYVKFNFVRQAQ--LKR 407

Query: 131 HAAELMVYVGLEAY-LNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
              E+   + +++  L+ E   +S G  +++ I R L  +PRIL LDEP  G +    AE
Sbjct: 408 DCEEMSRMLRVKSPGLHEEIQNLSGGNQQKVLIGRWLLTQPRILILDEPTRGIDVGAKAE 467

Query: 190 IDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           I  LV  +A  G+ V+++  +M  V+ +SDR++V++ GR
Sbjct: 468 IHRLVSALAGKGVAVLMISSEMPEVLGMSDRVMVMHEGR 506


>METN_XYLFT RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 335

 Score =  117 bits (294), Expect = 8e-29
 Identities = 75/248 (30%), Positives = 135/248 (54%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           +++  D  K +G     V A+Q ++  +  G V+ +IG +GAGK+T+  +I  +  P  G
Sbjct: 1   MIQFKDSYKHYGANGREVTALQPLNLEIRAGEVFGIIGHSGAGKSTMLRMINRLEEPSGG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L    L   R+ +G  FQ+  +  + T      V G+++    L  +  
Sbjct: 61  HLLINGQDITVLDRMGLRALRRQIGMIFQHFNLLSSYT------VAGNVAFPLKLTGA-- 112

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                  +DA +    AEL+ +VGLEA+ N+  + +S G  +R+ IARALA +P+IL  D
Sbjct: 113 -------SDAKINARVAELLAWVGLEAHANTYPAQLSGGQKQRVGIARALATRPQILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T+ +  L+ +I  + G+T+VL+ H+M ++  I DR+ VL+ GR +  G  
Sbjct: 166 EVTSALDPQTTSTVLQLLARINRELGLTIVLITHEMDVIRRICDRVAVLDTGRLVEIGLV 225

Query: 236 RDVRDNPE 243
            DV  +P+
Sbjct: 226 TDVFLHPQ 233


>LPTB_THIFE RecName: Full=Lipopolysaccharide export system
           ATP-binding protein lptB;         EC=3.6.3.-;
          Length = 241

 Score =  117 bits (294), Expect = 8e-29
 Identities = 74/248 (29%), Positives = 118/248 (47%), Gaps = 15/248 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL+   L K++               G V  ++GPNGAGKTT F ++ G+  P  G I L
Sbjct: 4   LLQAQSLFKSYXXXXXXXXXXXXXATGEVVGLLGPNGAGKTTTFYMMVGLVRPDRGHIFL 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
               ++ L  H+ AR G+G   Q   +   M+A +NV+                   +L 
Sbjct: 64  QQRDITALPMHERARMGLGYLPQEPSVFRQMSAADNVLAV---------------LETLP 108

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            +                     +++  ++S G  +R+EIARALA  PR + LDEP AG 
Sbjct: 109 LSPVXXXXXXXXXXXXXXXXXXXDTKGHSLSGGERRRVEIARALAMSPRFILLDEPFAGI 168

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
           +P    EI  L+R +   GI V++ +H+++  + I +R  +L+ G+ LT GS +++ D+P
Sbjct: 169 DPISVLEIQRLIRDLRARGIGVLITDHNVRETLGICERAYILHDGKVLTAGSPQEIVDDP 228

Query: 243 EVIAAYLG 250
            V   YLG
Sbjct: 229 MVRQVYLG 236


>RGMG_BURXL RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein;       
           EC=3.6.3.17;
          Length = 504

 Score =  117 bits (293), Expect = 1e-28
 Identities = 69/236 (29%), Positives = 123/236 (52%), Gaps = 10/236 (4%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L+ +  L+K+F GV A+  V F +  G V++++G NGAGK+TL  ++ G+YT   GEI 
Sbjct: 3   SLISVKRLNKSFPGVRALHEVQFELMAGEVHALMGENGAGKSTLMKILAGVYTRDSGEIL 62

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
             G+ V  L+P      G+G   Q LQ+  ++T  +N+ +                  + 
Sbjct: 63  YDGQPVEFLSPRDAQAVGVGIIHQELQLMNHLTVAQNIFIXXXXXXXXXXXXXXXXXNA- 121

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
            +A A+L        ++V L+    +   A++    + +EIA+AL+   R+L +DEP + 
Sbjct: 122 -QAAAILAR------MHVSLDP--RAVVGALTVARQQMVEIAKALSFDSRVLIMDEPTSA 172

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            N  E AE+  ++R++   G+ +V + H M  +  I+DR+ V+  G  +   +ARD
Sbjct: 173 LNDAEIAELFRIIRELKSRGVGIVYISHKMDELKQIADRVTVMRDGEYVATVAARD 228



 Score = 70.9 bits (172), Expect = 1e-14
 Identities = 62/225 (27%), Positives = 109/225 (48%), Gaps = 17/225 (7%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V++VSF++ +G +    G  GAG+T +   + G      GEI + G   +   P      
Sbjct: 271 VRDVSFALRKGEILGFAGLMGAGRTEVARAVFGADPVESGEIVVNGARATIRTPSDAVAH 330

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR-FPSL----RRADAVLREHAA 133
           G+G   ++ +     T ++         ++ N+V S LR F SL    RRA   +R  A+
Sbjct: 331 GIGYLSEDRKRFGLATGMD---------VESNIVMSNLRKFLSLNFFLRRAQ--IRRTAS 379

Query: 134 ELMVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDN 192
             +  +G+     ++A   +S G  +++ IA+ L     +LF DEP  G +     EI  
Sbjct: 380 HFISLLGIRTPSATQAVRLLSGGNQQKIVIAKWLERDCDVLFFDEPTRGIDVGAKNEIYK 439

Query: 193 LVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
           L+R +A  G  VV++  ++  ++ +SDR++V+  GR   E SA +
Sbjct: 440 LLRSLAGEGKAVVMISSELPEILRMSDRVIVMCEGRITGELSAAE 484


>RGMG2_BURCM RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 2;       
           EC=3.6.3.17;
          Length = 524

 Score =  117 bits (293), Expect = 1e-28
 Identities = 70/236 (29%), Positives = 122/236 (51%), Gaps = 11/236 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+  + K+F GV+A+  V F V +G V++++G NGAGK+TL  +I G+YTP  GEI +
Sbjct: 34  LLEVRGVGKSFPGVVALDGVQFRVRRGTVHALMGENGAGKSTLMKIIAGVYTPDQGEILI 93

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V    P     +G+    Q L +   MT  EN+ +       R   K+  RF  + 
Sbjct: 94  NGEPVVLSGPLDALDRGIAMIHQELNLMPYMTVAENIWI-------RREPKN--RFGLID 144

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
              A LR   A L   + ++    ++   ++  + + +EIA+A++    +L +DEP +  
Sbjct: 145 H--AALRRRTAALFERLSIDIDPEADVRTLTVASRQMVEIAKAVSFDSDVLIMDEPTSAL 202

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
             KE + +  ++R++ + G  +V + H M  +  I+D   V   G+ +   ++ DV
Sbjct: 203 TDKEVSHLFRIIRQLREQGKGIVYITHKMNELFEIADEFSVFRDGKYIGTHASTDV 258



 Score = 86.3 bits (212), Expect = 3e-19
 Identities = 69/231 (29%), Positives = 106/231 (45%), Gaps = 32/231 (13%)

Query: 16  VLAVQN---------VSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGEL 66
           VLAV+N         VSF +  G +  V G  G+G++ +   + G+     GEIR+ G+ 
Sbjct: 287 VLAVKNLGVDGVFRDVSFELRAGEILGVAGLVGSGRSNVAEALFGVVPATAGEIRIDGKP 346

Query: 67  VSGLAPHQLARKGMG---------RTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR 117
           V    P Q  + GM            F NL +  NM A               L    ++
Sbjct: 347 VRITTPAQAMKHGMAFLTEDRKDTGCFLNLDLLANMEAAV-------------LSNRYVK 393

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           F  +R+A       A   M+ V     L+ E   +S G  +++ I R L  +PRIL LDE
Sbjct: 394 FNFVRQAQLKRDCEAMSRMLRVKTPG-LHEEIQNLSGGNQQKVLIGRWLLTQPRILILDE 452

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P  G +    AEI  LV  +A  G+ V+++  +M  V+ +SDR++V++ GR
Sbjct: 453 PTRGIDVGAKAEIHRLVSALAGKGVAVLMISSEMPEVLGMSDRVMVMHEGR 503


>METN_STRPD RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  117 bits (293), Expect = 1e-28
 Identities = 78/255 (30%), Positives = 138/255 (54%), Gaps = 29/255 (11%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV++V+  ++QG +Y ++G +GAGK+TL  +I  +  P +
Sbjct: 4   AIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTN 63

Query: 58  GEIRLGGELVSGLAPHQLA-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I + G++       QL+       R+ +G  FQ+  +    TA ENV           
Sbjct: 64  GKITVDGDVTFDQGKIQLSADALRQKRRDIGMIFQHFNLMAQKTAKENVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREH-AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAK 169
                LR  SL + +   +EH   EL+  VGL    ++  + +S G  +R+ IARALA  
Sbjct: 116 -----LRHSSLSKTE---KEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALAND 167

Query: 170 PRILFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P+IL  DE  +  +PK T +I  L++++    G+T+V++ H+M++V +I +R+ V+  G 
Sbjct: 168 PKILISDEATSALDPKTTKQILALLQELNCKLGLTIVMITHEMQIVKDICNRVAVMQNGV 227

Query: 229 KLTEGSARDVRDNPE 243
            + EGS  D+  NP+
Sbjct: 228 LIEEGSVLDIFSNPK 242


>CYSA_BRUSU RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase;
          Length = 359

 Score =  117 bits (293), Expect = 1e-28
 Identities = 74/240 (30%), Positives = 124/240 (51%), Gaps = 15/240 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + ++ + K F    A+ NVS ++  G + +++GP+G+GKTTL  LI G+ TP +G I  G
Sbjct: 3   VRVAGVRKEFARFPALHNVSLTIQSGELIALLGPSGSGKTTLLRLIAGLETPTEGMIFFG 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
            E  S      +  + +G  FQ+  +  +MT  +N+  G             +R    R 
Sbjct: 63  DEDAS---QKSVQERNVGFVFQHYALFRHMTVADNIGFG-----------LKVRPGGTRP 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           + A +R  A EL+  V L        + +S G  +R+ +ARA+A +PR+L LDEP    +
Sbjct: 109 STAEIRRRALELLDLVQLSGLEKRYPAQLSGGQRQRVALARAMAIEPRVLLLDEPFGALD 168

Query: 184 PKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            +   E+   +R+I D +G T V V HD    + ++DR++V++ GR    G+  +V D P
Sbjct: 169 AQVRKELRRWLREIHDKTGHTTVFVTHDQDEALELADRVVVMSQGRIEQVGTPDEVYDKP 228


>CYSA_BRUME RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase;
          Length = 359

 Score =  117 bits (293), Expect = 1e-28
 Identities = 74/240 (30%), Positives = 124/240 (51%), Gaps = 15/240 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + ++ + K F    A+ NVS ++  G + +++GP+G+GKTTL  LI G+ TP +G I  G
Sbjct: 3   VRVAGVRKEFARFPALHNVSLTIQSGELIALLGPSGSGKTTLLRLIAGLETPTEGMIFFG 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
            E  S      +  + +G  FQ+  +  +MT  +N+  G             +R    R 
Sbjct: 63  DEDAS---QKSVQERNVGFVFQHYALFRHMTVADNIGFG-----------LKVRPGGTRP 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           + A +R  A EL+  V L        + +S G  +R+ +ARA+A +PR+L LDEP    +
Sbjct: 109 STAEIRRRALELLDLVQLSGLEKRYPAQLSGGQRQRVALARAMAIEPRVLLLDEPFGALD 168

Query: 184 PKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            +   E+   +R+I D +G T V V HD    + ++DR++V++ GR    G+  +V D P
Sbjct: 169 AQVRKELRRWLREIHDKTGHTTVFVTHDQDEALELADRVVVMSQGRIEQVGTPDEVYDKP 228


>RBSA1_BURCH RecName: Full=Ribose import ATP-binding protein rbsA 1;
                   EC=3.6.3.17;
          Length = 517

 Score =  117 bits (292), Expect = 1e-28
 Identities = 70/226 (30%), Positives = 121/226 (53%), Gaps = 9/226 (3%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIY-TPCDGEIR 61
           LLE+  +SKTF  V A+ NVS +V  G ++S++G NGAGK+TL  +++G Y     GEI 
Sbjct: 10  LLEMRGISKTFPAVRALDNVSLTVYPGEIHSLMGENGAGKSTLMKILSGAYRADAGGEIL 69

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + G+ +    P      G+   +Q L +  N+T  EN+ VG      R L +   R+ ++
Sbjct: 70  IDGQRIEIDGPLAARDAGVAVIYQELCLSPNLTVAENIYVG------RELRRGNRRWGTI 123

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
            RA   +     +++  +G     ++    +S    + +EIARA+  + RIL +DEP   
Sbjct: 124 DRA--AMARGCQDVLARLGAPFGPDTLVDTLSIAEQQLVEIARAVHTRARILVMDEPTTP 181

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            + +ET  +  L+R++ + G+ ++ + H M  +  +SDR+ VL  G
Sbjct: 182 LSSRETEHLFRLIRQLREEGLAIIYISHRMAEIYELSDRVSVLRDG 227



 Score = 67.4 bits (163), Expect = 1e-13
 Identities = 52/214 (24%), Positives = 93/214 (43%), Gaps = 16/214 (7%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V+  S  +  G V  + G  GAG+T L  LI G      G+++LG       +P      
Sbjct: 281 VRGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRVRGDVKLGERTFGAHSPRDAIDA 340

Query: 79  GM-----GRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
           G+      R  Q L + M++    N+ V                               A
Sbjct: 341 GLVYLTEDRKRQGLFLDMSVRDNINISVCNXXXXXXXXXXXXXXXXXXXXI--------A 392

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
            L + V    + N    A+S G  +++ ++R L  KPR+L LDEP  G +    +EI  +
Sbjct: 393 SLSIRV---PHANVNVGALSGGNQQKVLLSRLLETKPRVLILDEPTRGVDIGAKSEIYRI 449

Query: 194 VRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           + ++A +G+ V+++  ++  ++ ++DR+LV+  G
Sbjct: 450 INELARAGVGVIVISSELPEIIGVADRVLVMREG 483


>RBSA1_BURCA RecName: Full=Ribose import ATP-binding protein rbsA 1;
                   EC=3.6.3.17;
          Length = 517

 Score =  117 bits (292), Expect = 1e-28
 Identities = 70/226 (30%), Positives = 121/226 (53%), Gaps = 9/226 (3%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIY-TPCDGEIR 61
           LLE+  +SKTF  V A+ NVS +V  G ++S++G NGAGK+TL  +++G Y     GEI 
Sbjct: 10  LLEMRGISKTFPAVRALDNVSLTVYPGEIHSLMGENGAGKSTLMKILSGAYRADAGGEIL 69

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + G+ +    P      G+   +Q L +  N+T  EN+ VG      R L +   R+ ++
Sbjct: 70  IDGQRIEIDGPLAARDAGVAVIYQELCLSPNLTVAENIYVG------RELRRGNRRWGTI 123

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
            RA   +     +++  +G     ++    +S    + +EIARA+  + RIL +DEP   
Sbjct: 124 DRA--AMARGCQDVLARLGAPFGPDTLVDTLSIAEQQLVEIARAVHTRARILVMDEPTTP 181

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            + +ET  +  L+R++ + G+ ++ + H M  +  +SDR+ VL  G
Sbjct: 182 LSSRETEHLFRLIRQLREEGLAIIYISHRMAEIYELSDRVSVLRDG 227



 Score = 67.4 bits (163), Expect = 1e-13
 Identities = 52/214 (24%), Positives = 93/214 (43%), Gaps = 16/214 (7%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V+  S  +  G V  + G  GAG+T L  LI G      G+++LG       +P      
Sbjct: 281 VRGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRVRGDVKLGERTFGAHSPRDAIDA 340

Query: 79  GM-----GRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
           G+      R  Q L + M++    N+ V                               A
Sbjct: 341 GLVYLTEDRKRQGLFLDMSVRDNINISVCNXXXXXXXXXXXXXXXXXXXXI--------A 392

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
            L + V    + N    A+S G  +++ ++R L  KPR+L LDEP  G +    +EI  +
Sbjct: 393 SLSIRV---PHANVNVGALSGGNQQKVLLSRLLETKPRVLILDEPTRGVDIGAKSEIYRI 449

Query: 194 VRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           + ++A +G+ V+++  ++  ++ ++DR+LV+  G
Sbjct: 450 INELARAGVGVIVISSELPEIIGVADRVLVMREG 483


>NODI_RHIS3 RecName: Full=Nod factor export ATP-binding protein I;  
                 EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 304

 Score =  117 bits (292), Expect = 1e-28
 Identities = 75/232 (32%), Positives = 123/232 (53%), Gaps = 19/232 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           ++++ + K+FG  L V  +SF+V  G  + ++GPNGAGK+T+  ++ G+  P  G+I + 
Sbjct: 6   IDLAGVKKSFGDKLVVNGLSFTVASGECFGLLGPNGAGKSTIARMLLGMTVPDAGKITVL 65

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMV-GGHLSLDRNLVKSMLRFPSLR 122
           GE V   A  +LARK +G   Q   +    T  EN++V G +  +    +K ++  PSL 
Sbjct: 66  GEPVG--ARSRLARKSIGVVPQFDNLDQEFTVRENLLVFGRYFGMSTRKIKEVI--PSL- 120

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                        + +  LE+  ++    +S G  +RL +ARAL   P++L +DEP  G 
Sbjct: 121 -------------LEFARLESKADARVGELSGGMKRRLTLARALINDPQLLVMDEPTTGL 167

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           +P     I   +R +   G T++L  H M+    + DR+ VL +GRKL EGS
Sbjct: 168 DPHARHLIWERLRFLLARGKTIILTTHFMEEAERLCDRLCVLEHGRKLAEGS 219


>METN_STRPM RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  117 bits (292), Expect = 1e-28
 Identities = 78/255 (30%), Positives = 138/255 (54%), Gaps = 29/255 (11%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV++V+  ++QG +Y ++G +GAGK+TL  +I  +  P +
Sbjct: 4   AIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTN 63

Query: 58  GEIRLGGELVSGLAPHQLA-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I + G++       QL+       R+ +G  FQ+  +    TA ENV           
Sbjct: 64  GKITVDGDVTFDQGKIQLSADALRQKRRDIGMIFQHFNLMAQKTAKENVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREH-AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAK 169
                LR  SL + +   +EH   EL+  VGL    ++  + +S G  +R+ IARALA  
Sbjct: 116 -----LRHSSLSKTE---KEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALAND 167

Query: 170 PRILFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P+IL  DE  +  +PK T +I  L++++    G+T+V++ H+M++V +I +R+ V+  G 
Sbjct: 168 PKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGV 227

Query: 229 KLTEGSARDVRDNPE 243
            + EGS  D+  NP+
Sbjct: 228 LIEEGSVLDIFSNPK 242


>METN_STRPC RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  117 bits (292), Expect = 1e-28
 Identities = 78/255 (30%), Positives = 138/255 (54%), Gaps = 29/255 (11%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV++V+  ++QG +Y ++G +GAGK+TL  +I  +  P +
Sbjct: 4   AIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTN 63

Query: 58  GEIRLGGELVSGLAPHQLA-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I + G++       QL+       R+ +G  FQ+  +    TA ENV           
Sbjct: 64  GKITVDGDVTFDQGKVQLSANALRQKRRDIGMIFQHFNLMAQKTAKENVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREH-AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAK 169
                LR  SL + +   +EH   EL+  VGL    ++  + +S G  +R+ IARALA  
Sbjct: 116 -----LRHSSLSKTE---KEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALAND 167

Query: 170 PRILFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P+IL  DE  +  +PK T +I  L++++    G+T+V++ H+M++V +I +R+ V+  G 
Sbjct: 168 PKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGV 227

Query: 229 KLTEGSARDVRDNPE 243
            + EGS  D+  NP+
Sbjct: 228 LIEEGSVLDIFSNPK 242


>METN_STRPB RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  117 bits (292), Expect = 1e-28
 Identities = 78/255 (30%), Positives = 138/255 (54%), Gaps = 29/255 (11%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV++V+  ++QG +Y ++G +GAGK+TL  +I  +  P +
Sbjct: 4   AIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTN 63

Query: 58  GEIRLGGELVSGLAPHQLA-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I + G++       QL+       R+ +G  FQ+  +    TA ENV           
Sbjct: 64  GKITVDGDVTFDQGKVQLSANALRQKRRDIGMIFQHFNLMAQKTAKENVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREH-AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAK 169
                LR  SL + +   +EH   EL+  VGL    ++  + +S G  +R+ IARALA  
Sbjct: 116 -----LRHSSLSKTE---KEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALAND 167

Query: 170 PRILFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P+IL  DE  +  +PK T +I  L++++    G+T+V++ H+M++V +I +R+ V+  G 
Sbjct: 168 PKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGV 227

Query: 229 KLTEGSARDVRDNPE 243
            + EGS  D+  NP+
Sbjct: 228 LIEEGSVLDIFSNPK 242


>METN_STRP6 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  117 bits (292), Expect = 1e-28
 Identities = 78/255 (30%), Positives = 138/255 (54%), Gaps = 29/255 (11%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV++V+  ++QG +Y ++G +GAGK+TL  +I  +  P +
Sbjct: 4   AIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTN 63

Query: 58  GEIRLGGELVSGLAPHQLA-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I + G++       QL+       R+ +G  FQ+  +    TA ENV           
Sbjct: 64  GKITVDGDVTFDQGKIQLSANALRQKRRDIGMIFQHFNLMAQKTAKENVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREH-AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAK 169
                LR  SL + +   +EH   EL+  VGL    ++  + +S G  +R+ IARALA  
Sbjct: 116 -----LRHSSLSKTE---KEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALAND 167

Query: 170 PRILFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P+IL  DE  +  +PK T +I  L++++    G+T+V++ H+M++V +I +R+ V+  G 
Sbjct: 168 PKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGV 227

Query: 229 KLTEGSARDVRDNPE 243
            + EGS  D+  NP+
Sbjct: 228 LIEEGSVLDIFSNPK 242


>METN_STRP1 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  117 bits (292), Expect = 1e-28
 Identities = 78/255 (30%), Positives = 138/255 (54%), Gaps = 29/255 (11%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV++V+  ++QG +Y ++G +GAGK+TL  +I  +  P +
Sbjct: 4   AIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTN 63

Query: 58  GEIRLGGELVSGLAPHQLA-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I + G++       QL+       R+ +G  FQ+  +    TA ENV           
Sbjct: 64  GKITVDGDVTFDQGKIQLSADALRQKRRDIGMIFQHFNLMAQKTAKENVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREH-AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAK 169
                LR  SL + +   +EH   EL+  VGL    ++  + +S G  +R+ IARALA  
Sbjct: 116 -----LRHSSLSKTE---KEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALAND 167

Query: 170 PRILFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P+IL  DE  +  +PK T +I  L++++    G+T+V++ H+M++V +I +R+ V+  G 
Sbjct: 168 PKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGV 227

Query: 229 KLTEGSARDVRDNPE 243
            + EGS  D+  NP+
Sbjct: 228 LIEEGSVLDIFSNPK 242


>METN_STRP3 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  116 bits (291), Expect = 2e-28
 Identities = 78/255 (30%), Positives = 138/255 (54%), Gaps = 29/255 (11%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV++V+  ++QG +Y ++G +GAGK+TL  +I  +  P +
Sbjct: 4   AIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTN 63

Query: 58  GEIRLGGELVSGLAPHQLA-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I + G++       QL+       R+ +G  FQ+  +    TA ENV           
Sbjct: 64  GKITVDGDVTFEQGKVQLSANALRQKRRDIGMIFQHFNLMAQKTAKENVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREH-AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAK 169
                LR  SL + +   +EH   EL+  VGL    ++  + +S G  +R+ IARALA  
Sbjct: 116 -----LRHSSLSKTE---KEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALAND 167

Query: 170 PRILFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P+IL  DE  +  +PK T +I  L++++    G+T+V++ H+M++V +I +R+ V+  G 
Sbjct: 168 PKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGV 227

Query: 229 KLTEGSARDVRDNPE 243
            + EGS  D+  NP+
Sbjct: 228 LIEEGSVLDIFSNPK 242


>METN_RALEH RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 344

 Score =  116 bits (291), Expect = 2e-28
 Identities = 83/257 (32%), Positives = 134/257 (52%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+  LS+ F    G V A+++VS S+  G V+ +IG +GAGK+TL   I  +  P  G
Sbjct: 1   MIELQGLSQRFPGASGDVHALRDVSLSIAAGEVFGIIGRSGAGKSTLVRAINLLNRPSSG 60

Query: 59  EIRLGGELVSGL--APHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L     +LAR+ +G  FQ+  +  + T  ENV           L   + 
Sbjct: 61  RVIVAGQELTALDTGALRLARREIGMIFQHFNLLSSRTVYENVA----------LPLELA 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
             P    A  VL      L+  VGL A      + +S G  +R+ IARALA+KP++L  D
Sbjct: 111 GKPKAEIAATVL-----PLLDLVGLSALKGRYPAQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+++I  D G+T+V++ H M+++  + DR+ VL  GR +  G  
Sbjct: 166 EATSALDPETTRSILELLKQINRDLGLTIVMITHQMEVIKQVCDRVAVLEAGRVVETGRV 225

Query: 236 RDV--RDNPEVIAAYLG 250
            DV  R   +V  A +G
Sbjct: 226 IDVFLRPQHDVTRAMIG 242


>METN_BRAJA RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 346

 Score =  116 bits (291), Expect = 2e-28
 Identities = 74/250 (29%), Positives = 133/250 (53%), Gaps = 24/250 (9%)

Query: 3   LLEISDLSKTFG------GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPC 56
           ++    +SKT+       GV A+Q++ F++ +G +  VIG +GAGK++L  LI G+  P 
Sbjct: 1   MVRFEGISKTYPAYRGKPGVNALQDIDFAIPRGSITGVIGRSGAGKSSLVRLINGLEKPT 60

Query: 57  DGEIRLGGELVSGLAPHQ--LARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKS 114
            G + +  + +S LA  +  LA++ +G  FQ+  +  + TA +N+ +             
Sbjct: 61  TGRVIVDNKDISALAGRELRLAQRSIGMIFQHFNLLSSRTAADNIAL------------- 107

Query: 115 MLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILF 174
            L      RAD  ++   AEL+  VG+    +   S +S G  +R+ IARALA +P +L 
Sbjct: 108 PLEIAGWARAD--IKARVAELLALVGIADKHDRYPSELSGGQKQRVGIARALATRPSVLL 165

Query: 175 LDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
            DE  +  +P+ T  I +L+  I  + G+T+VL+ H+M +V  ++  ++VL+ G  +  G
Sbjct: 166 SDEATSALDPQTTRAILDLLANINRELGVTIVLITHEMSVVRQLAREVVVLDAGHVVESG 225

Query: 234 SARDVRDNPE 243
              D+  +P+
Sbjct: 226 HVADIFTHPK 235


>METN2_BACCZ RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 339

 Score =  116 bits (291), Expect = 2e-28
 Identities = 76/248 (30%), Positives = 135/248 (54%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF--GG--VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++  +++SK +  GG  V AV++V+ SV++G ++ +IG +GAGK+TL  L+  +  P  G
Sbjct: 1   MISFNNVSKVYESGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKSTLLRLVNMLERPTAG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I +  + ++ L+  +L   R+ +G  FQ+  +  + T   N+                L
Sbjct: 61  TISIDDKEITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIAYP-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           R   + + +  ++E   EL+ +VGLE   N+    +S G  +R+ IARALA  P IL  D
Sbjct: 108 RLAKVPKNE--IKERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILICD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T EI NL++K+  +  +T++L+ H+M +V  I  R+ V+  G+ + EG  
Sbjct: 166 EATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEEGKL 225

Query: 236 RDVRDNPE 243
            DV   P+
Sbjct: 226 FDVFTQPK 233


>RGMG1_BURCH RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 1;       
           EC=3.6.3.17;
          Length = 524

 Score =  116 bits (290), Expect = 2e-28
 Identities = 69/236 (29%), Positives = 122/236 (51%), Gaps = 11/236 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+  + K+F GV+A+  V F V +G V++++G NGAGK+TL  +I G+YTP  GEI +
Sbjct: 34  VLEVRGVGKSFPGVVALDGVQFRVRRGTVHALMGENGAGKSTLMKIIAGVYTPDQGEILI 93

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V    P     +G+    Q L +   MT  EN+ +       R   K+  RF  + 
Sbjct: 94  NGEPVVLNGPLDALDRGIAMIHQELNLMPYMTVAENIWI-------RREPKN--RFGLID 144

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            A+  LR   A L   + ++    ++   ++  + + +EIA+A++    +L +DEP +  
Sbjct: 145 HAE--LRRRTAALFERLSIDIDPETDVRTLTVASRQMVEIAKAVSFDSDVLIMDEPTSAL 202

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
             KE   +  ++R++ + G  +V + H M  +  I+D   V   G+ +   ++ DV
Sbjct: 203 TDKEVTHLFRIIRQLREQGKGIVYITHKMNELFEIADEFSVFRDGKYIGTHASSDV 258



 Score = 85.1 bits (209), Expect = 6e-19
 Identities = 65/219 (29%), Positives = 107/219 (48%), Gaps = 25/219 (11%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VSF +  G +  V G  G+G++ +   + G+     GEIR+ G+ V    P Q  + G
Sbjct: 300 RDVSFELRAGEILGVAGLVGSGRSNVAEALFGVVPATSGEIRIDGKPVRISTPAQAMKHG 359

Query: 80  MG---------RTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLRE 130
           M            F NL +  NM A           L R  VK    F  +++A   L+ 
Sbjct: 360 MAFLTEDRKDSGCFLNLDLLANMEAAV---------LSRRYVK----FNFVQQAQ--LKR 404

Query: 131 HAAELMVYVGLEAY-LNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
              E+   + +++  L+ E   +S G  +++ I R L  +PRIL LDEP  G +    AE
Sbjct: 405 DCEEMSRMLRVKSPGLHEEIQNLSGGNQQKVLIGRWLLTQPRILILDEPTRGIDVGAKAE 464

Query: 190 IDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           I  LV  +A  G+ V+++  +M  V+ +SDR++V++ GR
Sbjct: 465 IHRLVSALAGKGVAVLMISSEMPEVLGMSDRVMVMHEGR 503


>RGMG1_BURCA RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 1;       
           EC=3.6.3.17;
          Length = 524

 Score =  116 bits (290), Expect = 2e-28
 Identities = 69/236 (29%), Positives = 122/236 (51%), Gaps = 11/236 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+  + K+F GV+A+  V F V +G V++++G NGAGK+TL  +I G+YTP  GEI +
Sbjct: 34  VLEVRGVGKSFPGVVALDGVQFRVRRGTVHALMGENGAGKSTLMKIIAGVYTPDQGEILI 93

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V    P     +G+    Q L +   MT  EN+ +       R   K+  RF  + 
Sbjct: 94  NGEPVVLNGPLDALDRGIAMIHQELNLMPYMTVAENIWI-------RREPKN--RFGLID 144

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            A+  LR   A L   + ++    ++   ++  + + +EIA+A++    +L +DEP +  
Sbjct: 145 HAE--LRRRTAALFERLSIDIDPETDVRTLTVASRQMVEIAKAVSFDSDVLIMDEPTSAL 202

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
             KE   +  ++R++ + G  +V + H M  +  I+D   V   G+ +   ++ DV
Sbjct: 203 TDKEVTHLFRIIRQLREQGKGIVYITHKMNELFEIADEFSVFRDGKYIGTHASSDV 258



 Score = 85.1 bits (209), Expect = 6e-19
 Identities = 65/219 (29%), Positives = 107/219 (48%), Gaps = 25/219 (11%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VSF +  G +  V G  G+G++ +   + G+     GEIR+ G+ V    P Q  + G
Sbjct: 300 RDVSFELRAGEILGVAGLVGSGRSNVAEALFGVVPATSGEIRIDGKPVRISTPAQAMKHG 359

Query: 80  MG---------RTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLRE 130
           M            F NL +  NM A           L R  VK    F  +++A   L+ 
Sbjct: 360 MAFLTEDRKDSGCFLNLDLLANMEAAV---------LSRRYVK----FNFVQQAQ--LKR 404

Query: 131 HAAELMVYVGLEAY-LNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
              E+   + +++  L+ E   +S G  +++ I R L  +PRIL LDEP  G +    AE
Sbjct: 405 DCEEMSRMLRVKSPGLHEEIQNLSGGNQQKVLIGRWLLTQPRILILDEPTRGIDVGAKAE 464

Query: 190 IDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           I  LV  +A  G+ V+++  +M  V+ +SDR++V++ GR
Sbjct: 465 IHRLVSALAGKGVAVLMISSEMPEVLGMSDRVMVMHEGR 503


>RBSA2_BURTA RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 517

 Score =  116 bits (290), Expect = 2e-28
 Identities = 72/226 (31%), Positives = 120/226 (53%), Gaps = 9/226 (3%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIY-TPCDGEIR 61
           LLE+  +SKTF  V A+  VS +V  G ++S++G NGAGK+TL  +++G Y     GEI 
Sbjct: 10  LLEMRGISKTFPAVRALAGVSLTVHPGEIHSLMGENGAGKSTLIKILSGAYQADPGGEIL 69

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + G  +S   P      G+   +Q L +  N+T  EN+ VG      R L +   R+ ++
Sbjct: 70  IDGAPISIDGPLAARDAGVAVIYQELCLAPNLTVAENIYVG------RELRRGNGRWGTI 123

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
            RA   +     +++  +G +   N+    +S    + +EIARA+  K RIL +DEP   
Sbjct: 124 DRA--AMARGCQDVLARLGADFGPNTLVGTLSIAEQQLVEIARAVHTKARILVMDEPTTP 181

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            + +ET  +  L+R++   G+ ++ + H M  +  +SDR+ VL  G
Sbjct: 182 LSSRETENLFRLIRQLRAEGLAIIYISHRMAEIYELSDRVSVLRDG 227



 Score = 74.7 bits (182), Expect = 8e-16
 Identities = 57/229 (24%), Positives = 108/229 (47%), Gaps = 16/229 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL + D++   GG   V+  S  +  G V  + G  GAG+T L  LI G      GE++L
Sbjct: 269 LLSVRDVAD--GG--RVRGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRVRGEVKL 324

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           GG+   G +P      G+    ++ +   + ++M+  +N+    ++S+            
Sbjct: 325 GGKAFGGHSPCDAIDAGLVYLTEDRKRQGLFLDMSVRDNI----NISVCXXXXXXXXXXX 380

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
                       A  + V      + N    A+S G  +++ ++R L  KPR+L LDEP 
Sbjct: 381 XXXXXXXXXXIAALSIRV-----PHANVSVGALSGGNQQKVLLSRLLETKPRVLILDEPT 435

Query: 180 AGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            G +    +EI  ++  +A +G+ V+++  ++  ++ ++DR+LV+  GR
Sbjct: 436 RGVDIGAKSEIYRIINDLARAGVGVIVISSELPEIIGVADRVLVMREGR 484


>METN_STRP8 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  116 bits (290), Expect = 2e-28
 Identities = 78/255 (30%), Positives = 137/255 (53%), Gaps = 29/255 (11%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV++V+  ++QG +Y ++G +GAGK+TL  +I  +  P +
Sbjct: 4   AIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTN 63

Query: 58  GEIRLGGELVSGLAPHQLA-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I + G++       QL+       R+  G  FQ+  +    TA ENV           
Sbjct: 64  GKITVDGDVTFDQGKIQLSANALRQKRRDTGMIFQHFNLMAQKTAKENVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREH-AAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAK 169
                LR  SL + +   +EH   EL+  VGL    ++  + +S G  +R+ IARALA  
Sbjct: 116 -----LRHSSLSKTE---KEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALAND 167

Query: 170 PRILFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P+IL  DE  +  +PK T +I  L++++    G+T+V++ H+M++V +I +R+ V+  G 
Sbjct: 168 PKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGV 227

Query: 229 KLTEGSARDVRDNPE 243
            + EGS  D+  NP+
Sbjct: 228 LIEEGSVLDIFSNPK 242


>METN_COREF RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 359

 Score =  116 bits (290), Expect = 2e-28
 Identities = 76/235 (32%), Positives = 127/235 (54%), Gaps = 20/235 (8%)

Query: 17  LAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGL--APHQ 74
           +A+ +VS +V+ G V  +IG +GAGK+TL  +I G+ TP  G + L G  + G+  A  +
Sbjct: 42  VALDDVSLTVEPGEVIGIIGYSGAGKSTLVRMINGLDTPTSGALLLDGTDIVGMPEAKMR 101

Query: 75  LARKGMGRTFQNLQICMNMTAIENVMVGGHLS-LDRNLVKSMLRFPSLRRADAVLREHAA 133
             R  +G  FQ   +  + TA  NV     L+ +D+   K+ +R                
Sbjct: 102 KLRSRIGMIFQQFNLFQSRTAAGNVEYPLELAKMDKAQRKARVR---------------- 145

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           E++ +VGL     +    +S G  +R+ IARALA  P +L  DE  +  +P+ T E+  L
Sbjct: 146 EMLDFVGLSDKGRNYPEQLSGGQKQRVGIARALATNPSLLLADEATSALDPETTQEVLAL 205

Query: 194 VRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAA 247
           +RK+  + GIT+V++ H+M++V +I+D++ V+  GR +  GS  +V  NP+   A
Sbjct: 206 LRKVNKELGITIVVITHEMEVVRSIADKVAVMEAGRVVEYGSVYEVFSNPQTTVA 260


>RBSA_PSEPK RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 512

 Score =  115 bits (289), Expect = 3e-28
 Identities = 72/235 (30%), Positives = 114/235 (48%), Gaps = 11/235 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+  + KTFG   A+   S  V  G V+ ++G NGAGK+TL  ++ GI+ P  G + L
Sbjct: 5   VLELRGIVKTFGATRALDGASLRVAAGSVHGLVGENGAGKSTLIKVLAGIHRPDAGSLLL 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+     +P Q+ R G+G   Q   +    T  E +  G              RF  L 
Sbjct: 65  DGQPHGHFSPRQVERLGIGFIHQERLLPARFTVGEALFFGHER-----------RFGPLL 113

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
              +  RE A  L  Y GL    N+    +S    + ++I RAL  KPR+L  DEP+   
Sbjct: 114 DRRSQQREAARLLDDYFGLRLPANALIGELSSAEQQMVQIVRALLIKPRVLVFDEPSVAL 173

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
             +E   +  +V+++ D G+ +V + H ++ +  + DR+ VL  GR + E S R+
Sbjct: 174 VQREVERLLRIVQRLRDDGLAIVYISHYLQEIEALCDRVTVLRNGRDVAEVSPRN 228



 Score = 62.0 bits (149), Expect = 5e-12
 Identities = 48/217 (22%), Positives = 99/217 (45%), Gaps = 16/217 (7%)

Query: 14  GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPH 73
           G   A Q +   V +G +  + G  G+G   L   + G+  P  GE+RL G+ +S  +P 
Sbjct: 265 GRARAYQGIDLQVRRGEIVGLTGLVGSGAKELLRSLFGLAPPDSGEVRLDGQPLSLRSPR 324

Query: 74  QLARKG---MGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLRE 130
           +   +G   M    +   + ++++  EN  +            ++ RF  L         
Sbjct: 325 EAVAQGVALMPEERRRQGVALDLSVQENTTLA-----------ALSRFVRLGLLSPARER 373

Query: 131 HAA-ELMVYVGLEAY-LNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
           H   EL+  + ++A+  +++   +S G  +++ +A+  A    +  LDEP+ G +     
Sbjct: 374 HTTLELIERLRIKAHGAHAKVRQLSGGNQQKVALAKWFARCSSLYLLDEPSVGIDVGAKV 433

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLN 225
           EI  L+ ++   G  V+++  D+  ++ + DRI V++
Sbjct: 434 EIYRLIGELVKEGAGVLILSSDLPELIGLCDRIHVMH 470


>RBSA2_RHIEC RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 508

 Score =  115 bits (289), Expect = 3e-28
 Identities = 68/226 (30%), Positives = 120/226 (53%), Gaps = 12/226 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L I  ++K FG V A+++V F++++G V+++ G NGAGK+TL N+I G+  P +GEIR+
Sbjct: 5   VLTIHGVTKHFGAVKALRDVDFTLERGEVHALCGENGAGKSTLMNIIAGVLQPTEGEIRV 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V   +P      G+G   Q + +C + T  EN+ +    + +R     M      R
Sbjct: 65  DGKAVRISSPAAAQYLGIGLVHQEIALCPDATVAENMFMA---ATNRRRAPLMNYRRLER 121

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            A AV+   AA           +    + +   + + +EIA+AL    R+L LDEP A  
Sbjct: 122 DAQAVMNRLAA---------IDVRRRVADLPISSQQLVEIAKALTLDCRVLILDEPTAAL 172

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
              E  ++ +++R +  +GI+++ + H M  + ++ DR+ V   GR
Sbjct: 173 TETEAQQLFSIIRDLKANGISIIYISHRMAEIFSLCDRVTVFRDGR 218



 Score = 55.5 bits (132), Expect = 5e-10
 Identities = 34/114 (29%), Positives = 64/114 (56%), Gaps = 5/114 (4%)

Query: 140 GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIAD 199
           G+EA + S    +S G  +++ IA+ LA KP+++ +DEP  G +    AEI  ++R++  
Sbjct: 392 GIEAPVKS----LSGGNQQKVAIAKQLAVKPKVILMDEPTRGIDVGAKAEIHRVLRELXX 447

Query: 200 SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEV-IAAYLGTA 252
                     +M  ++ +SDR+LV+  GR   E SA ++ +   + +A+ +G+A
Sbjct: 448 XXXXXXXXXXEMPELLGLSDRLLVVREGRIAGELSADEMSEEAVIRLASGMGSA 501


>RBSA2_ECO57 RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 506

 Score =  115 bits (289), Expect = 3e-28
 Identities = 64/226 (28%), Positives = 122/226 (53%), Gaps = 12/226 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+ +++K FG   A++ V  +V  G +++++G NGAGK+TL  ++ G YT   GEI +
Sbjct: 6   VLEMRNIAKAFGKFYALKGVDLTVYPGEIHALMGENGAGKSTLMKVLAGAYTATSGEILI 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+      P      G+   +Q +Q+  N++  EN+ +G  LS              ++
Sbjct: 66  DGKPFHIRTPKDALSAGITLIYQEMQLAPNLSVAENIFLGSELS----------HGGLVQ 115

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R + +++  A +++  +G +   + +   ++    +++EIARAL    RIL +DEP A  
Sbjct: 116 RKEMLVQ--AQKVIDRLGAQFNASDKVMTLTIAEQQQVEIARALHRNSRILVMDEPTAAL 173

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           + +ET  +  L+ ++ D G+ ++ + H M  V  +SDR+ VL  G+
Sbjct: 174 SSRETHRLFELIMRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQ 219



 Score = 79.0 bits (193), Expect = 4e-17
 Identities = 61/223 (27%), Positives = 112/223 (50%), Gaps = 12/223 (5%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           VQ  S  V  G +  + G  GAG++ L  LI G+     G I + GE V   +P +    
Sbjct: 271 VQPSSLLVRSGEIVGLAGLVGAGRSELAQLIFGVRKATGGMIEVDGEPVVIHSPREAIDL 330

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           G+G   +N +   + + M A EN+ +    +L+R+    ML     R+    + + A +L
Sbjct: 331 GIGFLTENRKEQGLFLEMAAAENITMA---TLERDARWGMLN----RKKAQTISDDAIKL 383

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
           +      A +   A  +S G  ++L I+R +A  PRIL LDEPA G +    +EI  ++ 
Sbjct: 384 LNIRVPHAQVR--AGGLSGGNQQKLLISRWVAIGPRILLLDEPARGVDVGAKSEIYRIMN 441

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           ++A  G+ ++++  ++  ++ +SDR+ V+  G    E + +++
Sbjct: 442 EMARKGVAILMISSELPEIVGMSDRVYVMREGSIAGELNGKNI 484


>METN_RHOFD RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 348

 Score =  115 bits (289), Expect = 3e-28
 Identities = 75/248 (30%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++ D+S ++ G    V A+Q V+  V  G V+ VIG +GAGK++L  +I  +  P  G
Sbjct: 1   MIQLKDISLSYPGHPAPVQALQGVNLQVRAGEVFGVIGRSGAGKSSLIRVINLLNRPSQG 60

Query: 59  EIRLGGELVSGLAPHQLARKG--MGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++             +G  FQ+  +  + T  +NV +   LS  R       
Sbjct: 61  QVHVAGAELTXXXXXXXXXXXHQIGMIFQHFNLLSSRTVFDNVALPLELSGVR------- 113

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                    A++R    EL+  VGL A      + +S G  +R+ IARALA+KP++L  D
Sbjct: 114 --------PALIRARVDELLDLVGLSALRERYPAQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+R+I  D G+T+VL+ H M+++  ++DR+ V++ GR + +G+ 
Sbjct: 166 EATSALDPETTRSILGLLRQINRDFGLTIVLITHQMQVIKQVADRVAVIDAGRIVEQGAV 225

Query: 236 RDVRDNPE 243
            DV   P+
Sbjct: 226 IDVFTRPQ 233


>METN_BORA1 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 362

 Score =  115 bits (289), Expect = 3e-28
 Identities = 79/248 (31%), Positives = 128/248 (51%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I +LSKT+    G   A++ +   ++QG V+ +IGP+GAGK+TL   I  +  P  G
Sbjct: 1   MIHIKNLSKTYATPHGRFEALRGIDLLIEQGEVFGIIGPSGAGKSTLVQCINLLERPDQG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I +GG+ ++GL+  QL   R+ +G  FQ   +    T   NV +              L
Sbjct: 61  SISIGGQELTGLSEAQLRGQRRRIGMVFQGFNLLSRRTVYGNVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               + R +  +      L+  VGLE   +   S +S G  +R+ IARALA  P +L  D
Sbjct: 108 EIAGVPRQE--IPGKVERLLALVGLEHLRDRYPSQISGGQKQRVGIARALANDPDVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+R I   +G+TVV++ H M++V  I DR+ VL++G+ +     
Sbjct: 166 EATSALDPETTHNILALLRDINRKTGVTVVMITHQMEVVREICDRVAVLSHGQVVEMART 225

Query: 236 RDVRDNPE 243
           +DV   P+
Sbjct: 226 QDVFATPQ 233


>METN2_OCEIH RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 342

 Score =  115 bits (289), Expect = 3e-28
 Identities = 77/251 (30%), Positives = 133/251 (52%), Gaps = 28/251 (11%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I  LSK F      + AV +++ +++ G +Y VIG +GAGK+T   LI  +  P  G
Sbjct: 1   MISIEGLSKVFSLNKKDIKAVDSLTLNIENGDIYGVIGYSGAGKSTFVRLINRLEEPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ +G ++++ L  + L  AR+ +G  FQ+  +  + T  +N+                 
Sbjct: 61  KVTIGDQVITELNKNDLRVARQDIGMIFQHFNLLWSRTVEDNI----------------- 103

Query: 117 RFPSLRRADAVLREHA---AELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRIL 173
            FP L  A    +E A    EL+  VGLE    S  S +S G  +R+ IARALA  P++L
Sbjct: 104 GFP-LEIAGVDKQEKARRVKELIGLVGLEGREKSYPSQLSGGQKQRVGIARALANSPKVL 162

Query: 174 FLDEPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
             DE  +  +P+ T +I +L++ I +   +T++L+ H+M ++  I +R+ V+  G+ + E
Sbjct: 163 LCDEATSALDPETTNQILSLLQDINEKLNLTIILITHEMHVIRKICNRVAVMEQGKVVEE 222

Query: 233 GSARDVRDNPE 243
           G   DV  NP+
Sbjct: 223 GQVLDVFTNPK 233


>METN2_BACC1 RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 339

 Score =  115 bits (289), Expect = 3e-28
 Identities = 77/249 (30%), Positives = 135/249 (54%), Gaps = 24/249 (9%)

Query: 3   LLEISDLSKTF--GG--VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++  +++SK +  GG  V AV++V+ SV++G ++ +IG +GAGK+TL  L+  +  P  G
Sbjct: 1   MISFNNVSKVYETGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKSTLLRLVNMLERPTAG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLS-LDRNLVKSM 115
            I +  + ++ L+  +L   R+ +G  FQ+  +  + T   N+     L+ + +N +K  
Sbjct: 61  TISIDDKEITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIAYPLKLAKVPKNEIK-- 118

Query: 116 LRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                         E   EL+ +VGLE   N+    +S G  +R+ IARALA  P IL  
Sbjct: 119 --------------ERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILIC 164

Query: 176 DEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           DE  +  +P+ T EI NL++K+  +  +T++L+ H+M +V  I  R+ V+  G+ + EG 
Sbjct: 165 DEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEEGK 224

Query: 235 ARDVRDNPE 243
             DV   P+
Sbjct: 225 LFDVFTQPK 233


>RBSA1_STRAW RecName: Full=Ribose import ATP-binding protein rbsA 1;
                   EC=3.6.3.17;
          Length = 522

 Score =  115 bits (288), Expect = 4e-28
 Identities = 66/238 (27%), Positives = 120/238 (50%), Gaps = 12/238 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL I  + KTF GV+A+  V F + +G V+ ++G NGAGK+TL  +++G Y P  G + +
Sbjct: 7   LLRIEGIRKTFPGVVALDGVDFDLRRGEVHVLLGENGAGKSTLIKMLSGAYRPDGGRVLV 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V           G+   +Q   +  ++T  EN+ +G          +   R   + 
Sbjct: 67  EGEEVRIHGAQDSEALGIATIYQEFNLVPDLTVAENIFLG----------RQPRRLGLID 116

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R    +   AAEL+  VG++    +    +    L+ +EIA+AL+   R+L +DEP A  
Sbjct: 117 RKK--MEADAAELLARVGVQVSPRARVRELGIARLQMVEIAKALSLNARVLIMDEPTAVL 174

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
             +E  ++  +VR++ + G+ +V + H ++ +  + DR+ V+  G+ + +  A    D
Sbjct: 175 TSEEVEKLFAIVRQLREDGVGIVFITHHLEEIAALGDRVTVIRDGKSVGQVPASTSED 232



 Score = 55.5 bits (132), Expect = 5e-10
 Identities = 31/101 (30%), Positives = 55/101 (54%), Gaps = 1/101 (0%)

Query: 129 REHAAELMVYVGLE-AYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKET 187
           R+ AA +   +G+  A L      +S G  +++ I + L A  ++L LDEP  G +    
Sbjct: 373 RDAAARVAGQLGVRMAGLGQHVRTLSGGNQQKVVIGKWLLADTKVLILDEPTRGIDVGAK 432

Query: 188 AEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            EI  L+ ++  +G  V+++  D+  V+ +SDR+LV+  GR
Sbjct: 433 VEIYQLINELTAAGAAVLMISSDLPEVLGMSDRVLVMAQGR 473


>POTA_STRPF RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 384

 Score =  115 bits (288), Expect = 4e-28
 Identities = 72/253 (28%), Positives = 133/253 (52%), Gaps = 23/253 (9%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++  +++SKTF   G   ++N++F +++G  Y+++G +G+GK+T+ N++ G+     G+I
Sbjct: 5   IITFNNVSKTFEDSGTQVLKNINFDLEEGKFYTLLGASGSGKSTILNIMAGLLDASSGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE ++ L    + ++ +   FQN  +  +MT  ENV                L+   
Sbjct: 65  YLDGERINDL---PINKRDIHTVFQNYALFPHMTVFENVAFA-------------LKLKK 108

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + +  + +   E +  V LE Y N     +S G  +R+ IARA+  +PR++ LDEP +
Sbjct: 109 VDKKE--IAKRVKETLKMVQLEGYENRSIQKLSGGQRQRVAIARAIINQPRVVLLDEPLS 166

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   E+   +R++    GIT V V HD +  + +SD I V+N G  +  G+  D+ 
Sbjct: 167 ALDLKLRTEMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNEGEIVQSGTPVDIY 226

Query: 240 DNP--EVIAAYLG 250
           D P    +A ++G
Sbjct: 227 DEPINHFVANFIG 239


>POTA_STRPD RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 384

 Score =  115 bits (288), Expect = 4e-28
 Identities = 72/253 (28%), Positives = 133/253 (52%), Gaps = 23/253 (9%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++  +++SKTF   G   ++N++F +++G  Y+++G +G+GK+T+ N++ G+     G+I
Sbjct: 5   IITFNNVSKTFEDSGTQVLKNINFDLEEGKFYTLLGASGSGKSTILNIMAGLLDASSGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE ++ L    + ++ +   FQN  +  +MT  ENV                L+   
Sbjct: 65  YLDGERINDL---PINKRDIHTVFQNYALFPHMTVFENVAFA-------------LKLKK 108

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + +  + +   E +  V LE Y N     +S G  +R+ IARA+  +PR++ LDEP +
Sbjct: 109 VDKKE--IAKRVKETLKMVQLEGYENRSIQKLSGGQRQRVAIARAIINQPRVVLLDEPLS 166

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   E+   +R++    GIT V V HD +  + +SD I V+N G  +  G+  D+ 
Sbjct: 167 ALDLKLRTEMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNEGEIVQSGTPVDIY 226

Query: 240 DNP--EVIAAYLG 250
           D P    +A ++G
Sbjct: 227 DEPINHFVANFIG 239


>POTA_STRPC RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 384

 Score =  115 bits (288), Expect = 4e-28
 Identities = 72/253 (28%), Positives = 133/253 (52%), Gaps = 23/253 (9%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++  +++SKTF   G   ++N++F +++G  Y+++G +G+GK+T+ N++ G+     G+I
Sbjct: 5   IITFNNVSKTFEDSGTQVLKNINFDLEEGKFYTLLGASGSGKSTILNIMAGLLDASSGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE ++ L    + ++ +   FQN  +  +MT  ENV                L+   
Sbjct: 65  YLDGERINDL---PINKRDIHTVFQNYALFPHMTVFENVAFA-------------LKLKK 108

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + +  + +   E +  V LE Y N     +S G  +R+ IARA+  +PR++ LDEP +
Sbjct: 109 VDKKE--IAKRVKETLKMVQLEGYENRSIQKLSGGQRQRVAIARAIINQPRVVLLDEPLS 166

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   E+   +R++    GIT V V HD +  + +SD I V+N G  +  G+  D+ 
Sbjct: 167 ALDLKLRTEMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNEGEIVQSGTPVDIY 226

Query: 240 DNP--EVIAAYLG 250
           D P    +A ++G
Sbjct: 227 DEPINHFVANFIG 239


>POTA_STRPB RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 384

 Score =  115 bits (288), Expect = 4e-28
 Identities = 72/253 (28%), Positives = 133/253 (52%), Gaps = 23/253 (9%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++  +++SKTF   G   ++N++F +++G  Y+++G +G+GK+T+ N++ G+     G+I
Sbjct: 5   IITFNNVSKTFEDSGTQVLKNINFDLEEGKFYTLLGASGSGKSTILNIMAGLLDASSGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE ++ L    + ++ +   FQN  +  +MT  ENV                L+   
Sbjct: 65  YLDGERINDL---PINKRDIHTVFQNYALFPHMTVFENVAFA-------------LKLKK 108

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + +  + +   E +  V LE Y N     +S G  +R+ IARA+  +PR++ LDEP +
Sbjct: 109 VDKKE--IAKRVKETLKMVQLEGYENRSIQKLSGGQRQRVAIARAIINQPRVVLLDEPLS 166

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   E+   +R++    GIT V V HD +  + +SD I V+N G  +  G+  D+ 
Sbjct: 167 ALDLKLRTEMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNEGEIVQSGTPVDIY 226

Query: 240 DNP--EVIAAYLG 250
           D P    +A ++G
Sbjct: 227 DEPINHFVANFIG 239


>POTA_LISMF RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 366

 Score =  115 bits (288), Expect = 4e-28
 Identities = 73/235 (31%), Positives = 124/235 (52%), Gaps = 21/235 (8%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           + NVSF +++G  Y+++GP+G GKTT+  LI G     +G+I LG ++++ +  +   ++
Sbjct: 24  LDNVSFEIEKGKFYTLLGPSGCGKTTILRLIAGFLEASEGQIYLGDKVINQIPAN---KR 80

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
            +   FQ+  +  ++   ENV  G             LR   L++ DA+  E   E + +
Sbjct: 81  PVNTVFQDYALFPHLNVYENVAFG-------------LRIKKLKK-DAI-DEKVKEALRF 125

Query: 139 VGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIA 198
           V L+ Y   E S MS G  +R+ IARA+  +P ++ LDEP +  + K   E+   +R + 
Sbjct: 126 VNLKGYEKREISEMSGGQRQRVAIARAIVNEPEVILLDEPLSALDLKLRTEMQYELRDLQ 185

Query: 199 DS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EVIAAYLG 250
              GIT + V HD +  + +SD I VLN G     G+  D+ D P  + +A ++G
Sbjct: 186 KRLGITFIFVTHDQEEALAMSDEIFVLNKGEIQQSGTPIDIYDEPINKFVADFIG 240


>METN_LACBA RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  115 bits (288), Expect = 4e-28
 Identities = 76/251 (30%), Positives = 130/251 (51%), Gaps = 28/251 (11%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++ D+  TF      V AV+NVS +V++G +Y V+G +GAGK+TL  +I  +  P  
Sbjct: 5   AIIQLKDIDVTFHNKGQTVTAVKNVSLTVNRGDIYGVVGYSGAGKSTLVRVINRLQQPTA 64

Query: 58  GEIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENV---MVGGHLSLDRNLV 112
           G + + G+ + GL   +L  AR  +G  FQ+  +  + T  +NV   + GG L+ +    
Sbjct: 65  GTVEVNGQDILGLPSKELRVARTKIGMIFQHFNLMASRTIADNVGYPLKGGTLTREER-- 122

Query: 113 KSMLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRI 172
                           ++  A L+  VGL        + +S G  +R+ IARALA  P I
Sbjct: 123 ----------------QKKVAHLLELVGLTEKATDYPAQLSGGQKQRVAIARALANDPEI 166

Query: 173 LFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLT 231
           L  DE  +  +PK T+ I  L++++  + G+TVVL+ H+M+ V  I +++ V++ G  + 
Sbjct: 167 LISDEATSALDPKTTSSILELLKRLNQELGLTVVLITHEMEAVKEICNKVAVMDAGEIIE 226

Query: 232 EGSARDVRDNP 242
            G    +   P
Sbjct: 227 RGDLVTIFSQP 237


>METN_CORGL RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 360

 Score =  115 bits (288), Expect = 4e-28
 Identities = 77/254 (30%), Positives = 130/254 (51%), Gaps = 27/254 (10%)

Query: 4   LEISDLSKTFGG-----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           +E   ++K F         A+ NV+ +V+ G V  +IG +GAGK+TL  LI G+ +P  G
Sbjct: 25  VEFRGITKVFSNNKSAKTTALDNVTLTVEPGEVIGIIGYSGAGKSTLVRLINGLDSPTSG 84

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + L G  + G+   +L   R  +G  FQ   +  + TA  NV                 
Sbjct: 85  SLLLNGTDIVGMPESKLRKLRSNIGMIFQQFNLFQSRTAAGNV----------------- 127

Query: 117 RFP-SLRRADAVLRE-HAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILF 174
            +P  + + D   R+    E++ +VGL     +    +S G  +R+ IARALA  P +L 
Sbjct: 128 EYPLEVAKMDKAARKARVQEMLEFVGLGDKGKNYPEQLSGGQKQRVGIARALATNPTLLL 187

Query: 175 LDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
            DE  +  +P+ T E+  L+RK+  + GIT+V++ H+M++V +I+D++ V+  G+ +  G
Sbjct: 188 ADEATSALDPETTHEVLELLRKVNRELGITIVVITHEMEVVRSIADKVAVMESGKVVEYG 247

Query: 234 SARDVRDNPEVIAA 247
           S  +V  NP+   A
Sbjct: 248 SVYEVFSNPQTQVA 261


>METN2_BACAN RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 339

 Score =  115 bits (288), Expect = 4e-28
 Identities = 77/249 (30%), Positives = 135/249 (54%), Gaps = 24/249 (9%)

Query: 3   LLEISDLSKTF--GG--VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++  +++SK +  GG  V AV++V+ SV++G ++ +IG +GAGK+TL  L+  +  P  G
Sbjct: 1   MISFNNVSKVYESGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKSTLLRLVNMLERPTAG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLS-LDRNLVKSM 115
            I +  + ++ L+  +L   R+ +G  FQ+  +  + T   N+     L+ + +N +K  
Sbjct: 61  TISIDDKDITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIAYPLKLAKVPKNEIK-- 118

Query: 116 LRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                         E   EL+ +VGLE   N+    +S G  +R+ IARALA  P IL  
Sbjct: 119 --------------ERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILIC 164

Query: 176 DEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           DE  +  +P+ T EI NL++K+  +  +T++L+ H+M +V  I  R+ V+  G+ + EG 
Sbjct: 165 DEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEEGK 224

Query: 235 ARDVRDNPE 243
             DV   P+
Sbjct: 225 LFDVFTQPK 233


>METN1_BACHK RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 339

 Score =  115 bits (288), Expect = 4e-28
 Identities = 77/249 (30%), Positives = 135/249 (54%), Gaps = 24/249 (9%)

Query: 3   LLEISDLSKTF--GG--VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++  +++SK +  GG  V AV++V+ SV++G ++ +IG +GAGK+TL  L+  +  P  G
Sbjct: 1   MISFNNVSKVYESGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKSTLLRLVNMLERPTAG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLS-LDRNLVKSM 115
            I +  + ++ L+  +L   R+ +G  FQ+  +  + T   N+     L+ + +N +K  
Sbjct: 61  TISIDDKDITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIAYPLKLAKVPKNEIK-- 118

Query: 116 LRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                         E   EL+ +VGLE   N+    +S G  +R+ IARALA  P IL  
Sbjct: 119 --------------ERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILIC 164

Query: 176 DEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           DE  +  +P+ T EI NL++K+  +  +T++L+ H+M +V  I  R+ V+  G+ + EG 
Sbjct: 165 DEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEEGK 224

Query: 235 ARDVRDNPE 243
             DV   P+
Sbjct: 225 LFDVFTQPK 233


>DRRA_STRPE RecName: Full=Daunorubicin resistance ATP-binding
           protein drrA;
          Length = 330

 Score =  115 bits (288), Expect = 4e-28
 Identities = 73/238 (30%), Positives = 123/238 (51%), Gaps = 17/238 (7%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E S L K + G  AV  +  +V  G+VY ++GPNGAGK+T   ++  +  P  G  R+ 
Sbjct: 9   IETSGLVKVYNGTRAVDGLDLNVPAGLVYGILGPNGAGKSTTIRMLATLLRPDGGTARVF 68

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G  V+  +     R+ +  T Q   +   +T  EN+++ G L           +  S  R
Sbjct: 69  GHDVT--SEPDTVRRRISVTGQYASVDEGLTGTENLVMMGRL-----------QGYSWAR 115

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           A    RE AAEL+   GL    +      S G  +RL+IA ++   P +LFLDEP  G +
Sbjct: 116 A----RERAAELIDGFGLGDARDRLLKTYSGGMRRRLDIAASIVVTPDLLFLDEPTTGLD 171

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           P+   ++ ++VR + D+G TV+L    +     ++DRI V+++GR + EG+  +++ +
Sbjct: 172 PRSRNQVWDIVRALVDAGTTVLLTTQYLDEADQLADRIAVIDHGRVIAEGTTGELKSS 229


>CYSA2_AGRT5 RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA 2;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase 2;
          Length = 341

 Score =  115 bits (288), Expect = 4e-28
 Identities = 69/252 (27%), Positives = 134/252 (53%), Gaps = 19/252 (7%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + + ++ KTF    AV++VS  ++ G + +++GP+G+GKTT+  ++ G+     G I  G
Sbjct: 3   IRLENVVKTFDTFRAVRDVSLDIESGELLALLGPSGSGKTTILRMVAGLEYSDGGRIFFG 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
            E  + +    +  +G+G  FQ+  +  +MT  EN+  G             ++   ++R
Sbjct: 63  DEDATNI---PVRDRGVGFVFQHYALFPHMTLHENIAFG-------------MKVSKVKR 106

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
             A +     EL+  V L+   +   + +S G  +R+ +ARAL+  P++L LDEP    +
Sbjct: 107 DKAAIDARVKELLNLVKLDGLGDRFPAQISGGQRQRVALARALSVDPKVLLLDEPFGALD 166

Query: 184 PKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV--RD 240
                ++   +R+I DS GIT + V HD +  ++++DR+++LN G  + +G+ ++V  + 
Sbjct: 167 ANVRRDLRRWLREIHDSLGITTIFVTHDQEEALDLADRVVILNQGGIVQQGTPKEVCRQP 226

Query: 241 NPEVIAAYLGTA 252
           N   +  +LG A
Sbjct: 227 NSSFVMRFLGDA 238


>XYLG_YERPS RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 510

 Score =  115 bits (287), Expect = 5e-28
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ D++K FG V AV N+S +++ G V S+ G NG+GK+TL  ++ GIY      GEI
Sbjct: 4   LLEMKDITKQFGVVKAVDNISLTLEAGQVLSLCGENGSGKSTLMKVLCGIYPVGSYQGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +      +  +KG+    Q L +   M+ +EN+ +G              RF  
Sbjct: 64  IFSGETLQAKNIRETEQKGIAIIHQELALVKQMSVLENMFLGSEWG----------RFGI 113

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           +      LR     ++  V L    ++  S +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 114 MDYDAMYLR--CQRMLAQVKLVVDPHTPVSELGLGQQQLVEIAKALNKQVRLLVLDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
                ETA + +++R + + GI  + + H +  V  ISD I V+  GR +    A  + +
Sbjct: 172 SLTESETAILLDIIRDLRNHGIACIYISHKLNEVKEISDHICVIRDGRHIGTRPASTMSE 231

Query: 241 NPEVIAAYLG 250
           + ++IA  +G
Sbjct: 232 D-DIIAMMVG 240



 Score = 66.2 bits (160), Expect = 3e-13
 Identities = 53/220 (24%), Positives = 102/220 (46%), Gaps = 24/220 (10%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTP-CDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  G+G+T     + G+Y     G+I + G+  +     Q  +
Sbjct: 277 VDDVSFSLKRGEILGIAGLVGSGRTETVQCLFGVYPGRWQGDIFIKGQAATIRTCQQAMK 336

Query: 78  KGMGRTFQN---------LQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
            G+    ++         + +  N+T        G  SL  +  +  +   SL R    +
Sbjct: 337 LGIAMVPEDRKKDGIVPVMGVGANITLAALDDFTGAFSLLDDAKEQSIIVQSLARLK--V 394

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
           +  ++EL +            + +S G  ++  +A+ L   P+IL LDEP  G +     
Sbjct: 395 KTSSSELAI------------ARLSGGNQQKAILAKCLLLNPQILILDEPTRGIDIGAKY 442

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ GR
Sbjct: 443 EIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHQGR 482


>XYLG_YERPN RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 510

 Score =  115 bits (287), Expect = 5e-28
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ D++K FG V AV N+S +++ G V S+ G NG+GK+TL  ++ GIY      GEI
Sbjct: 4   LLEMKDITKQFGVVKAVDNISLTLEAGQVLSLCGENGSGKSTLMKVLCGIYPVGSYQGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +      +  +KG+    Q L +   M+ +EN+ +G              RF  
Sbjct: 64  IFSGETLQAKNIRETEQKGIAIIHQELALVKQMSVLENMFLGSEWG----------RFGI 113

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           +      LR     ++  V L    ++  S +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 114 MDYDAMYLR--CQRMLAQVKLVVDPHTPVSELGLGQQQLVEIAKALNKQVRLLVLDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
                ETA + +++R + + GI  + + H +  V  ISD I V+  GR +    A  + +
Sbjct: 172 SLTESETAILLDIIRDLRNHGIACIYISHKLNEVKEISDHICVIRDGRHIGTRPASTMSE 231

Query: 241 NPEVIAAYLG 250
           + ++IA  +G
Sbjct: 232 D-DIIAMMVG 240



 Score = 66.2 bits (160), Expect = 3e-13
 Identities = 53/220 (24%), Positives = 102/220 (46%), Gaps = 24/220 (10%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTP-CDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  G+G+T     + G+Y     G+I + G+  +     Q  +
Sbjct: 277 VDDVSFSLKRGEILGIAGLVGSGRTETVQCLFGVYPGRWQGDIFIKGQAATIRTCQQAMK 336

Query: 78  KGMGRTFQN---------LQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
            G+    ++         + +  N+T        G  SL  +  +  +   SL R    +
Sbjct: 337 LGIAMVPEDRKKDGIVPVMGVGANITLAALDDFTGAFSLLDDAKEQSIIVQSLARLK--V 394

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
           +  ++EL +            + +S G  ++  +A+ L   P+IL LDEP  G +     
Sbjct: 395 KTSSSELAI------------ARLSGGNQQKAILAKCLLLNPQILILDEPTRGIDIGAKY 442

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ GR
Sbjct: 443 EIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHQGR 482


>XYLG_YERPE RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 510

 Score =  115 bits (287), Expect = 5e-28
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ D++K FG V AV N+S +++ G V S+ G NG+GK+TL  ++ GIY      GEI
Sbjct: 4   LLEMKDITKQFGVVKAVDNISLTLEAGQVLSLCGENGSGKSTLMKVLCGIYPVGSYQGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +      +  +KG+    Q L +   M+ +EN+ +G              RF  
Sbjct: 64  IFSGETLQAKNIRETEQKGIAIIHQELALVKQMSVLENMFLGSEWG----------RFGI 113

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           +      LR     ++  V L    ++  S +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 114 MDYDAMYLR--CQRMLAQVKLVVDPHTPVSELGLGQQQLVEIAKALNKQVRLLVLDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
                ETA + +++R + + GI  + + H +  V  ISD I V+  GR +    A  + +
Sbjct: 172 SLTESETAILLDIIRDLRNHGIACIYISHKLNEVKEISDHICVIRDGRHIGTRPASTMSE 231

Query: 241 NPEVIAAYLG 250
           + ++IA  +G
Sbjct: 232 D-DIIAMMVG 240



 Score = 66.2 bits (160), Expect = 3e-13
 Identities = 53/220 (24%), Positives = 102/220 (46%), Gaps = 24/220 (10%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTP-CDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  G+G+T     + G+Y     G+I + G+  +     Q  +
Sbjct: 277 VDDVSFSLKRGEILGIAGLVGSGRTETVQCLFGVYPGRWQGDIFIKGQAATIRTCQQAMK 336

Query: 78  KGMGRTFQN---------LQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
            G+    ++         + +  N+T        G  SL  +  +  +   SL R    +
Sbjct: 337 LGIAMVPEDRKKDGIVPVMGVGANITLAALDDFTGAFSLLDDAKEQSIIVQSLARLK--V 394

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
           +  ++EL +            + +S G  ++  +A+ L   P+IL LDEP  G +     
Sbjct: 395 KTSSSELAI------------ARLSGGNQQKAILAKCLLLNPQILILDEPTRGIDIGAKY 442

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ GR
Sbjct: 443 EIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHQGR 482


>XYLG_YERPA RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 510

 Score =  115 bits (287), Expect = 5e-28
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ D++K FG V AV N+S +++ G V S+ G NG+GK+TL  ++ GIY      GEI
Sbjct: 4   LLEMKDITKQFGVVKAVDNISLTLEAGQVLSLCGENGSGKSTLMKVLCGIYPVGSYQGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +      +  +KG+    Q L +   M+ +EN+ +G              RF  
Sbjct: 64  IFSGETLQAKNIRETEQKGIAIIHQELALVKQMSVLENMFLGSEWG----------RFGI 113

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           +      LR     ++  V L    ++  S +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 114 MDYDAMYLR--CQRMLAQVKLVVDPHTPVSELGLGQQQLVEIAKALNKQVRLLVLDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
                ETA + +++R + + GI  + + H +  V  ISD I V+  GR +    A  + +
Sbjct: 172 SLTESETAILLDIIRDLRNHGIACIYISHKLNEVKEISDHICVIRDGRHIGTRPASTMSE 231

Query: 241 NPEVIAAYLG 250
           + ++IA  +G
Sbjct: 232 D-DIIAMMVG 240



 Score = 66.2 bits (160), Expect = 3e-13
 Identities = 53/220 (24%), Positives = 102/220 (46%), Gaps = 24/220 (10%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTP-CDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  G+G+T     + G+Y     G+I + G+  +     Q  +
Sbjct: 277 VDDVSFSLKRGEILGIAGLVGSGRTETVQCLFGVYPGRWQGDIFIKGQAATIRTCQQAMK 336

Query: 78  KGMGRTFQN---------LQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
            G+    ++         + +  N+T        G  SL  +  +  +   SL R    +
Sbjct: 337 LGIAMVPEDRKKDGIVPVMGVGANITLAALDDFTGAFSLLDDAKEQSIIVQSLARLK--V 394

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
           +  ++EL +            + +S G  ++  +A+ L   P+IL LDEP  G +     
Sbjct: 395 KTSSSELAI------------ARLSGGNQQKAILAKCLLLNPQILILDEPTRGIDIGAKY 442

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ GR
Sbjct: 443 EIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHQGR 482


>XYLG_SHIF8 RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 513

 Score =  115 bits (287), Expect = 5e-28
 Identities = 74/254 (29%), Positives = 130/254 (51%), Gaps = 23/254 (9%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ +++KTFG V A+ NVS  ++ G + S+ G NG+GK+TL  ++ GIY     +GEI
Sbjct: 4   LLEMKNITKTFGSVKAIDNVSLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLS----LDRNLVKSML 116
              GE +         RKG+    Q L +   +T +EN+ +G  ++    +D +L+   L
Sbjct: 64  IFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMT--L 121

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           R+               +L+  V L    ++    +  G  + +EIA+AL  + R+L LD
Sbjct: 122 RYQ--------------KLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILD 167

Query: 177 EPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR 236
           EP A    +ET+ + +++R +   GI  + + H +  V  ISD I V+  G+ +    A 
Sbjct: 168 EPTASLTEQETSVLLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAA 227

Query: 237 DVRDNPEVIAAYLG 250
            + ++ ++I   +G
Sbjct: 228 GMSED-DIITMMVG 240



 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 56/222 (25%), Positives = 102/222 (45%), Gaps = 28/222 (12%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVSGLAPHQLAR 77
           V ++SFS+ +G +  + G  GAG+T     + G++    +G+I + G+ V      Q   
Sbjct: 277 VNDISFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIA 336

Query: 78  KGMGRTFQN---------LQICMNMT-AIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           +G+    ++         + +  N+T A  N   GG   LD                DA 
Sbjct: 337 QGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGGISQLD----------------DAA 380

Query: 128 LREHAAELMVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKE 186
            ++   E +  + ++      A   +S G  ++  +AR L   PRIL LDEP  G +   
Sbjct: 381 EQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGA 440

Query: 187 TAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
             EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ G+
Sbjct: 441 KYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHEGK 482


>XYLG_SHIBS RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 513

 Score =  115 bits (287), Expect = 5e-28
 Identities = 70/250 (28%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ +++KTFG V A+ NVS  ++ G + S+ G NG+GK+TL  ++ GIY     +GEI
Sbjct: 4   LLEMKNITKTFGSVKAIDNVSLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +         RKG+    Q L +   +T +EN+ +G  ++ +  +   ++    
Sbjct: 64  IFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMTL-- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                        +L+  V L    ++    +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 122 ----------RCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
               +ET+ + +++R +   GI  + + H +  V  ISD I V+  G+ +    A  + +
Sbjct: 172 SLTEQETSVLLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSE 231

Query: 241 NPEVIAAYLG 250
           + ++I   +G
Sbjct: 232 D-DIITMMVG 240



 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 57/222 (25%), Positives = 102/222 (45%), Gaps = 28/222 (12%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  GAG+T     + G++    +G+I + G+ V      Q   
Sbjct: 277 VNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIA 336

Query: 78  KGMGRTFQN---------LQICMNMT-AIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           +G+    ++         + +  N+T A  N   GG   LD                DA 
Sbjct: 337 QGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGGISQLD----------------DAA 380

Query: 128 LREHAAELMVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKE 186
            ++   E +  + ++      A   +S G  ++  +AR L   PRIL LDEP  G +   
Sbjct: 381 EQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGA 440

Query: 187 TAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
             EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ G+
Sbjct: 441 KYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHEGK 482


>XYLG_ECOUT RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 513

 Score =  115 bits (287), Expect = 5e-28
 Identities = 70/250 (28%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ +++KTFG V A+ NVS  ++ G + S+ G NG+GK+TL  ++ GIY     +GEI
Sbjct: 4   LLEMKNITKTFGSVKAIDNVSLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +         RKG+    Q L +   +T +EN+ +G  ++ +  +   ++    
Sbjct: 64  IFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMTL-- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                        +L+  V L    ++    +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 122 ----------RCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
               +ET+ + +++R +   GI  + + H +  V  ISD I V+  G+ +    A  + +
Sbjct: 172 SLTEQETSVLLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSE 231

Query: 241 NPEVIAAYLG 250
           + ++I   +G
Sbjct: 232 D-DIITMMVG 240



 Score = 68.2 bits (165), Expect = 8e-14
 Identities = 57/222 (25%), Positives = 103/222 (46%), Gaps = 28/222 (12%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  GAG+T     + G++    +G+I + G+ V      Q   
Sbjct: 277 VNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIA 336

Query: 78  KGMGRTFQN---------LQICMNMT-AIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           +G+    ++         + +  N+T A  N   GG   LD                DA 
Sbjct: 337 QGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGGISQLD----------------DAA 380

Query: 128 LREHAAELMVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKE 186
            ++   E +  + ++   +  A   +S G  ++  +AR L   PRIL LDEP  G +   
Sbjct: 381 EQKCILESIQQLKVKTSSSDLAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGA 440

Query: 187 TAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
             EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ G+
Sbjct: 441 KYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHEGK 482


>XYLG_ECOL6 RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 513

 Score =  115 bits (287), Expect = 5e-28
 Identities = 70/250 (28%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ +++KTFG V A+ NVS  ++ G + S+ G NG+GK+TL  ++ GIY     +GEI
Sbjct: 4   LLEMKNITKTFGSVKAIDNVSLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +         RKG+    Q L +   +T +EN+ +G  ++ +  +   ++    
Sbjct: 64  IFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMTL-- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                        +L+  V L    ++    +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 122 ----------RCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
               +ET+ + +++R +   GI  + + H +  V  ISD I V+  G+ +    A  + +
Sbjct: 172 SLTEQETSVLLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSE 231

Query: 241 NPEVIAAYLG 250
           + ++I   +G
Sbjct: 232 D-DIITMMVG 240



 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 56/214 (26%), Positives = 101/214 (47%), Gaps = 12/214 (5%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  GAG+T     + G++    +G+I + G+ V      Q   
Sbjct: 277 VNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIA 336

Query: 78  KGMGRTFQNLQICMNMTAIENVM-VGGHLSLD--RNLVKSMLRFPSLRRADAVLREHAAE 134
           +G+    ++         I  VM VG +++L   +    S+ +         +L E   +
Sbjct: 337 QGIAMVPED----RKRDGIVPVMAVGKNITLAALKKFTGSISQLDDAAEQKCIL-ESIQQ 391

Query: 135 LMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           L V        +     +S G  ++  +AR L   PRIL LDEP  G +     EI  L+
Sbjct: 392 LKVKTSSP---DLAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGAKYEIYKLI 448

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            ++   GI V+++  ++  V+ +SDR+LV++ G+
Sbjct: 449 NQLVQQGIAVIVISSELPEVLGLSDRVLVMHEGK 482


>XYLG_ECOL5 RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 513

 Score =  115 bits (287), Expect = 5e-28
 Identities = 70/250 (28%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ +++KTFG V A+ NVS  ++ G + S+ G NG+GK+TL  ++ GIY     +GEI
Sbjct: 4   LLEMKNITKTFGSVKAIDNVSLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +         RKG+    Q L +   +T +EN+ +G  ++ +  +   ++    
Sbjct: 64  IFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMTL-- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                        +L+  V L    ++    +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 122 ----------RCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
               +ET+ + +++R +   GI  + + H +  V  ISD I V+  G+ +    A  + +
Sbjct: 172 SLTEQETSVLLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSE 231

Query: 241 NPEVIAAYLG 250
           + ++I   +G
Sbjct: 232 D-DIITMMVG 240



 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 56/214 (26%), Positives = 101/214 (47%), Gaps = 12/214 (5%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  GAG+T     + G++    +G+I + G+ V      Q   
Sbjct: 277 VNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIA 336

Query: 78  KGMGRTFQNLQICMNMTAIENVM-VGGHLSLD--RNLVKSMLRFPSLRRADAVLREHAAE 134
           +G+    ++         I  VM VG +++L   +    S+ +         +L E   +
Sbjct: 337 QGIAMVPED----RKRDGIVPVMAVGKNITLAALKKFTGSISQLDDAAEQKCIL-ESIQQ 391

Query: 135 LMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           L V        +     +S G  ++  +AR L   PRIL LDEP  G +     EI  L+
Sbjct: 392 LKVKTSSP---DLAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGAKYEIYKLI 448

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            ++   GI V+++  ++  V+ +SDR+LV++ G+
Sbjct: 449 NQLVQQGIAVIVISSELPEVLGLSDRVLVMHEGK 482


>XYLG_ECO57 RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 513

 Score =  115 bits (287), Expect = 5e-28
 Identities = 70/250 (28%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ +++KTFG V A+ NVS  ++ G + S+ G NG+GK+TL  ++ GIY     +GEI
Sbjct: 4   LLEMKNITKTFGSVKAIDNVSLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +         RKG+    Q L +   +T +EN+ +G  ++ +  +   ++    
Sbjct: 64  IFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMTL-- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                        +L+  V L    ++    +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 122 ----------RCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
               +ET+ + +++R +   GI  + + H +  V  ISD I V+  G+ +    A  + +
Sbjct: 172 SLTEQETSVLLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSE 231

Query: 241 NPEVIAAYLG 250
           + ++I   +G
Sbjct: 232 D-DIITMMVG 240



 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 57/222 (25%), Positives = 102/222 (45%), Gaps = 28/222 (12%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  GAG+T     + G++    +G+I + G+ V      Q   
Sbjct: 277 VNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIA 336

Query: 78  KGMGRTFQN---------LQICMNMT-AIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           +G+    ++         + +  N+T A  N   GG   LD                DA 
Sbjct: 337 QGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGGISQLD----------------DAA 380

Query: 128 LREHAAELMVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKE 186
            ++   E +  + ++      A   +S G  ++  +AR L   PRIL LDEP  G +   
Sbjct: 381 EQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGA 440

Query: 187 TAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
             EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ G+
Sbjct: 441 KYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHEGK 482


>POTA_STRPM RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 384

 Score =  115 bits (287), Expect = 5e-28
 Identities = 71/253 (28%), Positives = 133/253 (52%), Gaps = 23/253 (9%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++  +++SKTF   G   ++N++F +++G  Y+++G +G+GK+T+ N++ G+     G+I
Sbjct: 5   IITFNNVSKTFEDSGTQVLKNINFDLEEGKFYTLLGASGSGKSTILNIMAGLLDASSGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE ++ L    + ++ +   FQN  +  +MT  ENV                L+   
Sbjct: 65  YLDGERINDL---PINKRDIHTVFQNYALFPHMTVFENVAFA-------------LKLKK 108

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + +  + +   E +  V LE Y N     +S G  +R+ IARA+  +PR++ LDEP +
Sbjct: 109 VDKKE--IAKRVKETLKMVQLEGYENRSIQKLSGGQRQRVAIARAIINQPRVVLLDEPLS 166

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   E+   +R++    GIT V V HD +  + +SD + V+N G  +  G+  D+ 
Sbjct: 167 ALDLKLRTEMQYELRELQQRLGITFVFVTHDQEEALAMSDWVFVMNEGEIVQSGTPVDIY 226

Query: 240 DNP--EVIAAYLG 250
           D P    +A ++G
Sbjct: 227 DEPINHFVANFIG 239


>POTA_STRP6 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 384

 Score =  115 bits (287), Expect = 5e-28
 Identities = 71/253 (28%), Positives = 133/253 (52%), Gaps = 23/253 (9%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++  +++SKTF   G   ++N++F +++G  Y+++G +G+GK+T+ N++ G+     G+I
Sbjct: 5   IITFNNVSKTFEDSGTQVLKNINFDLEEGKFYTLLGASGSGKSTILNIMAGLLDASSGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE ++ L    + ++ +   FQN  +  +MT  ENV                L+   
Sbjct: 65  YLDGERINDL---PINKRDIHTVFQNYALFPHMTVFENVAFA-------------LKLKK 108

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + +  + +   E +  V LE Y N     +S G  +R+ IARA+  +PR++ LDEP +
Sbjct: 109 VDKKE--IAKRVKETLKMVQLEGYENRSIQKLSGGQRQRVAIARAIINQPRVVLLDEPLS 166

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   E+   +R++    GIT V V HD +  + +SD + V+N G  +  G+  D+ 
Sbjct: 167 ALDLKLRTEMQYELRELQQRLGITFVFVTHDQEEALAMSDWVFVMNEGEIVQSGTPVDIY 226

Query: 240 DNP--EVIAAYLG 250
           D P    +A ++G
Sbjct: 227 DEPINHFVANFIG 239


>POTA_STRP3 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 384

 Score =  115 bits (287), Expect = 5e-28
 Identities = 71/253 (28%), Positives = 133/253 (52%), Gaps = 23/253 (9%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++  +++SKTF   G   ++N++F +++G  Y+++G +G+GK+T+ N++ G+     G+I
Sbjct: 5   IITFNNVSKTFEDSGTQVLKNINFDLEEGKFYTLLGASGSGKSTILNIMAGLLDASSGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE ++ L    + ++ +   FQN  +  +MT  ENV                L+   
Sbjct: 65  YLDGERINDL---PINKRDIHTVFQNYALFPHMTVFENVAFA-------------LKLKK 108

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + +  + +   E +  V LE Y N     +S G  +R+ IARA+  +PR++ LDEP +
Sbjct: 109 VDKKE--IAKRVKETLKMVQLEGYENRSIQKLSGGQRQRVAIARAIINQPRVVLLDEPLS 166

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   E+   +R++    GIT V V HD +  + +SD + V+N G  +  G+  D+ 
Sbjct: 167 ALDLKLRTEMQYELRELQQRLGITFVFVTHDQEEALAMSDWVFVMNEGEIVQSGTPVDIY 226

Query: 240 DNP--EVIAAYLG 250
           D P    +A ++G
Sbjct: 227 DEPINHFVANFIG 239


>POTA_LAWIP RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 368

 Score =  115 bits (287), Expect = 5e-28
 Identities = 79/244 (32%), Positives = 124/244 (50%), Gaps = 25/244 (10%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+ ++SK F    A+ N++  +  G   +++GP+G GKTT+  +I+G  TP  GEI +
Sbjct: 7   IIELKNVSKIFEDTCALDNINLQIANGEFLTLLGPSGCGKTTILRIISGFETPDVGEILI 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  VSG  P    R+ +   FQ+  +  +MT  +NV  G             LR     
Sbjct: 67  AGVNVSGFPPE---RRQVNTVFQHYALFPHMTVRDNVAFG-------------LRMQKCP 110

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R    + E   E +  V LE + +   S +S G  +R+ IARA+  KP +L LDEP +  
Sbjct: 111 REK--VNELVFEALRMVHLENFADRRPSQLSGGQQQRVAIARAVVNKPLLLLLDEPFSAL 168

Query: 183 NPK----ETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           + K       EI +L RK+   GIT V V HD +    +SDR++V+N GR    G+ + +
Sbjct: 169 DHKLRQIMQLEIKHLQRKL---GITFVFVTHDQEEAFAMSDRVVVMNQGRIEQIGTPQCI 225

Query: 239 RDNP 242
            + P
Sbjct: 226 YEEP 229


>METN_BIFLO RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 401

 Score =  115 bits (287), Expect = 5e-28
 Identities = 76/240 (31%), Positives = 125/240 (52%), Gaps = 20/240 (8%)

Query: 18  AVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLA- 76
           AV +VS ++D+G ++ +IG +GAGK+TL  LI  +  P  G + + G  ++ L+  +L  
Sbjct: 27  AVDDVSLTIDRGDIFGIIGYSGAGKSTLVRLINALERPTSGTVTVLGTDITSLSETKLRP 86

Query: 77  -RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
            R+ +G  FQ   +    T  +N+     L   R   +        RR +        EL
Sbjct: 87  IRQKIGMIFQQFNLFSTKTVAQNIAYPLQLDHWRKDYQD-------RRVN--------EL 131

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
           + +VGL  + N   S +S G  +R+ IARALA  P IL  DE  +  +P+ T E+  L++
Sbjct: 132 LEFVGLSEHANKYPSQLSGGQKQRVGIARALATNPEILLADEATSALDPETTTEVLALLK 191

Query: 196 KIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE--VIAAYLGTA 252
           ++ +  GIT+VL+ H M +V  I+ R+ V++ GR +  G   DV   P+  V   ++ TA
Sbjct: 192 RVNEEFGITIVLITHQMNVVQQIAGRVAVMSAGRVVESGDVYDVFAAPQQPVTKRFIATA 251


>CYSA_RHILO RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase;
          Length = 346

 Score =  115 bits (287), Expect = 5e-28
 Identities = 72/240 (30%), Positives = 125/240 (52%), Gaps = 15/240 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + ++++ K F    A+ +VS  +  G + +++GP+G+GKTTL  LI G+  P  G+I  G
Sbjct: 3   VRVANVRKEFERFPALHDVSLDIKSGELIALLGPSGSGKTTLLRLIAGLERPTRGKIFFG 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
            E  S      +  + +G  FQ+  +  +MT  +N+  G             +R  S R 
Sbjct: 63  DEDAS---QKSIQERNVGFVFQHYALFRHMTVADNIGFG-----------LKVRHGSSRP 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
               +R  A+EL+  V L        + +S G  +R+ +ARA+A +P++L LDEP    +
Sbjct: 109 PAQEIRRRASELLDLVQLSGLEKRYPAQLSGGQRQRVALARAMAIEPKVLLLDEPFGALD 168

Query: 184 PKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            +   E+   +R+I D +G T V V HD +  + ++DR++V++ GR    G+A D+ D P
Sbjct: 169 AQVRRELRRWLREIHDRTGHTTVFVTHDQEEALELADRVVVMSQGRIEQVGTADDIYDTP 228


>CYSA2_RHIME RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA 2;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase 2;
          Length = 367

 Score =  115 bits (287), Expect = 5e-28
 Identities = 70/241 (29%), Positives = 127/241 (52%), Gaps = 17/241 (7%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + + ++ K FG   A+++VS  +  G + +++GP+G+GKTTL  L+ G+ +P +G I  G
Sbjct: 3   VRVQNIRKEFGRFPALEDVSLDIRSGELIALLGPSGSGKTTLLRLVAGLESPTEGTIFFG 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
            E  S     Q   + +G  FQ+  +  +MT ++NV  G  +             P+ RR
Sbjct: 63  DEDASKKTVQQ---RNIGFVFQHYALFRHMTVLDNVAFGLKVR------------PAKRR 107

Query: 124 ADAV-LREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             A  +R  A +L+  V L        + +S G  +R+ +ARA+A +P +L LDEP    
Sbjct: 108 PSAADIRRRAVDLLELVQLSGLERRYPAQLSGGQRQRVALARAMAVEPNVLLLDEPFGAL 167

Query: 183 NPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + +   E+   +R+I D +G T + V HD +  + ++DR++V++ G     G+  ++ D+
Sbjct: 168 DAQVRKELRRWLREIHDRTGHTTIFVTHDQEEALELADRVVVMSKGAIEQVGTPDEIYDH 227

Query: 242 P 242
           P
Sbjct: 228 P 228


>ARAG_MANSM RecName: Full=Arabinose import ATP-binding protein araG;
                   EC=3.6.3.17;
          Length = 502

 Score =  115 bits (287), Expect = 5e-28
 Identities = 71/247 (28%), Positives = 127/247 (51%), Gaps = 12/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           LE  ++SK+F GV A+QN+SF   +G V++++G NGAGK+TL  +++G Y P +G++ +G
Sbjct: 6   LEFDNVSKSFPGVKALQNISFKCYEGKVHALMGENGAGKSTLLKILSGNYLPSEGKLSIG 65

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G  +      +    G+   +Q L I   MT  EN+ + G L     +V           
Sbjct: 66  GRQLVFRNTKEALLAGVAIIYQELNIVPEMTVAENLCL-GQLPHSFGIVDK--------- 115

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
             A L E   + +  + L    N+    +S G  + +EIA+AL+   +I+  DEP +  +
Sbjct: 116 --AELIERTQQYLDKLDLNISPNTPLKELSIGQWQMIEIAKALSRGAKIIAFDEPTSSLS 173

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
             E  ++ +++ ++ D G  ++ V H M+ +  ISD I VL  G+ +   S      N +
Sbjct: 174 APEIEKLFSVINELRDEGKVILYVSHRMEEIFRISDEITVLKDGQFVETFSDLSKITNDD 233

Query: 244 VIAAYLG 250
           ++ + +G
Sbjct: 234 LVRSMVG 240



 Score = 59.7 bits (143), Expect = 3e-11
 Identities = 49/207 (23%), Positives = 98/207 (47%), Gaps = 15/207 (7%)

Query: 23  SFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGMGR 82
           S +V  G V  + G  GAG++ L  +I G      G I L G+ +S  +P     +G   
Sbjct: 274 SLTVRAGEVLGLFGLVGAGRSELLKVIFGADPCVSGSIELDGKTLSIRSPKDAIEQG--- 330

Query: 83  TFQNLQICMNMTAIENVM----VGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
               + +C      E ++    VG ++++    + +  +F      D   +++A +    
Sbjct: 331 ----IVLCPEDRKKEGIVPTASVGENINISARRLHNFFKFII---NDKWEKKNAEKQRQQ 383

Query: 139 VGLEA-YLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKI 197
           + ++   +      +S G  ++  + R L+   ++L LDEP  G +    +EI +L+ K+
Sbjct: 384 MNVKTPSIEQLIVNLSGGNQQKAILGRWLSEDIKVLLLDEPTRGIDVGAKSEIYDLIFKL 443

Query: 198 ADSGITVVLVEHDMKMVMNISDRILVL 224
           AD  + +++V  D+  V+ +SDRI+V+
Sbjct: 444 ADQKLAIIVVSSDLPEVIGVSDRIMVM 470


>YFIL_BACSU RecName: Full=Uncharacterized ABC transporter
           ATP-binding protein yfiL;
          Length = 311

 Score =  114 bits (286), Expect = 7e-28
 Identities = 68/236 (28%), Positives = 123/236 (52%), Gaps = 17/236 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L+  ++ K +G    V+ +SFS+ +G  + ++GPNGAGK+T  ++I+G+     G I +
Sbjct: 1   MLQAENIKKAYGKKTIVKGISFSLKKGESFGLLGPNGAGKSTTISMISGLVPHDSGNITV 60

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
           GG ++        A++ +G   Q + +   +TA EN+M  G +               L 
Sbjct: 61  GGYVIGKETAK--AKQKIGIVPQEIALYPTLTAHENLMFWGKMY-------------GLT 105

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             +A  ++ AAE++ YVGL      +    S G  +R+ I  AL  KP +L +DEP  G 
Sbjct: 106 HGEA--KKRAAEVLEYVGLTERAKDKIETFSGGMKRRINIGAALMHKPELLIMDEPTVGI 163

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +P+    I   V+++ ++G+TV+   H M+ V  + DRI +++ G  +  G+  D+
Sbjct: 164 DPQSRNHILETVKQLNETGMTVIYTSHYMEEVEFLCDRIGIIDQGEMIAIGTKTDL 219


>RGMG_RHOFD RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein;       
           EC=3.6.3.17;
          Length = 504

 Score =  114 bits (286), Expect = 7e-28
 Identities = 75/255 (29%), Positives = 126/255 (49%), Gaps = 24/255 (9%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L+ + +LSK+F GV A+  V F +  G V++++G NGAGK+TL  ++ G+Y    GE+ 
Sbjct: 3   SLISVKNLSKSFPGVKALDQVHFDLRAGEVHALMGENGAGKSTLMKILAGVYRKDSGEML 62

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVG------GHLSLDRNLVKSM 115
           L G+ V   +P       +G   Q L +  ++TA +N+ +G      G L LD       
Sbjct: 63  LDGQPVEIESPAHAQSLAIGIVHQELHLMNHLTAAQNIYLGREPRHCGGLFLD------- 115

Query: 116 LRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                    +A L +    L   + L     +    ++    + +EIA+AL+ K R+L +
Sbjct: 116 ---------EARLNQDTQILFDRLNLALAPTTAIGELTVARQQMVEIAKALSFKSRVLIM 166

Query: 176 DEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           DEP A  N  E  E+  ++R++   G+ +V + H M  +  I+DRI V+  G   T G+ 
Sbjct: 167 DEPTAALNNAEIDELFRIIRQLKSEGVGIVYISHKMDEIQRIADRITVMRDGS--TIGTV 224

Query: 236 RDVRDNPEVIAAYLG 250
                  +VIA  +G
Sbjct: 225 PASTPMQQVIAMMVG 239



 Score = 69.3 bits (168), Expect = 3e-14
 Identities = 65/254 (25%), Positives = 121/254 (47%), Gaps = 30/254 (11%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+  L++  G V  +++V+FSV +G +    G  GAG+T +   + G      GE+R+
Sbjct: 258 LLEVRGLNR--GRV--IRDVNFSVRRGEILGFAGLMGAGRTEVARAVFGADPIDSGEVRV 313

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNL-VKSMLRFPSL 121
            GEL+   +P    + G+G   ++ +               H  L   + V+S +  PSL
Sbjct: 314 RGELIRLASPQDAVQAGIGYLSEDRK---------------HFGLATGMDVESNITLPSL 358

Query: 122 RR-------ADAVLREHAAELMV-YVGLEA-YLNSEASAMSYGALKRLEIARALAAKPRI 172
           +R        +     H ++ MV  + ++   L   A  +S G  +++ +A+ L     +
Sbjct: 359 KRWLKWGLFLNQPAIHHISQQMVGKLRIKTPSLTQTARLLSGGNQQKVVVAKWLVQDCDV 418

Query: 173 LFLDEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
           L  DEP  G +    +EI  L+ ++A  G  ++++  ++  V+ +S R+LV+  GR +T 
Sbjct: 419 LIFDEPTRGIDVGAKSEIYKLLNELATQGKAIIVISSELPEVLLLSHRVLVMCEGR-ITG 477

Query: 233 GSARDVRDNPEVIA 246
             A DV     ++A
Sbjct: 478 EVAGDVATQETLMA 491


>NODI_RHIL3 RecName: Full=Nod factor export ATP-binding protein I;  
                 EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 311

 Score =  114 bits (286), Expect = 7e-28
 Identities = 72/230 (31%), Positives = 120/230 (52%), Gaps = 17/230 (7%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           ++++ +SK++GG + V ++SF++  G  + ++GPNGAGK+T+  +I G+ +P  G+I + 
Sbjct: 13  IDLAGVSKSYGGKIVVNDLSFTIAAGECFGLLGPNGAGKSTITRMILGMTSPSVGKITVL 72

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G    G      A+ G+   F NL +    T  EN++V G                S R 
Sbjct: 73  GAQEPGQVRLARAKIGIVSQFDNLDL--EFTVRENLLVYGRYFR-----------MSTRE 119

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            + V+      L+ +  LE+  N+  + +S G  +RL +ARAL   P++L LDEP  G +
Sbjct: 120 IETVI----PSLLEFARLESKANTRVADLSGGMKRRLTLARALINDPQLLILDEPTTGLD 175

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
           P     I   +R +   G T++L  H M+    + DR+ VL  GRK+ EG
Sbjct: 176 PHARHLIWERLRSLLARGKTILLTTHIMEEAERLCDRLCVLEAGRKIAEG 225


>XYLG_SHIFL RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 513

 Score =  114 bits (285), Expect = 9e-28
 Identities = 71/234 (30%), Positives = 121/234 (51%), Gaps = 22/234 (9%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ +++KTFG V A+ NVS  ++ G + S+ G NG+GK+TL  ++ GIY     +GEI
Sbjct: 4   LLEMKNITKTFGSVKAIDNVSLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLS----LDRNLVKSML 116
              GE +         RKG+    Q L +   +T +EN+ +G  ++    +D +L+   L
Sbjct: 64  IFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMT--L 121

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           R+               +L+  V L    ++    +  G  + +EIA+AL  + R+L LD
Sbjct: 122 RYQ--------------KLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILD 167

Query: 177 EPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKL 230
           EP A    +ET+ + +++R +   GI  + + H +  V  ISD I V+  G+ +
Sbjct: 168 EPTASLTEQETSVLLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHI 221



 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 57/222 (25%), Positives = 102/222 (45%), Gaps = 28/222 (12%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  GAG+T     + G++    +G+I + G+ V      Q   
Sbjct: 277 VNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIT 336

Query: 78  KGMGRTFQN---------LQICMNMT-AIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           +G+    ++         + +  N+T A  N   GG   LD                DA 
Sbjct: 337 QGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGGISQLD----------------DAA 380

Query: 128 LREHAAELMVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKE 186
            ++   E +  + ++      A   +S G  ++  +AR L   PRIL LDEP  G +   
Sbjct: 381 EQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGA 440

Query: 187 TAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
             EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ G+
Sbjct: 441 KYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHEGK 482


>XYLG_HAEIN RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 503

 Score =  114 bits (285), Expect = 9e-28
 Identities = 75/253 (29%), Positives = 125/253 (49%), Gaps = 17/253 (6%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPC---D 57
           MALLE+  ++K FG V A+ N+S  ++ G + S+ G NG+GK+TL  ++ GIY PC    
Sbjct: 1   MALLEMKHITKKFGDVTALHNISIELEAGEILSLCGENGSGKSTLMKILCGIY-PCGDYS 59

Query: 58  GEIRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR 117
           G+I      +          KG+    Q L +  NM+ +EN+ +G  ++  + L      
Sbjct: 60  GDIYFSESELKARNIRDTEEKGISIIHQELTLVKNMSVLENIFLGNEIT-HKGLT----- 113

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
                 AD  +      L+  V L+A  N+    +  G  + +EIA+AL  + R+L LDE
Sbjct: 114 ------ADNEMYLRCKNLLQQVQLDADPNTRVGELGLGQQQLVEIAKALNKQVRLLILDE 167

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
           P A    KET  + NL++ +    I  + + H +  V  ISD+I V+  G  +    A  
Sbjct: 168 PTASLTEKETEILLNLIKDLKAHNIACIYISHKLNEVKAISDKICVIRDGEHVGTKDAST 227

Query: 238 VRDNPEVIAAYLG 250
           + ++ ++I   +G
Sbjct: 228 MTED-DIITMMVG 239



 Score = 65.9 bits (159), Expect = 4e-13
 Identities = 53/216 (24%), Positives = 104/216 (48%), Gaps = 16/216 (7%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V NVSFS+ +G +  V G  G+G+T +   + G Y     E +  G +   +   Q+  K
Sbjct: 276 VDNVSFSLHEGEILGVAGLVGSGRTDMVQCLFGSY-----EGKFEGNIF--INQKQVNIK 328

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
              +  ++  + +     ++ +V   + + +N+  S L+  S      V+ E   E ++ 
Sbjct: 329 NCAQAIEHKIVMVPEDRKKHGIVS-IMGVGKNITLSSLK--SYCFGKMVVNEAKEEQIIG 385

Query: 139 VGLEAYLNSEASA------MSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDN 192
             ++       S       +S G  ++  +A+ L+  P+IL LDEP  G +     EI  
Sbjct: 386 SAIKRLKVKTFSPDLPIGRLSGGNQQKAILAKCLSLNPKILILDEPTRGIDVGAKYEIYK 445

Query: 193 LVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           L+ ++A  GI ++++  ++  V+ ISDR+LV++ G+
Sbjct: 446 LINQLAQEGIAIIVISSELPEVLGISDRVLVMHQGK 481


>POTA_OCEIH RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 370

 Score =  114 bits (285), Expect = 9e-28
 Identities = 72/252 (28%), Positives = 131/252 (51%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG-VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +++  ++SK F    L + +VSF++++G  Y+++GP+G GKTT+  LI G      G+I 
Sbjct: 7   IIQFKNVSKQFDNDPLVLDHVSFTIEKGKFYTLLGPSGCGKTTILRLIAGFTEASSGDII 66

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
             G+ ++ +  +   ++ +   FQ+  +  ++   ENV  G             LR   L
Sbjct: 67  FEGKRINHIPAN---KRPINTVFQDYALFPHLNVYENVAFG-------------LRIKKL 110

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           ++  +++ E   E + +V L  Y N E   MS G  +R+ IARA+  +P ++ LDEP + 
Sbjct: 111 KK--SMIDEKVKEALSFVNLVGYENREIKDMSGGQRQRVAIARAIVNEPAVILLDEPLSA 168

Query: 182 FNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
            + K   ++   +R++    GIT + V HD +  + +SD I VLN G+    G+  D+ D
Sbjct: 169 LDLKLRYQMQYELRELQQRLGITFIFVTHDQEEALAMSDEIFVLNKGKIQQSGTPNDIYD 228

Query: 241 NP--EVIAAYLG 250
            P    +A ++G
Sbjct: 229 EPINRFVADFIG 240


>POTA_LACGA RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 363

 Score =  114 bits (285), Expect = 9e-28
 Identities = 70/253 (27%), Positives = 134/253 (52%), Gaps = 24/253 (9%)

Query: 3   LLEISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +++++ + K +  G +A+++++ +++ G  YS++GP+G+GKTT+  +I G   P  G++ 
Sbjct: 4   IIKLTHVRKEYDDGFVALKDINLTIESGKFYSLLGPSGSGKTTILRIIAGFSEPTSGQVF 63

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHL-SLDRNLVKSMLRFPS 120
             G+ ++ L     A++ +   FQN  +  +M   ENV  G  +   D+  +K  ++   
Sbjct: 64  FAGKDITNL---DAAKRKINTVFQNYALFPHMNVFENVAFGLQIKKKDKQEIKLAVK--- 117

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                        E +  V L+ + N E S +S G  +R+ IARA+  +P++L LDE  +
Sbjct: 118 -------------EALHMVQLDGFANREISELSGGQQQRVAIARAIVNQPKVLLLDESLS 164

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + +   ++   +R+I    GIT + V HD +  + +SD I VLN G+    GS  D+ 
Sbjct: 165 ALDKRLRKDMQFELREIQKKLGITFIFVTHDQEEALAMSDEIFVLNEGKIQQSGSPVDIY 224

Query: 240 DNP--EVIAAYLG 250
           D P  + +A ++G
Sbjct: 225 DEPVNDFVARFIG 237


>POTA_BACCR RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 327

 Score =  114 bits (285), Expect = 9e-28
 Identities = 69/251 (27%), Positives = 129/251 (51%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++++  + K FG  + +  +S  + +G   +++GP+G GKTTL  +I G  TP  G + L
Sbjct: 4   IIKVEAVEKHFGNQVIIPPLSLDIKEGEFLTILGPSGCGKTTLLRMIAGFETPTKGNLLL 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             E ++ L P+   ++ M   FQ+  +  +MT  +N+  G  +                +
Sbjct: 64  DDERINDLPPY---KRHMNLVFQHYALFPHMTVEKNICFGMKMQ---------------K 105

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            + A  +E A E M    L  + N + + +S G  +R+ IARA+   PR+L LDEP    
Sbjct: 106 VSAAEQKERAEEAMRLTQLLEFRNRKPAKLSGGQQQRVAIARAIVNNPRVLLLDEPLGAL 165

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   ++ +  + GIT + V HD +  M++SDRI+V+N G     G+ +++ + 
Sbjct: 166 DFKLRKDLQRELKNLQRNLGITFIYVTHDQEEAMSMSDRIVVMNKGHIEQIGTPKEIYNK 225

Query: 242 PEV--IAAYLG 250
           P+   +A ++G
Sbjct: 226 PKTLFVATFIG 236


>PHNC2_SYNJB RecName: Full=Phosphonates import ATP-binding protein
           phnC 2;         EC=3.6.3.28;
          Length = 269

 Score =  114 bits (285), Expect = 9e-28
 Identities = 76/237 (32%), Positives = 130/237 (54%), Gaps = 15/237 (6%)

Query: 3   LLEISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L I  LSK +  G +A++ V+  V  G V ++IGP+GAGK+TL   I  +  P  G I 
Sbjct: 1   MLRIDSLSKRYPTGDMALKGVTLEVPDGQVMALIGPSGAGKSTLLRCINRLVEPTSGSIW 60

Query: 62  LGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVG--GHLSLDRNLVKSMLR 117
           L G  ++ L   +L  AR+ +G  FQ   +   +T +ENV+ G  G+++  ++  +   +
Sbjct: 61  LNGIDLTRLNTRELRQARRKIGMIFQEYALVERLTVMENVLSGQLGYVNFWQSWFR---K 117

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           FP          + A  L+  VGL  + +  A A+S G  +R+ IARAL   P +L +DE
Sbjct: 118 FPQ------ATIDEAFRLLDRVGLSDFPDKRADALSGGQRQRVGIARALLQNPELLLVDE 171

Query: 178 PAAGFNPKETAEIDNLVRKIA-DSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
           P A  +PK + +I  L+ ++A + G++V++  HD+ +    + RI+ L +G  + +G
Sbjct: 172 PTASLDPKTSRQIMRLINELASERGLSVIINIHDVPLAQMFAQRIVGLRFGEVVYDG 228


>METN_STRPF RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  114 bits (285), Expect = 9e-28
 Identities = 75/254 (29%), Positives = 135/254 (53%), Gaps = 27/254 (10%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV++V+  ++QG +Y ++G +GAGK+TL  +I  +  P +
Sbjct: 4   AIIQLDHIDITFHQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQAPTN 63

Query: 58  GEIRLGGELVSGLAPHQLA-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I + G++       QL+       R+ +G  FQ+  +    TA ENV           
Sbjct: 64  GKITVDGDVTFDQGKIQLSAEALRQKRRDIGMIFQHFNLMAQKTAKENVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKP 170
                LR  SL + +    +   EL+  VGL    ++  + +S G  +R+ IARALA  P
Sbjct: 116 -----LRHSSLSKTEK--EQKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALANDP 168

Query: 171 RILFLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRK 229
           +IL  DE  +  +PK T +I  L++++    G+T+V++ H+M++V +I +R+ V+  G  
Sbjct: 169 KILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGVL 228

Query: 230 LTEGSARDVRDNPE 243
           + EG   D+  NP+
Sbjct: 229 IEEGPVLDIFSNPK 242


>METN_HAES1 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 345

 Score =  114 bits (285), Expect = 9e-28
 Identities = 77/253 (30%), Positives = 135/253 (53%), Gaps = 24/253 (9%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++ ++SK F      + A+ NVS  V QG +  VIG +GAGK+TL   I  +  P  G
Sbjct: 1   MIKLKNISKVFNVSGKNLTALDNVSLEVPQGQICGVIGASGAGKSTLIRCINLLERPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLS-LDRNLVKSM 115
            + +    ++ L+ ++L  AR+ +G  FQ+  +  + T  +NV +   L   D+  +K  
Sbjct: 61  SVIVDNTDLTQLSDNELIHARRHIGMIFQHFNLLSSRTVFDNVALPLELEKTDKTQIK-- 118

Query: 116 LRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                 ++ DA+L          VGL    +   + +S G  +R+ IARALA  P++L  
Sbjct: 119 ------QKVDALLN--------LVGLYDKKDVYPANLSGGQKQRVAIARALANSPKVLLC 164

Query: 176 DEPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           DE  +  +P  T  I  L+++I  + GIT++L+ H+M +V  I D++ V+N G+ + +GS
Sbjct: 165 DEATSALDPATTQSILKLLKEINRTLGITILLITHEMDVVKRICDQVAVINKGQLIEQGS 224

Query: 235 ARDVRDNPEVIAA 247
             D+  NP+ + A
Sbjct: 225 VGDIFSNPKTLLA 237


>METN_HAEI8 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 345

 Score =  114 bits (285), Expect = 9e-28
 Identities = 71/248 (28%), Positives = 137/248 (55%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++++++K F      + A+ NVS ++++G +  VIG +GAGK+TL   +  +  P  G
Sbjct: 1   MIKLNNITKIFELPNKKLTALDNVSLNIEKGQICGVIGASGAGKSTLIRCVNLLEKPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G  ++ L+  +L  AR+ +G  FQ+  +  + T  ENV +   L  +        
Sbjct: 61  SVIVDGVELTKLSDRELVLARRQIGMIFQHFNLLSSRTVFENVALPLELESE-------- 112

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                  + A ++E    L+  VGL    ++  S +S G  +R+ IARALA+ P++L  D
Sbjct: 113 -------SKAKIQEKITALLDLVGLSEKRDAYPSNLSGGQKQRVAIARALASDPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L+++I  + GIT++L+ H+M++V  I D++ V++ GR + +G+ 
Sbjct: 166 EATSALDPATTQSILQLLKEINRTLGITILLITHEMEVVKQICDQVAVIDQGRLVEQGTV 225

Query: 236 RDVRDNPE 243
            ++  NP+
Sbjct: 226 GEIFANPK 233


>METN2_STAAW RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  114 bits (285), Expect = 9e-28
 Identities = 72/231 (31%), Positives = 123/231 (53%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V+ S+  G +Y VIG +GAGK+TL  +   +  P  GE+ + G+ +  L+ + L
Sbjct: 18  VLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +   FQ+  +  + T ++N+M               L    + R  A  ++ A 
Sbjct: 78  RAKRQKVSMIFQHFNLLWSRTVLKNIMF-------------PLEIAGVPRRRA--KQKAL 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+    +  S +S G  +R+ IARALA  P +L  DE  +  +P+ T EI +L
Sbjct: 123 ELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEILDL 182

Query: 194 VRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + KI +   +T+VL+ H+M ++  I D + V+  G+ + +G    V +NP+
Sbjct: 183 LLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEQGPVTQVFENPQ 233


>METN2_STAAS RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  114 bits (285), Expect = 9e-28
 Identities = 72/231 (31%), Positives = 123/231 (53%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V+ S+  G +Y VIG +GAGK+TL  +   +  P  GE+ + G+ +  L+ + L
Sbjct: 18  VLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +   FQ+  +  + T ++N+M               L    + R  A  ++ A 
Sbjct: 78  RAKRQKVSMIFQHFNLLWSRTVLKNIMF-------------PLEIAGVPRRRA--KQKAL 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+    +  S +S G  +R+ IARALA  P +L  DE  +  +P+ T EI +L
Sbjct: 123 ELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEILDL 182

Query: 194 VRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + KI +   +T+VL+ H+M ++  I D + V+  G+ + +G    V +NP+
Sbjct: 183 LLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEQGPVTQVFENPQ 233


>METN2_STAAC RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  114 bits (285), Expect = 9e-28
 Identities = 72/231 (31%), Positives = 123/231 (53%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V+ S+  G +Y VIG +GAGK+TL  +   +  P  GE+ + G+ +  L+ + L
Sbjct: 18  VLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +   FQ+  +  + T ++N+M               L    + R  A  ++ A 
Sbjct: 78  RAKRQKVSMIFQHFNLLWSRTVLKNIMF-------------PLEIAGVPRRRA--KQKAL 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+    +  S +S G  +R+ IARALA  P +L  DE  +  +P+ T EI +L
Sbjct: 123 ELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEILDL 182

Query: 194 VRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + KI +   +T+VL+ H+M ++  I D + V+  G+ + +G    V +NP+
Sbjct: 183 LLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEQGPVTQVFENPQ 233


>METN2_STAA8 RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  114 bits (285), Expect = 9e-28
 Identities = 72/231 (31%), Positives = 123/231 (53%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V+ S+  G +Y VIG +GAGK+TL  +   +  P  GE+ + G+ +  L+ + L
Sbjct: 18  VLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +   FQ+  +  + T ++N+M               L    + R  A  ++ A 
Sbjct: 78  RAKRQKVSMIFQHFNLLWSRTVLKNIMF-------------PLEIAGVPRRRA--KQKAL 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+    +  S +S G  +R+ IARALA  P +L  DE  +  +P+ T EI +L
Sbjct: 123 ELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEILDL 182

Query: 194 VRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + KI +   +T+VL+ H+M ++  I D + V+  G+ + +G    V +NP+
Sbjct: 183 LLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEQGPVTQVFENPQ 233


>METN2_STAA3 RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  114 bits (285), Expect = 9e-28
 Identities = 72/231 (31%), Positives = 123/231 (53%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V+ S+  G +Y VIG +GAGK+TL  +   +  P  GE+ + G+ +  L+ + L
Sbjct: 18  VLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +   FQ+  +  + T ++N+M               L    + R  A  ++ A 
Sbjct: 78  RAKRQKVSMIFQHFNLLWSRTVLKNIMF-------------PLEIAGVPRRRA--KQKAL 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+    +  S +S G  +R+ IARALA  P +L  DE  +  +P+ T EI +L
Sbjct: 123 ELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEILDL 182

Query: 194 VRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + KI +   +T+VL+ H+M ++  I D + V+  G+ + +G    V +NP+
Sbjct: 183 LLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEQGPVTQVFENPQ 233


>CBIO_METMJ RecName: Full=Cobalt import ATP-binding protein cbiO;   
                EC=3.6.3.-;
          Length = 277

 Score =  114 bits (285), Expect = 9e-28
 Identities = 77/247 (31%), Positives = 129/247 (52%), Gaps = 17/247 (6%)

Query: 1   MALLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           M LLE  DL+  + G V A++ V+F+ ++    +VIGPNGAGK+TLF    GI  P  GE
Sbjct: 1   MHLLETRDLTHIYRGDVHALEGVNFTAERKSRIAVIGPNGAGKSTLFKHFNGILKPTSGE 60

Query: 60  IRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           + + GE ++     ++ RK +G  FQN    +    +E  +  G ++L  +         
Sbjct: 61  VLVRGEPITKENVREV-RKFVGIVFQNPDDQIFSPTVEQDIAFGPINLGLD--------- 110

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
                +A +     E +  +G+E         +S G  KR+ IA  LA +P++L LDEP 
Sbjct: 111 -----EATVAHRVEEALHLLGIEELRERVPHHLSGGEKKRVAIAGILAMEPQVLVLDEPT 165

Query: 180 AGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           AG +P+  A++   V ++ +  G+TVV   H + +V  ++D I V++ GR +  G+  +V
Sbjct: 166 AGLDPQGVADLVAFVNRLPEEYGMTVVFSTHHLDLVAEMADYIYVMDKGRVVGSGTVEEV 225

Query: 239 RDNPEVI 245
              PE++
Sbjct: 226 FTRPELL 232


>ARAG_YERPS RecName: Full=Arabinose import ATP-binding protein araG;
                   EC=3.6.3.17;
          Length = 523

 Score =  114 bits (285), Expect = 9e-28
 Identities = 69/247 (27%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           L    + K+F GVLA+ ++SF+   G +++++G NGAGK+TL  +++G YTP  GEI + 
Sbjct: 20  LAFRGIGKSFPGVLALDDISFTCQAGQIHALMGENGAGKSTLLKILSGNYTPTQGEIHIK 79

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+ V+          G+   +Q L +   MT  EN+ + G L     +V   L       
Sbjct: 80  GKAVNFTNTTDALDAGVAIIYQELHLVPEMTVAENIYL-GQLPTKMGMVDRKL------- 131

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
               LR  +   + ++GL+   ++    +S G  + +EIA+ALA   +I+  DEP +  +
Sbjct: 132 ----LRYESRIQLSHLGLDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLS 187

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E  ++  ++R++   G  ++ V H M+ +  +SD I V   GR +         +N  
Sbjct: 188 AREIEQLFRVIRELRAEGRVILYVSHRMEEIFALSDAITVFKDGRYVRTFDDMTQVNNAS 247

Query: 244 VIAAYLG 250
           ++ A +G
Sbjct: 248 LVQAMVG 254


>ARAG_YERPN RecName: Full=Arabinose import ATP-binding protein araG;
                   EC=3.6.3.17;
          Length = 523

 Score =  114 bits (285), Expect = 9e-28
 Identities = 69/247 (27%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           L    + K+F GVLA+ ++SF+   G +++++G NGAGK+TL  +++G YTP  GEI + 
Sbjct: 20  LAFRGIGKSFPGVLALDDISFTCQAGQIHALMGENGAGKSTLLKILSGNYTPTQGEIHIK 79

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+ V+          G+   +Q L +   MT  EN+ + G L     +V   L       
Sbjct: 80  GKAVNFTNTTDALDAGVAIIYQELHLVPEMTVAENIYL-GQLPTKMGMVDRKL------- 131

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
               LR  +   + ++GL+   ++    +S G  + +EIA+ALA   +I+  DEP +  +
Sbjct: 132 ----LRYESRIQLSHLGLDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLS 187

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E  ++  ++R++   G  ++ V H M+ +  +SD I V   GR +         +N  
Sbjct: 188 AREIEQLFRVIRELRAEGRVILYVSHRMEEIFALSDAITVFKDGRYVRTFDDMTQVNNAS 247

Query: 244 VIAAYLG 250
           ++ A +G
Sbjct: 248 LVQAMVG 254


>ARAG_YERPE RecName: Full=Arabinose import ATP-binding protein araG;
                   EC=3.6.3.17;
          Length = 523

 Score =  114 bits (285), Expect = 9e-28
 Identities = 69/247 (27%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           L    + K+F GVLA+ ++SF+   G +++++G NGAGK+TL  +++G YTP  GEI + 
Sbjct: 20  LAFRGIGKSFPGVLALDDISFTCQAGQIHALMGENGAGKSTLLKILSGNYTPTQGEIHIK 79

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+ V+          G+   +Q L +   MT  EN+ + G L     +V   L       
Sbjct: 80  GKAVNFTNTTDALDAGVAIIYQELHLVPEMTVAENIYL-GQLPTKMGMVDRKL------- 131

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
               LR  +   + ++GL+   ++    +S G  + +EIA+ALA   +I+  DEP +  +
Sbjct: 132 ----LRYESRIQLSHLGLDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLS 187

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E  ++  ++R++   G  ++ V H M+ +  +SD I V   GR +         +N  
Sbjct: 188 AREIEQLFRVIRELRAEGRVILYVSHRMEEIFALSDAITVFKDGRYVRTFDDMTQVNNAS 247

Query: 244 VIAAYLG 250
           ++ A +G
Sbjct: 248 LVQAMVG 254


>ARAG_YERPA RecName: Full=Arabinose import ATP-binding protein araG;
                   EC=3.6.3.17;
          Length = 523

 Score =  114 bits (285), Expect = 9e-28
 Identities = 69/247 (27%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           L    + K+F GVLA+ ++SF+   G +++++G NGAGK+TL  +++G YTP  GEI + 
Sbjct: 20  LAFRGIGKSFPGVLALDDISFTCQAGQIHALMGENGAGKSTLLKILSGNYTPTQGEIHIK 79

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+ V+          G+   +Q L +   MT  EN+ + G L     +V   L       
Sbjct: 80  GKAVNFTNTTDALDAGVAIIYQELHLVPEMTVAENIYL-GQLPTKMGMVDRKL------- 131

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
               LR  +   + ++GL+   ++    +S G  + +EIA+ALA   +I+  DEP +  +
Sbjct: 132 ----LRYESRIQLSHLGLDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLS 187

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E  ++  ++R++   G  ++ V H M+ +  +SD I V   GR +         +N  
Sbjct: 188 AREIEQLFRVIRELRAEGRVILYVSHRMEEIFALSDAITVFKDGRYVRTFDDMTQVNNAS 247

Query: 244 VIAAYLG 250
           ++ A +G
Sbjct: 248 LVQAMVG 254


>RBSA_CORGL RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 524

 Score =  114 bits (284), Expect = 1e-27
 Identities = 73/249 (29%), Positives = 126/249 (50%), Gaps = 16/249 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L++  +SK+FG V  +  VS  V  G V +++G NGAGK+TL  +++G+Y P  G+I +
Sbjct: 16  ILQLDKVSKSFGPVNVINQVSIDVRPGRVLALLGENGAGKSTLIKMMSGVYQPDGGQILV 75

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVK-SMLRFPSL 121
            G+  +          G+    Q L +   MT  ENVM+G      R   K  ++ F  L
Sbjct: 76  DGKPTTLPDTKTAESFGIATIHQELNLVPTMTVAENVMLG------RTPRKWGLVNFKHL 129

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           RR        A   +  +G++  LN++  ++     + +EIA+AL+   RIL LDEP A 
Sbjct: 130 RR-------QAQAALDLIGVDVDLNAQVGSLGIARQQMVEIAKALSMNARILILDEPTAA 182

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
              +E  ++  +V ++ + G+ +V + H +  +  I D + VL  G+ + E  A    D 
Sbjct: 183 LTGREIDQLFKVVDQLKEKGVAMVFISHHLDEIARIGDTVSVLRDGQFIAELPAD--TDE 240

Query: 242 PEVIAAYLG 250
            E++   +G
Sbjct: 241 DELVRLMVG 249



 Score = 53.5 bits (127), Expect = 2e-09
 Identities = 48/191 (25%), Positives = 91/191 (47%), Gaps = 16/191 (8%)

Query: 43  TTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVG 102
           T +   I G+     GE+ + G+ + G    +  + G+G   ++ +        + +++G
Sbjct: 303 TEVVRSIAGVDKVDSGEVIVAGKKLRGGDISEAIKNGIGHIPEDRKA-------QGLVLG 355

Query: 103 GHLSLDRNLVKSMLRFPSLRRADAVLR----EHAAELMVYVGLE-AYLNSEASAMSYGAL 157
              S++ NL   +    S  RA  V R    + AAE+   + +  A L    S +S G  
Sbjct: 356 S--SVEDNL--GLATLASTARAGLVDRSGQHKRAAEVAEKLRIRMASLKQPISDLSGGNQ 411

Query: 158 KRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNI 217
           ++    R + A   +L LDEP  G +     EI N++ ++ + G  V++V  ++  V+ +
Sbjct: 412 QKAVFGRWVLAGSNVLLLDEPTRGVDVGAKVEIYNIINEMTEKGGAVLMVSSELPEVLGM 471

Query: 218 SDRILVLNYGR 228
           +DRILV++ GR
Sbjct: 472 ADRILVMSGGR 482


>POTA_STRP8 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 384

 Score =  114 bits (284), Expect = 1e-27
 Identities = 71/253 (28%), Positives = 133/253 (52%), Gaps = 23/253 (9%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++  +++SKTF   G   ++N++F +++G  Y+++G +G+GK+T+ N++ G+     G+I
Sbjct: 5   IITFNNVSKTFEDSGTQVLKNINFDLEEGKFYTLLGASGSGKSTILNIMAGLLDASSGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE ++ L    + ++ +   FQN  +  +MT  ENV                L+   
Sbjct: 65  YLDGERINDL---PINKRDIHTVFQNYALFPHMTVFENVAFA-------------LKLKK 108

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + +  + +   E +  V LE + N     +S G  +R+ IARA+  +PR++ LDEP +
Sbjct: 109 VDKKE--IAKRVKETLKMVQLEGFENRSIQKLSGGQRQRVAIARAIINQPRVVLLDEPLS 166

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   E+   +R++    GIT V V HD +  + +SD I V+N G  +  G+  D+ 
Sbjct: 167 ALDLKLRTEMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNEGEIVQSGTPVDIY 226

Query: 240 DNP--EVIAAYLG 250
           D P    +A ++G
Sbjct: 227 DEPINHFVANFIG 239


>POTA_STRP1 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 384

 Score =  114 bits (284), Expect = 1e-27
 Identities = 71/253 (28%), Positives = 133/253 (52%), Gaps = 23/253 (9%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++  +++SKTF   G   ++N++F +++G  Y+++G +G+GK+T+ N++ G+     G+I
Sbjct: 5   IITFNNVSKTFEDSGTQVLKNINFDLEEGKFYTLLGASGSGKSTILNIMAGLLDASSGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE ++ L    + ++ +   FQN  +  +MT  ENV                L+   
Sbjct: 65  YLDGERINDL---PINKRDIHTVFQNYALFPHMTVFENVAFA-------------LKLKK 108

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + + +  + +   E +  V LE + N     +S G  +R+ IARA+  +PR++ LDEP +
Sbjct: 109 VDKKE--IAKRVKETLKMVQLEGFENRSIQKLSGGQRQRVAIARAIINQPRVVLLDEPLS 166

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   E+   +R++    GIT V V HD +  + +SD I V+N G  +  G+  D+ 
Sbjct: 167 ALDLKLRTEMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNEGEIVQSGTPVDIY 226

Query: 240 DNP--EVIAAYLG 250
           D P    +A ++G
Sbjct: 227 DEPINHFVANFIG 239


>POTA_PASMU RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 370

 Score =  114 bits (284), Expect = 1e-27
 Identities = 70/251 (27%), Positives = 131/251 (52%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  ++K++G    ++N + +++ G   +++GP+G GKTT+  L+ G+     G I L
Sbjct: 10  IIELRSITKSYGDKTIIENFNLTINNGEFLTILGPSGCGKTTVLRLLAGLEELDSGNIIL 69

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE ++ +   Q   + +   FQ+  +  +MT  ENV  G             LR   + 
Sbjct: 70  DGEDITHVPAEQ---RHVNTVFQSYALFPHMTIFENVAFG-------------LRMQKVP 113

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             +  ++    E +  V LE Y  S+ + +S G  +R+ IARA+  KP++L LDE  +  
Sbjct: 114 NEE--IKPRVLEALRMVQLEEYAYSKPAQLSGGQQQRIAIARAVVNKPKVLLLDESLSAL 171

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++ N ++ +    GIT + V HD +  + +SDRI+VL  G    +GS R++ + 
Sbjct: 172 DYKLRKQMQNELKALQRKLGITFIFVTHDQEEALTMSDRIIVLRKGHIQQDGSPREIYEE 231

Query: 242 PE--VIAAYLG 250
           P+   +A ++G
Sbjct: 232 PKNLFVAKFIG 242


>POTA_LISMO RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 366

 Score =  114 bits (284), Expect = 1e-27
 Identities = 71/235 (30%), Positives = 121/235 (51%), Gaps = 21/235 (8%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           + NVSF +++G  Y+++GP+G GKTT+  LI G      G+I LG ++++ +  +   ++
Sbjct: 24  LDNVSFEIEKGKFYTLLGPSGCGKTTILRLIAGFLEASKGQIYLGDKVINQIPAN---KR 80

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
            +   FQ+  +  ++   ENV  G             LR   L++    + E   E + +
Sbjct: 81  PVNTVFQDYALFPHLNVYENVAFG-------------LRIKKLKK--EAIDEKVKEALRF 125

Query: 139 VGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIA 198
           V L+ Y   E S MS G  +R+ IARA+  +P ++ LDEP +  + K   E+   +R + 
Sbjct: 126 VNLKGYEKREISEMSGGQRQRVAIARAIVNEPEVILLDEPLSALDLKLRTEMQYELRDLQ 185

Query: 199 DS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EVIAAYLG 250
              GIT + V HD +  + +SD I VLN G     G+  D+ D P  + +A ++G
Sbjct: 186 KRLGITFIFVTHDQEEALAMSDEIFVLNKGEIQQSGTPIDIYDEPINKFVADFIG 240


>POTA_LACJO RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 363

 Score =  114 bits (284), Expect = 1e-27
 Identities = 69/240 (28%), Positives = 126/240 (52%), Gaps = 23/240 (9%)

Query: 15  GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQ 74
           G +A+++++ +++ G  YS++GP+G+GKTT+  +I G   P  G++   G+ ++ L    
Sbjct: 17  GFVALKDINLTIESGKFYSLLGPSGSGKTTILRIIAGFSEPTSGQVFFDGQDITNL---D 73

Query: 75  LARKGMGRTFQNLQICMNMTAIENVMVGGHL-SLDRNLVKSMLRFPSLRRADAVLREHAA 133
            A++ +   FQN  +  +M   ENV  G  +   D+  +K  ++                
Sbjct: 74  AAKRKINTVFQNYALFPHMNVFENVAFGLQIKKKDKQEIKLAVK---------------- 117

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           E +  V L+ + N E S +S G  +R+ IARA+  +P++L LDE  +  + +   ++   
Sbjct: 118 EALHMVQLDGFANREISELSGGQQQRVAIARAIVNQPKVLLLDESLSALDKRLRKDMQFE 177

Query: 194 VRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EVIAAYLG 250
           +R+I    GIT + V HD +  + +SD I VLN G+    GS  D+ D P  + +A ++G
Sbjct: 178 LREIQKKLGITFIFVTHDQEEALAMSDEIFVLNEGKIQQSGSPVDIYDEPVNDFVARFIG 237


>POTA_BACHK RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 327

 Score =  114 bits (284), Expect = 1e-27
 Identities = 70/251 (27%), Positives = 129/251 (51%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++++  + K FG  + +  +S  + +G   +++GP+G GKTTL  +I G  TP  G + L
Sbjct: 4   IIKVEAVEKHFGNQVIIPPLSLDIKEGEFLTILGPSGCGKTTLLRMIAGFETPTKGNLLL 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             E ++ L P+   ++ M   FQ+  +  +M   +N+  G            M + P+  
Sbjct: 64  DDEKINDLPPY---KRHMNLVFQHYALFPHMNVEKNICFG----------MKMQKVPA-- 108

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
              A  +E A E M    L  + N + + +S G  +R+ IARA+   PR+L LDEP    
Sbjct: 109 ---AEQKERAEEAMRLTQLLEFRNRKPAKLSGGQQQRVAIARAIVNNPRVLLLDEPLGAL 165

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   ++ +  + GIT + V HD +  M++SDRI+V+N G     G+ +++ + 
Sbjct: 166 DFKLRKDLQRELKNLQRNLGITFIYVTHDQEEAMSMSDRIVVMNKGHIEQIGTPKEIYNK 225

Query: 242 PEV--IAAYLG 250
           P+   +A ++G
Sbjct: 226 PKTLFVATFIG 236


>POTA_BACCZ RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 327

 Score =  114 bits (284), Expect = 1e-27
 Identities = 70/251 (27%), Positives = 129/251 (51%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++++  + K FG  + +  +S  + +G   +++GP+G GKTTL  +I G  TP  G + L
Sbjct: 4   IIKVEAVEKHFGNQVIIPPLSLDIKEGEFLTILGPSGCGKTTLLRMIAGFETPTKGNLLL 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             E ++ L P+   ++ M   FQ+  +  +M   +N+  G            M + P+  
Sbjct: 64  DDEKINDLPPY---KRHMNLVFQHYALFPHMNVEKNICFG----------MKMQKVPA-- 108

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
              A  +E A E M    L  + N + + +S G  +R+ IARA+   PR+L LDEP    
Sbjct: 109 ---AEQKERAEEAMRLTQLLEFRNRKPAKLSGGQQQRVAIARAIVNNPRVLLLDEPLGAL 165

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   ++ +  + GIT + V HD +  M++SDRI+V+N G     G+ +++ + 
Sbjct: 166 DFKLRKDLQRELKNLQRNLGITFIYVTHDQEEAMSMSDRIVVMNKGHIEQIGTPKEIYNK 225

Query: 242 PEV--IAAYLG 250
           P+   +A ++G
Sbjct: 226 PKTLFVATFIG 236


>POTA_BACC1 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 327

 Score =  114 bits (284), Expect = 1e-27
 Identities = 70/251 (27%), Positives = 129/251 (51%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++++  + K FG  + +  +S  + +G   +++GP+G GKTTL  +I G  TP  G + L
Sbjct: 4   IIKVEAVEKHFGNQVIIPPLSLDIKEGEFLTILGPSGCGKTTLLRMIAGFETPTKGNLLL 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             E ++ L P+   ++ M   FQ+  +  +M   +N+  G            M + P+  
Sbjct: 64  DDEKINDLPPY---KRHMNLVFQHYALFPHMNVEKNICFG----------MKMQKVPA-- 108

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
              A  +E A E M    L  + N + + +S G  +R+ IARA+   PR+L LDEP    
Sbjct: 109 ---AEQKERAEEAMRLTQLLEFRNRKPAKLSGGQQQRVAIARAIVNNPRVLLLDEPLGAL 165

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   ++ +  + GIT + V HD +  M++SDRI+V+N G     G+ +++ + 
Sbjct: 166 DFKLRKDLQRELKNLQRNLGITFIYVTHDQEEAMSMSDRIVVMNKGHIEQIGTPKEIYNK 225

Query: 242 PEV--IAAYLG 250
           P+   +A ++G
Sbjct: 226 PKTLFVATFIG 236


>POTA_BACAH RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 327

 Score =  114 bits (284), Expect = 1e-27
 Identities = 70/251 (27%), Positives = 129/251 (51%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++++  + K FG  + +  +S  + +G   +++GP+G GKTTL  +I G  TP  G + L
Sbjct: 4   IIKVEAVEKHFGNQVIIPPLSLDIKEGEFLTILGPSGCGKTTLLRMIAGFETPTKGNLLL 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             E ++ L P+   ++ M   FQ+  +  +M   +N+  G            M + P+  
Sbjct: 64  DDEKINDLPPY---KRHMNLVFQHYALFPHMNVEKNICFG----------MKMQKVPA-- 108

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
              A  +E A E M    L  + N + + +S G  +R+ IARA+   PR+L LDEP    
Sbjct: 109 ---AEQKERAEEAMRLTQLLEFRNRKPAKLSGGQQQRVAIARAIVNNPRVLLLDEPLGAL 165

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   ++ +  + GIT + V HD +  M++SDRI+V+N G     G+ +++ + 
Sbjct: 166 DFKLRKDLQRELKNLQRNLGITFIYVTHDQEEAMSMSDRIVVMNKGHIEQIGTPKEIYNK 225

Query: 242 PEV--IAAYLG 250
           P+   +A ++G
Sbjct: 226 PKTLFVATFIG 236


>PHNC2_NATPD RecName: Full=Phosphonates import ATP-binding protein
           phnC 2;         EC=3.6.3.28;
          Length = 267

 Score =  114 bits (284), Expect = 1e-27
 Identities = 77/238 (32%), Positives = 132/238 (55%), Gaps = 15/238 (6%)

Query: 3   LLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L +  L K +  G +A+ +VS +V      ++IGP+GAGK+TL   I  +  P  G + 
Sbjct: 1   MLRVESLRKVYDSGDVALDDVSLTVSGSETVAIIGPSGAGKSTLVRCINRLVEPTSGTVW 60

Query: 62  LGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVG--GHLSLDRNLVKSMLR 117
           L    V+GL   QL   R+ MG  FQ   +   +T +ENV+ G  G++S  +   +   +
Sbjct: 61  LDEREVTGLPEKQLPAVRRDMGMIFQEYNLIERLTVMENVLSGRLGYVSSWKGFRR---K 117

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           FP   + D    + A E++  VGL    N+ A  +S G  +R+ IARA+  +P+I+ +DE
Sbjct: 118 FP---QEDV---DRAFEILDRVGLSGLENNRADELSGGQRQRVGIARAVIQQPKIMLVDE 171

Query: 178 PAAGFNPKETAEIDNLVRKIA-DSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           P +  +P  + ++ +L+ +IA D G+ V+L  H++ + +  +DRI+ L  GR + +GS
Sbjct: 172 PTSSLDPDTSRDVMDLLTEIASDEGVPVLLNIHEVDLAVEYADRIVGLADGRIVYDGS 229


>METN_CAMJR RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 336

 Score =  114 bits (284), Expect = 1e-27
 Identities = 72/238 (30%), Positives = 126/238 (52%), Gaps = 7/238 (2%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +++I +L K +G  L + +VS  + +G +Y+++G +GAGK+TL   I G+    +G +++
Sbjct: 1   MIKIKNLKKYYGKELVINDVSLEIKKGEIYAIVGHSGAGKSTLLRCINGLENYQEGSLKV 60

Query: 63  GGELVSGLAPH-----QLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR 117
             + +  L+       ++ RK +G  FQN  +       ENV +       +    + L 
Sbjct: 61  FDQEIKDLSQKKSKELRMLRKDIGMIFQNFALMERKNVFENVAMPLRTHYTQCKFHAKL- 119

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           F     ++  + +    L+  VGL+    S    +S G  +R+ IARALA  P+IL  DE
Sbjct: 120 FNKEYMSEKEIAQKVNSLLEIVGLDHKNKSYPRELSGGQKQRVAIARALALNPKILLSDE 179

Query: 178 PAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
             +  +P  T  I  L+ KI A+ GITVVLV H+M +V +I+ + L+L +G+ +  G+
Sbjct: 180 ATSALDPNTTKNILELISKINAEFGITVVLVTHEMDVVKDIAQKALLLEHGQIIGSGA 237


>METN_CAMJE RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 336

 Score =  114 bits (284), Expect = 1e-27
 Identities = 72/238 (30%), Positives = 126/238 (52%), Gaps = 7/238 (2%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +++I +L K +G  L + +VS  + +G +Y+++G +GAGK+TL   I G+    +G +++
Sbjct: 1   MIKIKNLKKYYGKELVINDVSLEIKKGEIYAIVGHSGAGKSTLLRCINGLENYQEGSLKV 60

Query: 63  GGELVSGLAPH-----QLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR 117
             + +  L+       ++ RK +G  FQN  +       ENV +       +    + L 
Sbjct: 61  FDQEIKDLSQKKSKELRMLRKDIGMIFQNFALMERKNVFENVAMPLRTHYTQCKFHAKL- 119

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           F     ++  + +    L+  VGL+    S    +S G  +R+ IARALA  P+IL  DE
Sbjct: 120 FNKEYMSEKEIAQKVNSLLEIVGLDHKNKSYPRELSGGQKQRVAIARALALNPKILLSDE 179

Query: 178 PAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
             +  +P  T  I  L+ KI A+ GITVVLV H+M +V +I+ + L+L +G+ +  G+
Sbjct: 180 ATSALDPNTTKNILELISKINAEFGITVVLVTHEMDVVKDIAQKALLLEHGQIIGSGA 237


>METN2_BACLD RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  114 bits (284), Expect = 1e-27
 Identities = 73/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ + ++SK +    G V AVQ+V+ ++ +G ++ +IG +GAGK++L  L+ G+  P  G
Sbjct: 1   MINLQNVSKIYRSKHGDVNAVQDVTLTIKKGEIFGIIGYSGAGKSSLIRLLNGLEQPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G  +S +   +L  AR+ +   FQ+  +  + T  +N+                L
Sbjct: 61  TVEVAGRKISEIKGKKLRKARQEISMIFQHFNLLWSRTVRDNIAF-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               + +A  +  E  AEL+  VGLE   N+  S +S G  +R+ IARALA  P++L  D
Sbjct: 108 EIAGVSKAKRL--ERVAELIKLVGLEGKENAYPSQLSGGQKQRVGIARALANNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+  I +  G+T+VL+ H+M ++  I  R+ V+  G+ + EG  
Sbjct: 166 EATSALDPQTTDSILGLLSDINERLGLTIVLITHEMHVIRKICHRVAVMENGKVVEEGDV 225

Query: 236 RDVRDNPE 243
            +V   P+
Sbjct: 226 LNVFIKPK 233


>METN1_LISIN RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 338

 Score =  114 bits (284), Expect = 1e-27
 Identities = 75/243 (30%), Positives = 132/243 (54%), Gaps = 22/243 (9%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+  +SK+F      V AV+NVS +V++G ++ V+G +GAGK+TL   I  +  P  G
Sbjct: 1   MIELHQVSKSFNVNGKTVEAVKNVSITVEKGEIFGVVGYSGAGKSTLVRCINLLERPDAG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G+ +S L+  +L  AR+ +G  FQ   +    T  +N             +   L
Sbjct: 61  QVLIDGKNLSTLSSKELRVARRKIGMIFQGYNLLKTATVYDN-------------IAKPL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           +   + + +  +R +  + +  VGLE   N+  S +S G  +R+ IARALA +P IL  D
Sbjct: 108 KLEGVPKDEIEIRVN--KYLSIVGLEDKRNNYPSQLSGGQKQRVAIARALAHEPEILLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+ KI A+ GIT+ L+ H++ ++  I DR+ V+  G  + +G+ 
Sbjct: 166 EATSALDPETTEAILQLLLKINAELGITIFLITHELDVIQRICDRVAVMENGHLVEQGTV 225

Query: 236 RDV 238
            D+
Sbjct: 226 LDI 228


>CBIO1_METHJ RecName: Full=Cobalt import ATP-binding protein cbiO 1;
                   EC=3.6.3.-;
          Length = 277

 Score =  114 bits (284), Expect = 1e-27
 Identities = 73/251 (29%), Positives = 129/251 (51%), Gaps = 21/251 (8%)

Query: 1   MALLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           M ++E  DL  T+ G + A++N+SF   +    ++IGPNGAGK+TLF    G+  P  G+
Sbjct: 1   MHIIETQDLCHTYKGNIDALKNISFIAPRNTRIAIIGPNGAGKSTLFKHFNGVLKPTSGK 60

Query: 60  IRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGG--HLSLDRNLVKSMLR 117
           + + GE ++     ++ R+ +G  FQN    +    +E  +  G  ++ LD   VK    
Sbjct: 61  VLIRGEPITKENIREV-RRTVGLVFQNPDDQIFSPTVEQDVAFGPINMGLDEEAVK---- 115

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
                          +E +  VGL  Y       +S G  KR+ IA  +A +P++L LDE
Sbjct: 116 ------------HRVSEALRTVGLSEYRTRVPHHLSGGEKKRVAIAGIIAMEPQVLVLDE 163

Query: 178 PAAGFNPKETAEIDNLVRKIA-DSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR 236
           P AG +P+   EI   +R  +   G+TV+   H++ +V  +++ I V+N G  + EG+  
Sbjct: 164 PTAGLDPQGVREIIRFIRDFSVRYGMTVIFSTHNISLVAELAEYIYVMNNGSFVAEGTVA 223

Query: 237 DVRDNPEVIAA 247
           ++   P+++++
Sbjct: 224 EIFSQPDLLSS 234


>POTA_SPICI RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 350

 Score =  113 bits (283), Expect = 2e-27
 Identities = 68/242 (28%), Positives = 124/242 (51%), Gaps = 19/242 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+ ++SK + G + ++ ++ ++ +G   +++GP+G GKTT   +I G   P  GE+  
Sbjct: 5   ILELRNISKQYDGKVVLKGINLNIKEGEFVTLLGPSGCGKTTTLRIIAGFEQPNSGELLF 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+       H   ++ +   FQN  +  ++T  +N+  G  L + RN            
Sbjct: 65  LGKDYLKTPVH---KREVNTVFQNYALFPHLTVFDNIAYG--LKVKRNKYD--------- 110

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
               V+     + +  VGLE + +     +S G  +R+ +ARAL  KPR+L LDEP A  
Sbjct: 111 ----VIETEVKKFLQLVGLEGFEDKSVEQLSGGQRQRVALARALINKPRVLLLDEPMAAL 166

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   ++ +  + GIT +LV HD +  + +SDRI+V+N G     G+  ++ + 
Sbjct: 167 DVKLRKKMQAELKALQGEIGITFILVTHDQEEALTLSDRIIVMNDGAIQQVGTPAEIYNE 226

Query: 242 PE 243
           PE
Sbjct: 227 PE 228


>POTA_DESDG RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 373

 Score =  113 bits (283), Expect = 2e-27
 Identities = 77/254 (30%), Positives = 131/254 (51%), Gaps = 27/254 (10%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           + E+  +SK F    A++N+   +  G   +++GP+G GKTT+  L++G  TP  G++ L
Sbjct: 7   IFELRGVSKYFDDTCALENIDLQIRNGEFLTLLGPSGCGKTTILRLLSGFETPSSGDVIL 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G +V+ + P Q   + +   FQN  +  +MT  +NV  G  L + +            R
Sbjct: 67  SGRVVNDVPPEQ---RQVNTVFQNYALFPHMTVRDNVGFG--LKMQK------------R 109

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             D + R    E +  V LE + + + + +S G  +R+ IARA+   P +L LDEP +  
Sbjct: 110 PKDEIAR-RVREALKMVHLEQFGDRKPARLSGGQQQRVAIARAVVNNPYVLLLDEPFSAL 168

Query: 183 N----PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +     K   EI +L R++   GIT V V HD +    +SDR++V+N GR    GS +++
Sbjct: 169 DFKLRKKMQLEIKHLQRQL---GITFVFVTHDQEEAFAMSDRVVVMNDGRIEQIGSPQEI 225

Query: 239 RDNPE--VIAAYLG 250
            + P    +A ++G
Sbjct: 226 YEEPANLYVARFVG 239


>METN_HAEIN RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 345

 Score =  113 bits (283), Expect = 2e-27
 Identities = 71/248 (28%), Positives = 136/248 (54%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           +++++++ K F      + A+ NVS ++++G +  VIG +GAGK+TL   +  +  P  G
Sbjct: 1   MIKLNNIXKIFELPXKKLTALDNVSLNIEKGQICGVIGASGAGKSTLIRCVNLLEKPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G  ++ L+  +L  AR+ +G  FQ+  +  + T  ENV +   L  +        
Sbjct: 61  SVIVDGVELTKLSDRELVLARRQIGMIFQHFNLLSSRTVFENVALPLELESE-------- 112

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                  + A ++E    L+  VGL    ++  S +S G  +R+ IARALA+ P++L  D
Sbjct: 113 -------SKAKIQEKITALLDLVGLSEKRDAYPSNLSGGQKQRVAIARALASDPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L+++I  + GIT++L+ H+M++V  I D++ V++ GR + +G+ 
Sbjct: 166 EATSALDPATTQSILKLLKEINRTLGITILLITHEMEVVKQICDQVAVIDQGRLVEQGTV 225

Query: 236 RDVRDNPE 243
            ++  NP+
Sbjct: 226 GEIFANPK 233


>METN2_YERPE RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 328

 Score =  113 bits (283), Expect = 2e-27
 Identities = 77/247 (31%), Positives = 130/247 (52%), Gaps = 22/247 (8%)

Query: 3   LLEISDLSKTF--GGV--LAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I  LSKT+  GG+  +A++ VS  +  G V+ ++G +GAGK+TL   +  +  P  G
Sbjct: 1   MISIERLSKTYPQGGLPMVALEEVSLEIPTGSVFGIVGRSGAGKSTLIRCLNLLERPTSG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I++ G  ++ L+  +L   R+ +G  FQN  +  +    +N+ VG            ++
Sbjct: 61  RIQVDGRELTTLSDRELRLQRQNIGMIFQNFHLLHSRNVWDNIAVG----------LEII 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
             P  +R     ++  AEL+  VGL     +  S +S G  +R+ IARALAAKP  L  D
Sbjct: 111 GMPKAQR-----QQRVAELLDLVGLSDKAYAFPSQLSGGQKQRVGIARALAAKPSYLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA I  L+  I    G+T+VL+ H++ +V +I D   +L  GR +  G+ 
Sbjct: 166 EATSALDPETTASILALLSDINRQLGLTIVLITHELDVVKSICDNAALLETGRVVETGAI 225

Query: 236 RDVRDNP 242
            D+  +P
Sbjct: 226 ADLLSDP 232


>METN2_YERPA RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 328

 Score =  113 bits (283), Expect = 2e-27
 Identities = 77/247 (31%), Positives = 130/247 (52%), Gaps = 22/247 (8%)

Query: 3   LLEISDLSKTF--GGV--LAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I  LSKT+  GG+  +A++ VS  +  G V+ ++G +GAGK+TL   +  +  P  G
Sbjct: 1   MISIERLSKTYPQGGLPMVALEEVSLEIPTGSVFGIVGRSGAGKSTLIRCLNLLERPTSG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I++ G  ++ L+  +L   R+ +G  FQN  +  +    +N+ VG            ++
Sbjct: 61  RIQVDGRELTTLSDRELRLQRQNIGMIFQNFHLLHSRNVWDNIAVG----------LEII 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
             P  +R     ++  AEL+  VGL     +  S +S G  +R+ IARALAAKP  L  D
Sbjct: 111 GMPKAQR-----QQRVAELLDLVGLSDKAYAFPSQLSGGQKQRVGIARALAAKPSYLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA I  L+  I    G+T+VL+ H++ +V +I D   +L  GR +  G+ 
Sbjct: 166 EATSALDPETTASILALLSDINRQLGLTIVLITHELDVVKSICDNAALLETGRVVETGAI 225

Query: 236 RDVRDNP 242
            D+  +P
Sbjct: 226 ADLLSDP 232


>METN2_STAAN RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  113 bits (283), Expect = 2e-27
 Identities = 72/231 (31%), Positives = 122/231 (52%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V+ S+  G +Y VIG +GAGK+TL  +   +  P  GE+ + G+ +  L+ + L
Sbjct: 18  VLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +   FQ+  +  + T ++N+M               L    + R  A  ++ A 
Sbjct: 78  RAKRQKVNMIFQHFNLLWSRTVLKNIMF-------------PLEIAGVPRRRA--KQKAL 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+    +  S +S G  +R+ IARALA  P +L  DE  +  +P+ T EI +L
Sbjct: 123 ELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEILDL 182

Query: 194 VRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + KI +   +T+VL+ H+M ++  I D + V+  G+ +  G    V +NP+
Sbjct: 183 LLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEHGPVTQVFENPQ 233


>METN2_STAAM RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  113 bits (283), Expect = 2e-27
 Identities = 72/231 (31%), Positives = 122/231 (52%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V+ S+  G +Y VIG +GAGK+TL  +   +  P  GE+ + G+ +  L+ + L
Sbjct: 18  VLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +   FQ+  +  + T ++N+M               L    + R  A  ++ A 
Sbjct: 78  RAKRQKVNMIFQHFNLLWSRTVLKNIMF-------------PLEIAGVPRRRA--KQKAL 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+    +  S +S G  +R+ IARALA  P +L  DE  +  +P+ T EI +L
Sbjct: 123 ELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEILDL 182

Query: 194 VRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + KI +   +T+VL+ H+M ++  I D + V+  G+ +  G    V +NP+
Sbjct: 183 LLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEHGPVTQVFENPQ 233


>METN2_STAAB RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  113 bits (283), Expect = 2e-27
 Identities = 72/231 (31%), Positives = 122/231 (52%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V+ S+  G +Y VIG +GAGK+TL  +   +  P  GE+ + G+ +  L+ + L
Sbjct: 18  VLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +   FQ+  +  + T ++N+M               L    + R  A  ++ A 
Sbjct: 78  RAKRQKVSMIFQHFNLLWSRTVLKNIMF-------------PLEIAGVPRRRA--KQKAL 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+    +  S +S G  +R+ IARALA  P +L  DE  +  +P+ T EI +L
Sbjct: 123 ELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEILDL 182

Query: 194 VRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + KI +   +T+VL+ H+M ++  I D + V+  G+ +  G    V +NP+
Sbjct: 183 LLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEHGPVTQVFENPQ 233


>METN1_YERPS RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 328

 Score =  113 bits (283), Expect = 2e-27
 Identities = 77/247 (31%), Positives = 130/247 (52%), Gaps = 22/247 (8%)

Query: 3   LLEISDLSKTF--GGV--LAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I  LSKT+  GG+  +A++ VS  +  G V+ ++G +GAGK+TL   +  +  P  G
Sbjct: 1   MISIERLSKTYPQGGLPMVALEEVSLEIPTGSVFGIVGRSGAGKSTLIRCLNLLERPTSG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I++ G  ++ L+  +L   R+ +G  FQN  +  +    +N+ VG            ++
Sbjct: 61  RIQVDGRELTTLSDRELRLQRQNIGMIFQNFHLLHSRNVWDNIAVG----------LEII 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
             P  +R     ++  AEL+  VGL     +  S +S G  +R+ IARALAAKP  L  D
Sbjct: 111 GMPKAQR-----QQRVAELLDLVGLSDKAYAFPSQLSGGQKQRVGIARALAAKPSYLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA I  L+  I    G+T+VL+ H++ +V +I D   +L  GR +  G+ 
Sbjct: 166 EATSALDPETTASILALLSDINRQLGLTIVLITHELDVVKSICDNAALLETGRVVETGAI 225

Query: 236 RDVRDNP 242
            D+  +P
Sbjct: 226 ADLLSDP 232


>METN1_YERPN RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 328

 Score =  113 bits (283), Expect = 2e-27
 Identities = 77/247 (31%), Positives = 130/247 (52%), Gaps = 22/247 (8%)

Query: 3   LLEISDLSKTF--GGV--LAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I  LSKT+  GG+  +A++ VS  +  G V+ ++G +GAGK+TL   +  +  P  G
Sbjct: 1   MISIERLSKTYPQGGLPMVALEEVSLEIPTGSVFGIVGRSGAGKSTLIRCLNLLERPTSG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I++ G  ++ L+  +L   R+ +G  FQN  +  +    +N+ VG            ++
Sbjct: 61  RIQVDGRELTTLSDRELRLQRQNIGMIFQNFHLLHSRNVWDNIAVG----------LEII 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
             P  +R     ++  AEL+  VGL     +  S +S G  +R+ IARALAAKP  L  D
Sbjct: 111 GMPKAQR-----QQRVAELLDLVGLSDKAYAFPSQLSGGQKQRVGIARALAAKPSYLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA I  L+  I    G+T+VL+ H++ +V +I D   +L  GR +  G+ 
Sbjct: 166 EATSALDPETTASILALLSDINRQLGLTIVLITHELDVVKSICDNAALLETGRVVETGAI 225

Query: 236 RDVRDNP 242
            D+  +P
Sbjct: 226 ADLLSDP 232


>GLNQ_BACST RecName: Full=Glutamine transport ATP-binding protein
           glnQ;
          Length = 242

 Score =  113 bits (283), Expect = 2e-27
 Identities = 68/243 (27%), Positives = 131/243 (53%), Gaps = 17/243 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++    ++K +G    +++++ ++ QG V  +IGP+G+GK+TL   I  + T   GE+ +
Sbjct: 1   MIYFHQVNKYYGDFHVLKDINLTIHQGEVVVIIGPSGSGKSTLVRCINRLETISSGELIV 60

Query: 63  GGELVSG--LAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
               V+   +  +QL R+ +G  FQ+  +  +MT ++N+ +             +LR P 
Sbjct: 61  DNVKVNDKHIDINQL-RRNIGMVFQHFNLYPHMTVLQNITLAP---------MKVLRIP- 109

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
               +   +E A   +  VG+    N+  S +S G  +R+ IAR LA KP+I+  DEP +
Sbjct: 110 ----EKEAKETAMYYLEKVGIPDKANAYPSELSGGQQQRVAIARGLAMKPKIMLFDEPTS 165

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
             +P+   E+ ++++++A  G+T+V+V H+M     ++DRI+ ++ GR L E    +   
Sbjct: 166 ALDPETIGEVLDVMKQLAKEGMTMVVVTHEMGFAREVADRIVFMDQGRILEEAPPEEFFS 225

Query: 241 NPE 243
           NP+
Sbjct: 226 NPK 228


>Y5533_VIBVU RecName: Full=Putative ABC transporter ATP-binding
           protein VV2_1533;         EC=3.6.3.-;
          Length = 574

 Score =  113 bits (282), Expect = 2e-27
 Identities = 76/247 (30%), Positives = 130/247 (52%), Gaps = 21/247 (8%)

Query: 3   LLEISDLSKTFGGVL-AVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           LL++ +L+ ++ G   A++ VSF+V +G   S++G NG+GK+T+  LI G+  P DG I 
Sbjct: 298 LLDVRNLTYSYDGEKNALEGVSFNVQRGEFVSILGKNGSGKSTITKLIMGVIEPDDGAIY 357

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           L G+ +S L   + ++K +G   QN           N M+  H+  D       + F   
Sbjct: 358 LNGQDLSELTIFERSQK-VGVVMQN----------PNHMISHHMIFDE------VAFGLR 400

Query: 122 RRA--DAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
            R   +  + +   E++   GL  Y +    A+SYG  KR+ IA  LA +P +L LDEP 
Sbjct: 401 NRGWDEQQVNDKVLEVLELCGLSKYRHWPIEALSYGQKKRVTIASILALEPELLILDEPT 460

Query: 180 AGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           AG + +    + + + K+  + GITVV++ HDM +V+  + R +V+   + + +    DV
Sbjct: 461 AGQDYRNYTSMLSFIEKLNRELGITVVIISHDMHLVLEYTTRSIVIADSQLVADAPMTDV 520

Query: 239 RDNPEVI 245
             NP ++
Sbjct: 521 FSNPALL 527



 Score = 60.8 bits (146), Expect = 1e-11
 Identities = 61/241 (25%), Positives = 113/241 (46%), Gaps = 31/241 (12%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITG-----IYTPCDGEIRLGGELVSGLAPH 73
           ++N++  +++G    +IGP+G+GK+TL   + G     I     G + + G+  +  A H
Sbjct: 20  LRNINLRIEKGEKIVIIGPSGSGKSTLGQCLNGLIPHAIKGEVSGSLTINGQETATFAMH 79

Query: 74  QLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLD-RNLVKSMLRFPSLRRADAVLREHA 132
           Q   + +G   Q+       +    + +G  ++    N + S +   SL +A A +    
Sbjct: 80  QFTEQ-VGTVLQDTD-----SQFVGLSIGEDIAFALENQLTSNIEMYSLVKATAKM---- 129

Query: 133 AELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNP---KETAE 189
                 V LE  L      +S G  +R+ +A            DEP A  +P   K T E
Sbjct: 130 ------VDLEQMLQRSPHDLSGGQKQRVSLAGXXXXXXXXXXFDEPLAALDPKTGKRTIE 183

Query: 190 -IDNLVRKIADSGITVVLVEHDMKMVMNIS-DRILVLNYGRKLTEGSARDVRDNPEVIAA 247
            ID L RK   +G TVV++EH ++ V++   DRI++++ G  + + +  ++  +P ++A 
Sbjct: 184 IIDELHRK---TGKTVVIIEHRLEDVLHRHVDRIILMDDGEIMADTTPDELLASP-LLAQ 239

Query: 248 Y 248
           Y
Sbjct: 240 Y 240


>Y1078_HAEIN RecName: Full=Probable amino-acid ABC transporter
           ATP-binding protein HI1078;
          Length = 257

 Score =  113 bits (282), Expect = 2e-27
 Identities = 69/242 (28%), Positives = 126/242 (52%), Gaps = 21/242 (8%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLIT-------GIY 53
           M++L++S++ K F G   ++ + F +++G V +++GP+G+GKTT    +        GI 
Sbjct: 1   MSMLKVSNIQKNFNGNHVLKGIDFEINKGEVVAILGPSGSGKTTFLRCLNLLERPEQGIL 60

Query: 54  TPCDGEIRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVK 113
              DG +++        A     R+     FQ   +  + +A+ENVM G           
Sbjct: 61  EFTDGSLKIDFSQKISKADELKLRRRSSMVFQQYNLFPHRSALENVMEG----------- 109

Query: 114 SMLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRIL 173
            M+      +A A  RE A  L+  VGL+   +   S +S G  +R+ IARALA KP I+
Sbjct: 110 -MVVVQKQDKAQA--REKALSLLEKVGLKNKADLFPSQLSGGQQQRVGIARALAVKPDII 166

Query: 174 FLDEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
            LDEP +  +P+   E+   ++ +A  G T+++V H+M+   +++DR++++  G  + + 
Sbjct: 167 LLDEPTSALDPELVGEVLQTLKMLAQEGWTMIIVTHEMQFAKDVADRVILMADGHIVEQN 226

Query: 234 SA 235
           +A
Sbjct: 227 TA 228


>METN_LACS1 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 353

 Score =  113 bits (282), Expect = 2e-27
 Identities = 74/236 (31%), Positives = 125/236 (52%), Gaps = 23/236 (9%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           V AV+NV+ +V++G ++ V+G +GAGK+TL   I  +  P  G +++ G L+      Q+
Sbjct: 21  VNAVKNVNLNVEKGDIFGVVGYSGAGKSTLVRTINLLQKPTSGTVKVNGTLLFADNKQQI 80

Query: 76  A-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
           +       R+ +G  FQ+  +    T ++NV                LR  SL  +D  +
Sbjct: 81  SNKELQKQRRSIGMIFQHFNLLNETTVVDNVAFA-------------LRHSSL--SDKEI 125

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
            E A  L+  VGLE         +S G  +R+ IARALA  P IL  DE  +  +P+ T 
Sbjct: 126 EEKALNLLKLVGLEDKAKFYPIQLSGGEQQRVAIARALANDPEILISDESTSALDPRTTN 185

Query: 189 EIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           +I +L++++ A  G+T+VL+ H+M  V  I+++I ++ +G  + +G  RDV   P+
Sbjct: 186 QILDLLKELNAKLGLTIVLITHEMDAVKRIANKIAIMEHGVIIEKGKLRDVYLRPK 241


>METN3_BACSK RecName: Full=Methionine import ATP-binding protein
           metN 3;         EC=3.6.3.-;
          Length = 342

 Score =  113 bits (282), Expect = 2e-27
 Identities = 71/248 (28%), Positives = 128/248 (51%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ +  +SKTF    G V AV NV+  ++ G ++ +IG +GAGK+TL  L+  +  P +G
Sbjct: 1   MISLKGISKTFKTKNGAVQAVDNVNLEIEAGQIFGIIGYSGAGKSTLIRLLNLLEKPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            +++ G+ +S L P +L  AR+ +G  FQ+  +  + T  +N+          +    + 
Sbjct: 61  SVKIDGKALSSLTPSKLRAARQEIGMIFQHFNLLWSRTVRQNI----------SFPLEVA 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
             P+ +R     ++   EL+  VGL    +S  S +S G  +R+ IARALA  P++L  D
Sbjct: 111 GVPAAQR-----KKRVEELIELVGLHGRGDSYPSQLSGGQKQRVGIARALANNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +PK T           +   +T+VL+ H+M ++  I  ++ V+  G+ + +G  
Sbjct: 166 EATSALDPKTTDSXXXXXXXXNEKLNLTIVLITHEMHVIQKICHQVAVMENGKIVEQGPV 225

Query: 236 RDVRDNPE 243
            DV   P+
Sbjct: 226 IDVFRKPK 233


>METN2_STAAR RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  113 bits (282), Expect = 2e-27
 Identities = 71/231 (30%), Positives = 122/231 (52%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V+ S+  G +Y VIG +GAGK+TL  +   +  P  GE+ + G+ +  L+ + L
Sbjct: 18  VLAVDHVNLSIRAGSIYGVIGFSGAGKSTLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +   FQ+  +  + T ++N+M               L    + R  A  ++ A 
Sbjct: 78  RAKRQKVSMIFQHFNLLWSRTVLKNIMF-------------PLEIAGVPRRRA--KQKAL 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+    +  S +S G  +R+ IARALA  P +L  DE  +  +P+ T EI +L
Sbjct: 123 ELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLLCDEATSALDPQTTDEILDL 182

Query: 194 VRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + KI +   +T++L+ H+M ++  I D + V+  G+ +  G    V +NP+
Sbjct: 183 LLKIREQQNLTIILITHEMHVIRRICDEVAVMESGKVIEHGPVTQVFENPQ 233


>METN2_BACCR RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 339

 Score =  113 bits (282), Expect = 2e-27
 Identities = 76/243 (31%), Positives = 130/243 (53%), Gaps = 21/243 (8%)

Query: 6   ISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGG 64
           +S L ++ G  V AV++V+ SV++G ++ +IG +GAGK+TL  L+  +  P  G I +  
Sbjct: 7   VSKLYESAGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKSTLLRLVNMLERPTAGTISIDD 66

Query: 65  ELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLS-LDRNLVKSMLRFPSL 121
           + ++ L+  +L   R+ +G  FQ+  +  + T   N+     L+ + +N +K        
Sbjct: 67  KDITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIAYPLKLAKVPKNEIK-------- 118

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
                   E   EL+ +VGLE   N     +S G  +R+ IARALA  P IL  DE  + 
Sbjct: 119 --------ERVNELLKFVGLEDKANYYPEQLSGGQKQRVGIARALATSPDILICDEATSA 170

Query: 182 FNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
            +P+ T EI NL++K+  +  +T++L+ H+M +V  I  R+ V+  G+ + EG   DV  
Sbjct: 171 LDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEEGKLFDVFT 230

Query: 241 NPE 243
            P+
Sbjct: 231 QPK 233


>Y1583_CLOPE RecName: Full=Putative ABC transporter ATP-binding
           protein CPE1583;         EC=3.6.3.-;
          Length = 568

 Score =  112 bits (281), Expect = 3e-27
 Identities = 69/244 (28%), Positives = 129/244 (52%), Gaps = 16/244 (6%)

Query: 3   LLEISDLSKTFGGVLAV-QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           LLE  ++S ++     +  +++F +++G + SV+G NGAGK+T+  +I G +    G+I 
Sbjct: 302 LLEFKNVSFSYDKKKDILSDINFKINRGDIVSVVGKNGAGKSTISKIICGFFKESKGDIL 361

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
             G+ + G    +   + +G   QN    ++ T I + +  G            LR   +
Sbjct: 362 FEGKSLDGKTIKERGEE-IGVVLQNPNQMISKTMIFDEVALG------------LRVRGI 408

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
              +  ++E   E +   GL  Y N   SA+S+G  KR+ IA  L   P+++ LDEP AG
Sbjct: 409 DEKE--VKERVIETLKTCGLYPYRNWPVSALSFGQKKRVTIASILVLNPKVIILDEPTAG 466

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
            + K   EI   + K+   G+T++L+ HDM +++  +D+ +V++ GRK+ + ++ ++  +
Sbjct: 467 QDYKHYNEIMEFLLKLNKKGVTIILITHDMHLMLEYTDKAIVISNGRKIADTTSAEILTD 526

Query: 242 PEVI 245
            EVI
Sbjct: 527 KEVI 530



 Score = 62.0 bits (149), Expect = 5e-12
 Identities = 58/247 (23%), Positives = 113/247 (45%), Gaps = 26/247 (10%)

Query: 2   ALLEISDLSK--TFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           A++E  D +   T      + N++ ++ +G    + GP+G+GK+TL N I G+  P   +
Sbjct: 5   AIIEFKDFTAHYTVQSKPTLNNINLTIYEGEKVLIAGPSGSGKSTLANCINGL-IPFSTD 63

Query: 60  IRLGGEL-VSGLAPHQLA----RKGMGRTFQNLQI-CMNMTAIENVMVGGHLSLDRNLVK 113
           I + G L + G     L+     K +G   Q+     + +T  E++       L+ N V 
Sbjct: 64  IEISGSLKIKGKETKDLSVFEISKMVGTVLQDPDSQFIGLTVAEDIA----FKLENNCV- 118

Query: 114 SMLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRIL 173
                     +   +++    +   V +E  L+    ++S G  +R+ +A  +     IL
Sbjct: 119 ----------SQEEMKKKVNYVSKIVDIENRLDLAPYSLSGGQKQRVTLAGTIVDDVDIL 168

Query: 174 FLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNIS-DRILVLNYGRKLT 231
             DEP A  +P        L+ KI  +   TV+++EH ++ V+N   DRI+++N G  + 
Sbjct: 169 LFDEPLASLDPAAGKASIELIDKIQKEEKKTVIIIEHRLEEVLNCDVDRIILMNEGEIIA 228

Query: 232 EGSARDV 238
           + +  ++
Sbjct: 229 DTNPNEI 235


>XYLG_ECOLI RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 513

 Score =  112 bits (281), Expect = 3e-27
 Identities = 69/250 (27%), Positives = 125/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ +++KTFG V A+ NV   ++ G + S+ G NG+GK+TL  ++ GIY     +GEI
Sbjct: 4   LLEMKNITKTFGSVKAIDNVCLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              GE +         RKG+    Q L +   +T +EN+ +G  ++ +  +   ++    
Sbjct: 64  IFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMTL-- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                        +L+  V L    ++    +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 122 ----------RCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
               +ET+ + +++R +   GI  + + H +  V  ISD I V+  G+ +    A  + +
Sbjct: 172 SLTEQETSILLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSE 231

Query: 241 NPEVIAAYLG 250
           + ++I   +G
Sbjct: 232 D-DIITMMVG 240



 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 57/222 (25%), Positives = 102/222 (45%), Gaps = 28/222 (12%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVSGLAPHQLAR 77
           V +VSFS+ +G +  + G  GAG+T     + G++    +G+I + G+ V      Q   
Sbjct: 277 VNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIA 336

Query: 78  KGMGRTFQN---------LQICMNMT-AIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           +G+    ++         + +  N+T A  N   GG   LD                DA 
Sbjct: 337 QGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGGISQLD----------------DAA 380

Query: 128 LREHAAELMVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKE 186
            ++   E +  + ++      A   +S G  ++  +AR L   PRIL LDEP  G +   
Sbjct: 381 EQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGA 440

Query: 187 TAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
             EI  L+ ++   GI V+++  ++  V+ +SDR+LV++ G+
Sbjct: 441 KYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHEGK 482


>POTA_BACAN RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 327

 Score =  112 bits (281), Expect = 3e-27
 Identities = 70/251 (27%), Positives = 128/251 (50%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++++  + K FG  + +  +S  + +G   +++GP+G GKTTL  +I G  TP  G + L
Sbjct: 4   IIKVEAVEKHFGNQVIIPPLSLDIKEGEFLTILGPSGCGKTTLLRMIAGFETPTKGNLLL 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             E ++ L P+   ++ M   FQ+  +  +M   +N+  G            M + P   
Sbjct: 64  DDEKINDLPPY---KRHMNLVFQHYALFPHMNVEKNICFG----------MKMQKVPV-- 108

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
              A  +E A E M    L  + N + + +S G  +R+ IARA+   PR+L LDEP    
Sbjct: 109 ---AEQKERAEEAMRLTQLLEFRNRKPAKLSGGQQQRVAIARAIVNNPRVLLLDEPLGAL 165

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   ++ +  + GIT + V HD +  M++SDRI+V+N G     G+ +++ + 
Sbjct: 166 DFKLRKDLQRELKNLQRNLGITFIYVTHDQEEAMSMSDRIVVMNKGHIEQIGTPKEIYNK 225

Query: 242 PEV--IAAYLG 250
           P+   +A ++G
Sbjct: 226 PKTLFVATFIG 236


>PHNC2_HALWD RecName: Full=Phosphonates import ATP-binding protein
           phnC 2;         EC=3.6.3.28;
          Length = 281

 Score =  112 bits (281), Expect = 3e-27
 Identities = 77/254 (30%), Positives = 128/254 (50%), Gaps = 23/254 (9%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           M+ L + +++KT+G V+A+ +VSF ++   V  ++G +GAGK+T+   + G+  P +GEI
Sbjct: 1   MSTLTVDNVTKTYGDVVALDSVSFEIENEFVV-LLGESGAGKSTMLRCVNGLTHPTEGEI 59

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
           RL G+ ++G      +R  +G  FQ   +   ++A  N + G   SLDR    S L    
Sbjct: 60  RLNGDPING------SRSDIGMIFQQHNLVDGVSAYMNALTG---SLDRTSTVSSL---- 106

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           L++ +   +E A E +  VGL    +   S MS G  +R+ IARAL   P +L  DEP A
Sbjct: 107 LQQQNKETKERALEALQTVGLLEESHQRTSQMSGGQQQRVGIARALVQDPALLLADEPVA 166

Query: 181 GFNPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYG--------RKLT 231
             +P     + + ++K A    +T ++  H + +     +R + L  G         KLT
Sbjct: 167 SLDPSSAESVMDYLKKAASVHEVTALVSLHQVNIAAYFGERFIGLRDGEILFDVSPEKLT 226

Query: 232 EGSARDVRDNPEVI 245
            G   D+  N E +
Sbjct: 227 PGLVDDLYGNVETV 240


>MGLA_CLOPS RecName: Full=Galactose/methyl galactoside import
           ATP-binding protein mglA;         EC=3.6.3.17;
          Length = 515

 Score =  112 bits (281), Expect = 3e-27
 Identities = 63/238 (26%), Positives = 120/238 (50%), Gaps = 16/238 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ ++SK F GV A+ NV+  V +G V++++G NGAGK+TL   + GIY P  GEI +
Sbjct: 7   LLEMRNISKEFPGVKALDNVTLKVKKGSVHALMGENGAGKSTLMKCLFGIYHPNSGEIFI 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP--S 120
            G+ V           G+    Q L        ++N+ +G              R+P   
Sbjct: 67  SGQKVQFKNSKHALDNGVSMVHQELNQVRERNVMDNLWLG--------------RYPKKG 112

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           L   +  + +   ++   + +      + S +S   ++ +EIA+A++ K +I+ +DEP +
Sbjct: 113 LFIDEKKMYDETEKIFKDLDINVNPRDKVSTLSVSQMQMVEIAKAVSYKSKIIVMDEPTS 172

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
               KE + +  ++ K+   GI+++ + H M+ ++ ISD + ++  G+ +    A D+
Sbjct: 173 SLTEKEVSHLFKIINKLRKQGISIIYISHKMEEILEISDEVTIMRDGKWIATEKASDL 230



 Score = 63.2 bits (152), Expect = 2e-12
 Identities = 55/231 (23%), Positives = 104/231 (45%), Gaps = 20/231 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+++LS        ++NVSF + +G +  + G  GA +T     + G+     G+I L
Sbjct: 259 ILEVNNLSDAKN---ELKNVSFKLRKGEILGIAGLVGAKRTETLETLFGLREKGSGDIIL 315

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V    P +  + G     +  +            + G L +D N +  +    S +
Sbjct: 316 HGKKVDNSKPFKAMQNGFALVTEERR---------QTGIFGKLPIDFNSI--IANIDSYK 364

Query: 123 RADAVL---REHAAELMVYVGLEAYLNSEAS---AMSYGALKRLEIARALAAKPRILFLD 176
            +  +L   R       V   ++    S+ +   ++S G  +++ I + L  KP IL LD
Sbjct: 365 TSTGLLSNGRISKDTQWVINSMKVKTPSQKTLIGSLSGGNQQKIVIGKWLLRKPEILLLD 424

Query: 177 EPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           EP  G +     EI  L+ ++A     +++V  +M  ++ + DRILV++ G
Sbjct: 425 EPTRGIDVGAKFEIYQLINELAKEDKGIIMVSSEMPELLGVCDRILVMSNG 475


>METN_MYCSS RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 333

 Score =  112 bits (281), Expect = 3e-27
 Identities = 75/243 (30%), Positives = 122/243 (50%), Gaps = 18/243 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++EI +L+K FG    + ++S SV  G + +V+GP+GAGK+TL   ++ +  P  G +R+
Sbjct: 1   MIEIDNLTKRFGDRTVLDDISLSVGAGEILAVVGPSGAGKSTLSRCVSFLERPTSGSVRV 60

Query: 63  GGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            G   + L    L  AR+ +G  FQ   +    T  +NV                L    
Sbjct: 61  DGADFTRLEGDALIAARRKIGVIFQTAPLLRRRTVAQNV---------------ALPLEY 105

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           LR  D  +     EL+  VGL        + +S G  +R+ IARALA  P +L  DE  +
Sbjct: 106 LRATDDSVSRRVTELLDRVGLRDRSGYHPAQLSGGQRQRVGIARALALGPSVLLSDEATS 165

Query: 181 GFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
           G +P  T  I  L+  +  D G++++L+ H+M++V  I+D +  ++ GR +  GS  DV 
Sbjct: 166 GLDPATTKSILALLSHLREDFGLSIILITHEMEVVREIADSVARIDDGRIVESGSVTDVI 225

Query: 240 DNP 242
            +P
Sbjct: 226 LDP 228


>METN1_PSEPF RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 335

 Score =  112 bits (281), Expect = 3e-27
 Identities = 76/248 (30%), Positives = 133/248 (53%), Gaps = 21/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E  ++ KT+      + A+   SFS++ G V+ +IG +GAGK+TL  LI  +     G
Sbjct: 1   MIEFQNVHKTYRVAGKDITALHPTSFSIENGQVFGLIGHSGAGKSTLLRLINRLEQSSGG 60

Query: 59  EIRLGGELVSGLAPHQLAR--KGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           +I + GE V+ L  + L R  + +G  FQ+  +  + T  +NV      +L   L   + 
Sbjct: 61  KIIVDGEEVTALDANGLRRFRQQVGMIFQHFNLLASKTVADNV------ALPLTLAGELS 114

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           R        A + +  AEL+  VGL  +     + +S G  +R+ IARALA KP+IL  D
Sbjct: 115 R--------AEIDQRVAELLARVGLSDHAKKYPAQLSGGQKQRVGIARALATKPKILLCD 166

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA +  L+ +I  +  +T+VL+ H+M ++  + D++ V++ G  + +GS 
Sbjct: 167 EATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVGVMDAGVIVEQGSV 226

Query: 236 RDVRDNPE 243
            DV  +P+
Sbjct: 227 ADVFLHPK 234


>CYSA_PSESM RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase;
          Length = 326

 Score =  112 bits (281), Expect = 3e-27
 Identities = 74/240 (30%), Positives = 116/240 (48%), Gaps = 15/240 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ ++SK F    A+ N+S  +  G + +++GP+G GKTTL  +I G+ TP DG I   
Sbjct: 3   IEVRNVSKNFNAFKALNNISLDIQSGELVALLGPSGCGKTTLLRIIAGLETPDDGSIVFH 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE VSG   H +  + +G  FQ+  +  +MT  +NV  G             ++  S R 
Sbjct: 63  GEDVSG---HDVRDRNVGFVFQHYALFRHMTVFDNVAFG-----------LRMKPKSERP 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +  + E   EL+  V L+   +     +S G             +P++L LDEP    +
Sbjct: 109 NETRIAEKVHELLNMVQLDWLADRYPEQLSGGXXXXXXXXXXXXVEPKVLLLDEPFGALD 168

Query: 184 PKETAEIDN-LVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            K   E+   L R   D  +T V V HD +  M ++DRI+V+N G     GS  +V +NP
Sbjct: 169 AKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPGEVYENP 228


>Y1368_CLOAB RecName: Full=Putative ABC transporter ATP-binding
           protein CA_C1368;         EC=3.6.3.-;
          Length = 279

 Score =  112 bits (280), Expect = 4e-27
 Identities = 64/233 (27%), Positives = 122/233 (52%), Gaps = 17/233 (7%)

Query: 15  GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQ 74
           G  A+ +++ S+ +G   +++GPNGAGK+TLFN++ GI +P  GE+++ G          
Sbjct: 16  GFEALHDINMSIKKGERVAILGPNGAGKSTLFNMLNGIISPTSGEVKINGLDTKVKKNLN 75

Query: 75  LARKGMGRTFQNL-QICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
           + R+ +G  FQ+      N + ++ +  G                 +++ ++  L+    
Sbjct: 76  VIRRDVGMVFQDSDDQLFNSSVMQEIAYG---------------LVNMKVSEEELQSRVK 120

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
             +  V ++ +       +S G  KR+ +A  LA KP +L LDEP    +P+ T ++  L
Sbjct: 121 WALNVVNMDGFEKKSPHNLSGGQKKRIALASVLAMKPEVLVLDEPTVSLDPRGTIKLVKL 180

Query: 194 VRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVI 245
           ++KI  +  IT+V   HDM +V   +D++ VLN G+ + +G  ++V +N +V+
Sbjct: 181 LKKINEEMKITIVFSTHDMDIVPLFADKVYVLNEGKLILQGGVKEVFNNKKVL 233


>RBSA3_RUBXD RecName: Full=Ribose import ATP-binding protein rbsA 3;
                   EC=3.6.3.17;
          Length = 495

 Score =  112 bits (280), Expect = 4e-27
 Identities = 71/231 (30%), Positives = 116/231 (50%), Gaps = 22/231 (9%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++ +  +SK F GV+AV  V   +  G V+ V G NGAGK+TL  L++ +  P  GEI +
Sbjct: 4   VVRLRGVSKEFPGVVAVDGVDLDILPGEVHVVAGENGAGKSTLMKLLSQVERPTSGEIYI 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL- 121
            GE V    P    R G+   +Q   +  +++  EN+ +G              R P   
Sbjct: 64  SGERVEFHGPGHARRLGVAMVYQEFALAPHLSVAENLFLG--------------REPGRG 109

Query: 122 ----RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
               RRA+   +E A  L+  VGLE   +   S+++    +R+EIA+ALA   R++ +DE
Sbjct: 110 GFVNRRAE---KEEARGLLRRVGLEVDPDRLVSSLTVAEQQRVEIAKALAIDARVVIMDE 166

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P A    KE  E+  ++R +   G  V+ + H +  +  I+DR+ V+  G+
Sbjct: 167 PTATLAEKEIEELFEVIRDLTSHGRAVLYISHRLDEIFRIADRVTVMRDGK 217



 Score = 68.6 bits (166), Expect = 6e-14
 Identities = 55/214 (25%), Positives = 97/214 (45%), Gaps = 16/214 (7%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           +++ SF V  G +    G  GAG+T L   + G      GEI L G  +    P      
Sbjct: 268 LKDCSFEVRAGEILGFAGLVGAGRTELARAVFGADPVDSGEIELEGRPLRIRKPQDAIEA 327

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNL----VKSMLRFPSLRRADAVLREHAAE 134
           G+G   ++ +            +   L +D+N+    + + L F  L R  ++      +
Sbjct: 328 GIGYLTEDRK---------GEGLALQLGIDQNITLASLPARLGFIGLGRERSIAERRREQ 378

Query: 135 LMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           L +       +  +   +S G  +++ +AR L  + R+LF DEPA G +    AE+  L+
Sbjct: 379 LNIRT---PSVRRKVQVLSGGNQQKVVVARWLETRARVLFFDEPARGIDVGAKAEMFALI 435

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            ++A  G  +VL+   +  ++N+ DRILV+  GR
Sbjct: 436 GELAREGRGIVLISSYLPELINMCDRILVMRDGR 469


>RBSA1_BURS3 RecName: Full=Ribose import ATP-binding protein rbsA 1;
                   EC=3.6.3.17;
          Length = 517

 Score =  112 bits (280), Expect = 4e-27
 Identities = 70/226 (30%), Positives = 118/226 (52%), Gaps = 9/226 (3%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIY-TPCDGEIR 61
           LLE+  +SKTF  V A+ NVS +V  G ++S++G NGAGK+TL  +++G Y     GEI 
Sbjct: 10  LLEMRGISKTFPAVRALDNVSLTVYPGEIHSLMGENGAGKSTLMKILSGAYRADAGGEIL 69

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + G  +    P      G+   +Q L +  N++  EN+ +G  L        ++ R    
Sbjct: 70  IDGTRIDIDGPLAARDAGVAVIYQELCLSPNLSVAENIYIGRELRRGNRRWGTIDRAAMA 129

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           R  + VL    A L    G +  +++    +S    + +EIARA+  + RIL +DEP   
Sbjct: 130 RGCEDVL----ARLSASFGPDTLVDT----LSIAEQQLVEIARAVHTRARILVMDEPTTP 181

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            + +ET  +  L+R++ + G+ ++ + H M  +  +SDR+ VL  G
Sbjct: 182 LSSRETEHLFRLIRQLREEGLAIIYISHRMAEIYELSDRVSVLRDG 227



 Score = 73.6 bits (179), Expect = 2e-15
 Identities = 57/214 (26%), Positives = 101/214 (47%), Gaps = 16/214 (7%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V+  S  +  G V  + G  GAG+T L  LI G      G++++G       +P      
Sbjct: 281 VRGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRVRGDVKVGERTFGAHSPRDAIDA 340

Query: 79  GM-----GRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
           G+      R  Q L + M++    N+ V    + D  L    L   + R  DA+     A
Sbjct: 341 GLVYLTEDRKRQGLFLDMSVRDNINISV---CNRDARLGSLDLARGAERARDAI-----A 392

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
            L + V      N    A+S G  +++ ++R L  KPR+L LDEP  G +    +EI  +
Sbjct: 393 SLSIRV---PDANVNVGALSGGNQQKVLLSRLLETKPRVLILDEPTRGVDIGAKSEIYRI 449

Query: 194 VRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           + ++A +G+ V+++  ++  ++ ++DR+LV+  G
Sbjct: 450 INELARAGVGVIVISSELPEIIGVADRVLVMREG 483


>POTA_LACC3 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 362

 Score =  112 bits (280), Expect = 4e-27
 Identities = 65/251 (25%), Positives = 130/251 (51%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  + K +G    +++++  ++QG  Y+++GP+G+GKTT+   I G     +GE+  
Sbjct: 5   IVELKHVGKRYGDTQVLKDINIEIEQGKFYTLLGPSGSGKTTILRAIAGFLDVSEGEVLF 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ ++ +  +Q   + +   FQ+  +  ++   +NV  G             LR   + 
Sbjct: 65  DGKRINDVPANQ---RKVNTVFQDYALFPHLNVFDNVAFG-------------LRLHRMS 108

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           + D  ++    + +  V L+ Y + E S +S G  +R+ IARA+  +P++L LDEP +  
Sbjct: 109 KQD--IQTKVEDALKMVRLQGYADREISELSGGQQQRVAIARAIVLEPQVLLLDEPLSAL 166

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   +R++ +  GIT + V HD +  + +SD I V+N G     G+  D+ D 
Sbjct: 167 DAKLRKDMQYELRELQERLGITFLFVTHDQEEALALSDEIFVMNDGEVQQSGTPVDIYDE 226

Query: 242 P--EVIAAYLG 250
           P    +A ++G
Sbjct: 227 PVNHFVADFIG 237


>PHNC_CHRSD RecName: Full=Phosphonates import ATP-binding protein
           phnC;         EC=3.6.3.28;
          Length = 272

 Score =  112 bits (280), Expect = 4e-27
 Identities = 76/238 (31%), Positives = 130/238 (54%), Gaps = 15/238 (6%)

Query: 3   LLEISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +LE+  L+KT+  G  A++ VS +V +G V  +IGP+GAGK+TL   I  +  P  G I 
Sbjct: 1   MLELQRLTKTYATGDTALREVSLAVPRGQVVGLIGPSGAGKSTLIRCINRLVAPSGGRIL 60

Query: 62  LGGELVSGLAPHQLAR--KGMGRTFQNLQICMNMTAIENVMVG--GHLSLDRNLVKSMLR 117
           LG   ++ +   +L R  + +G  FQ   +   +T +ENV+ G  G++   R+  +   R
Sbjct: 61  LGDVDLAAVGRAELRRQRRRIGMIFQEYALVERLTVMENVLSGRLGYVPFWRSFTR---R 117

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           FP          E+A  L+  VGL A+ +  A A+S G  +R+ IARALA +P +L +DE
Sbjct: 118 FPGRDI------ENAYRLLDRVGLLAHADKRADALSGGQRQRVGIARALAQEPALLLVDE 171

Query: 178 PAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           P A  +PK + +I  L+ ++ +   +  ++  HD+ +      R++ L+ G  + +G+
Sbjct: 172 PTASLDPKTSRQIMRLILEVCEERDLPAIVNIHDVPLAQQFMHRLVGLHAGEVVFDGA 229


>PHNC_ALCFA RecName: Full=Phosphonates import ATP-binding protein
           phnC;         EC=3.6.3.28;
          Length = 276

 Score =  112 bits (280), Expect = 4e-27
 Identities = 77/239 (32%), Positives = 126/239 (52%), Gaps = 15/239 (6%)

Query: 3   LLEISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +LEI +L K++  G  A++ V+ SV  G +  +IGP+GAGK+TL   +  +  P +G + 
Sbjct: 1   MLEIHNLQKSYSTGDKALKGVNLSVQPGELLGLIGPSGAGKSTLIRCVNRLVEPSEGRVL 60

Query: 62  LGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           L G+ ++ L  H L  AR+ +G  FQ   +   +T +EN++  G L           RF 
Sbjct: 61  LNGKDLANLGRHDLRMARRRIGMIFQEYALVERLTVMENLL-SGRLGYSGFWPSWFRRFS 119

Query: 120 --SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
              +R A A+L          VGL+   N  A A+S G  +R+ IARAL  KP +L +DE
Sbjct: 120 PEDIRLAYALLER--------VGLDGMHNKRADALSGGQRQRVGIARALMQKPDLLLVDE 171

Query: 178 PAAGFNPKETAEIDNLVRKIA-DSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           P A  +PK + ++  LV ++  + G++ ++  HD+ +      RI+ L  G  + +G A
Sbjct: 172 PTASLDPKTSRQVMRLVLELCREHGLSAIINIHDVVLATEYLPRIVGLRAGAVVYDGPA 230


>NODI2_RHIME RecName: Full=Nod factor export ATP-binding protein I; 
                  EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 335

 Score =  112 bits (280), Expect = 4e-27
 Identities = 80/250 (32%), Positives = 126/250 (50%), Gaps = 20/250 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           ++++ ++K++G    V  +SF+V  G  + ++GPNGAGK+T+  +I G+ TP  G I + 
Sbjct: 37  IDLASVTKSYGDKPVVDGLSFTVAAGECFGLLGPNGAGKSTITRMILGMTTPATGVITVL 96

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G  V   A  +LAR G+G   Q   +    T  EN++V G                S R 
Sbjct: 97  GVPVPSRA--RLARMGIGVVPQFDNLDSEFTVRENLLVFGRYFR-----------MSTRE 143

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +AV+      L+ +  LE  +++  S +S G  +RL +ARAL   P++L LDEP  G +
Sbjct: 144 IEAVI----PSLLEFARLENKVDARVSDLSGGMKRRLTLARALINDPQLLILDEPTTGLD 199

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR---DVRD 240
           P     I   +R +   G T++L  H M+    + DR+ VL  GRK+ EG      D + 
Sbjct: 200 PHARHLIWERLRSLLARGKTILLTTHIMEEAERLCDRLCVLEAGRKIAEGRPHVLIDEKI 259

Query: 241 NPEVIAAYLG 250
             +VI  Y G
Sbjct: 260 GCQVIEIYGG 269


>METN_PARUW RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 341

 Score =  112 bits (280), Expect = 4e-27
 Identities = 74/250 (29%), Positives = 122/250 (48%), Gaps = 24/250 (9%)

Query: 3   LLEISDLSKTF------GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPC 56
           L+EI  LSK F          A++++  ++  G +Y +IG +GAGK+TL   I G+  P 
Sbjct: 5   LIEIKKLSKNFLHSSSQHSTYALKDIDLAIPAGCIYGIIGMSGAGKSTLLRCINGLEAPS 64

Query: 57  DGEIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKS 114
            G+I + G+ +    P  L   R+ MG  FQ+ Q+  + T  EN+     +     + + 
Sbjct: 65  KGDILIEGKSLFQKNPAALRAIRQKMGMVFQHFQLFSSRTVAENIAYPMEIGFISQVFQE 124

Query: 115 MLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILF 174
                          E   +L+  VGLE       +++S G  +R+ IARALA  P IL 
Sbjct: 125 ---------------ERINQLLNLVGLEQKKEIYPTSLSGGEKQRVGIARALANHPHILL 169

Query: 175 LDEPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
            DEP +  +PK T  I  L+ ++    G+T++++ H ++ V  I  R+ VL+ G  + EG
Sbjct: 170 CDEPTSALDPKTTRSILQLLAELNQKFGLTIIIITHQLETVKQICHRVAVLSEGEIVEEG 229

Query: 234 SARDVRDNPE 243
             + V   P+
Sbjct: 230 EVKQVFIRPQ 239


>METN_MANSM RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 345

 Score =  112 bits (280), Expect = 4e-27
 Identities = 73/248 (29%), Positives = 133/248 (53%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++ ++SK F      + A+ NVS  + +G +  VIG +GAGK+TL   +  +  P  G
Sbjct: 1   MIKLKNISKIFDVAGKKLNALDNVSLDIPKGDICGVIGASGAGKSTLIRCVNLLERPTSG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  QL   R+ +G  FQ+  +  + T  ENV +   L+L+        
Sbjct: 61  SVFVDGQDLTQLSEAQLIAERRNIGMIFQHFNLLSSRTVYENVALP--LTLEH------- 111

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                  A   + E    L+  VGL    +   + +S G  +R+ IARALA+ P++L  D
Sbjct: 112 ------MAKEKIHEKVTALLALVGLTDKKDVYPANLSGGQKQRVAIARALASDPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L+++I  + GIT++L+ H+M +V NI D++ V++ G+ + +GS 
Sbjct: 166 EATSALDPATTQSILKLLKEINRTLGITILLITHEMDVVKNICDQVAVIDKGQLIEQGSV 225

Query: 236 RDVRDNPE 243
            ++  NP+
Sbjct: 226 SEIFSNPK 233


>METN_LACC3 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 350

 Score =  112 bits (280), Expect = 4e-27
 Identities = 80/251 (31%), Positives = 130/251 (51%), Gaps = 27/251 (10%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++ + D+   F G    V AV +V  +V++G +Y ++G +GAGK+TL   I  +  P  
Sbjct: 5   AVVTLKDVDVEFHGKTRSVHAVDHVDLTVNRGDIYGIVGYSGAGKSTLVRTINLLQRPTG 64

Query: 58  GEIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSM 115
           G + + G+ +  L+P QL   RK +G  FQ+  +  + T  +NV                
Sbjct: 65  GSVNVLGQDMLALSPAQLRKERKRIGMIFQHFNLMNSRTIADNVA--------------- 109

Query: 116 LRFP--SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRIL 173
             FP   L+   A+ ++  AEL+  VGL    NS  + +S G  +R+ IARALA+ P IL
Sbjct: 110 --FPLKGLKSKQAIQKK-VAELLDLVGLTDRANSYPAQLSGGQKQRVGIARALASDPEIL 166

Query: 174 FLDEPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
             DE  +  +PK T+ I  L++ +    G+T+VL+ H M+ V  I +R+ V++ G  +  
Sbjct: 167 ISDEATSALDPKTTSSILELLQSLNQRLGLTIVLITHQMEAVKQICNRVAVMDDGAIIEC 226

Query: 233 GSARDVRDNPE 243
           G    V  NP+
Sbjct: 227 GDLLQVFSNPQ 237


>METN1_STAAC RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  112 bits (280), Expect = 4e-27
 Identities = 66/252 (26%), Positives = 136/252 (53%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   +SKTF      + A+++VSF+V++  ++ VIG +GAGK+TL  L+  +    +G
Sbjct: 1   MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++  +   +   +K +G  FQ+  +  + T  +NV +   LS          
Sbjct: 61  QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                +++   +++   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 111 -----KKSKTEIKQRVTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  TA I  L++ +  + GIT++++ H+M+++ +I +R+ V+  G+ +  G+ 
Sbjct: 166 EATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGKVVETGTV 225

Query: 236 RDVRDNPEVIAA 247
           ++V  +P+   A
Sbjct: 226 KEVFSHPKTTIA 237


>METN1_STAA8 RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  112 bits (280), Expect = 4e-27
 Identities = 66/252 (26%), Positives = 136/252 (53%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   +SKTF      + A+++VSF+V++  ++ VIG +GAGK+TL  L+  +    +G
Sbjct: 1   MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++  +   +   +K +G  FQ+  +  + T  +NV +   LS          
Sbjct: 61  QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                +++   +++   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 111 -----KKSKTEIKQRVTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  TA I  L++ +  + GIT++++ H+M+++ +I +R+ V+  G+ +  G+ 
Sbjct: 166 EATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGKVVETGTV 225

Query: 236 RDVRDNPEVIAA 247
           ++V  +P+   A
Sbjct: 226 KEVFSHPKTTIA 237


>METN1_STAA3 RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  112 bits (280), Expect = 4e-27
 Identities = 66/252 (26%), Positives = 136/252 (53%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   +SKTF      + A+++VSF+V++  ++ VIG +GAGK+TL  L+  +    +G
Sbjct: 1   MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++  +   +   +K +G  FQ+  +  + T  +NV +   LS          
Sbjct: 61  QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                +++   +++   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 111 -----KKSKTEIKQRVTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  TA I  L++ +  + GIT++++ H+M+++ +I +R+ V+  G+ +  G+ 
Sbjct: 166 EATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGKVVETGTV 225

Query: 236 RDVRDNPEVIAA 247
           ++V  +P+   A
Sbjct: 226 KEVFSHPKTTIA 237


>METN1_PSE14 RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 335

 Score =  112 bits (280), Expect = 4e-27
 Identities = 77/248 (31%), Positives = 133/248 (53%), Gaps = 21/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E  ++ KT+      + A+   S  VD G V+ +IG +GAGK+TL  LI  + TP  G
Sbjct: 1   MIEFHNVHKTYRVAGKEIPALHPTSLRVDGGQVFGIIGHSGAGKSTLLRLINRLETPSGG 60

Query: 59  EIRLGGELVSGLAPHQLAR--KGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           +I + GE V+ L  + L R  + +G  FQ+  +  + T  +NV +   L+ D        
Sbjct: 61  QIVVDGEDVTALDANGLRRFRQQVGMIFQHFNLLASKTVADNVAMPLTLAGDM------- 113

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
              S ++ D    +  AEL+  VGL  +     + +S G  +R+ IARALA KP+IL  D
Sbjct: 114 ---SRKQID----QRVAELLKRVGLSDHAKKYPAQLSGGQKQRVGIARALATKPKILLCD 166

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA +  L+ +I  +  +T+VL+ H+M ++  + D++ V++ G  + +G  
Sbjct: 167 EATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDAGVIVEQGKV 226

Query: 236 RDVRDNPE 243
            DV  +P+
Sbjct: 227 ADVFLHPQ 234


>METN1_LISMO RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 338

 Score =  112 bits (280), Expect = 4e-27
 Identities = 75/243 (30%), Positives = 131/243 (53%), Gaps = 22/243 (9%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+  +SK+F      V AV+NVS +V++G ++ V+G +GAGK+TL   I  +  P  G
Sbjct: 1   MIELHQVSKSFNVNGKTVEAVKNVSITVEKGEIFGVVGYSGAGKSTLVRCINLLERPDAG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G+ +S L+  +L  AR+ +G  FQ   +    T  +N             +   L
Sbjct: 61  QVVIDGKNLSTLSSKELRVARRKIGMIFQGYNLLKTATVYDN-------------IAKPL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           +   + + +   R +  + +  VGLE   N+  S +S G  +R+ IARALA +P IL  D
Sbjct: 108 KLEGVPKNEIETRVN--KYLSIVGLEDKRNNYPSQLSGGQKQRVAIARALAHEPEILLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+ KI A+ GIT+ L+ H++ ++  I DR+ V+  G  + +G+ 
Sbjct: 166 EATSALDPETTEAILQLLLKINAELGITIFLITHELDVIQRICDRVAVMENGHLVEQGTV 225

Query: 236 RDV 238
            D+
Sbjct: 226 LDI 228


>METN1_LISMF RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 338

 Score =  112 bits (280), Expect = 4e-27
 Identities = 75/243 (30%), Positives = 131/243 (53%), Gaps = 22/243 (9%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+  +SK+F      V AV+NVS +V++G ++ V+G +GAGK+TL   I  +  P  G
Sbjct: 1   MIELHQVSKSFNVNGKTVEAVKNVSITVEKGEIFGVVGYSGAGKSTLVRCINLLERPDAG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G+ +S L+  +L  AR+ +G  FQ   +    T  +N             +   L
Sbjct: 61  QVVIDGKNLSTLSSKELRVARRKIGMIFQGYNLLKTATVYDN-------------IAKPL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           +   + + +   R +  + +  VGLE   N+  S +S G  +R+ IARALA +P IL  D
Sbjct: 108 KLEGVPKDEIETRVN--KYLSIVGLEDKRNNYPSQLSGGQKQRVAIARALAHEPEILLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+ KI A+ GIT+ L+ H++ ++  I DR+ V+  G  + +G+ 
Sbjct: 166 EATSALDPETTEAILQLLLKINAELGITIFLITHELDVIQRICDRVAVMENGHLVEQGTV 225

Query: 236 RDV 238
            D+
Sbjct: 226 LDI 228


>ALSA_ECOLI RecName: Full=D-allose import ATP-binding protein alsA; 
                  EC=3.6.3.17;
          Length = 510

 Score =  112 bits (280), Expect = 4e-27
 Identities = 65/247 (26%), Positives = 130/247 (52%), Gaps = 9/247 (3%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + ++ + K+FG V A+++V+ +V  G +++++G NGAGK+TL  +++GI+ P  G I + 
Sbjct: 6   ISMAGIGKSFGPVHALKSVNLTVYPGEIHALLGENGAGKSTLMKVLSGIHEPTKGTITIN 65

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
               + L     A+ G+G  +Q L +   +T +EN+ +G HL+      K +     +  
Sbjct: 66  NISYNKLDHKLAAQLGIGIIYQELSVIDELTVLENLYIGRHLT------KKICGVNIIDW 119

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +  +R  AA +++ VGL+  L+ + + +S    + LEIA+ L    +++ +DEP +   
Sbjct: 120 RE--MRVRAAMMLLRVGLKVDLDEKVANLSISHKQMLEIAKTLMLDAKVIIMDEPTSSLT 177

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            KE   +  ++ ++   G  +V + H +  +  I DR  V+  G  +  G   DV  N +
Sbjct: 178 NKEVDYLFLIMNQLRKEGTAIVYISHKLAEIRRICDRYTVMKDGSSVCSGIVSDV-SNDD 236

Query: 244 VIAAYLG 250
           ++   +G
Sbjct: 237 IVRLMVG 243



 Score = 86.7 bits (213), Expect = 2e-19
 Identities = 65/238 (27%), Positives = 113/238 (47%), Gaps = 22/238 (9%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V+++SFSV +G +    G  G+G+T L N + G+     GEIRL G+ +S  +P    +K
Sbjct: 279 VRDISFSVCRGEILGFAGLVGSGRTELMNCLFGVDKRAGGEIRLNGKDISPRSPLDAVKK 338

Query: 79  GMGRT---------FQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLR 129
           GM            F N  I  NM    ++  GG+    +  +         R A     
Sbjct: 339 GMAYITESRRDNGFFPNFSIAQNMAISRSLKDGGY----KGAMGLFHEVDEQRTA----- 389

Query: 130 EHAAELMVYVGLEAY-LNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
           E+  EL+    L+ + +N   + +S G  +++ I++ L   P ++  DEP  G +    A
Sbjct: 390 ENQRELLA---LKCHSVNQNITELSGGNQQKVLISKWLCCCPEVIIFDEPTRGIDVGAKA 446

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIA 246
           EI  ++R++AD G  +++V  ++  ++ + DRI V   GR     + RD     E++A
Sbjct: 447 EIYKVMRQLADDGKVILMVSSELPEIITVCDRIAVFCEGRLTQILTNRDDMSEEEIMA 504


>Y4347_VIBVY RecName: Full=Putative ABC transporter ATP-binding
           protein VVA0347;         EC=3.6.3.-;
          Length = 574

 Score =  112 bits (279), Expect = 5e-27
 Identities = 75/247 (30%), Positives = 129/247 (52%), Gaps = 21/247 (8%)

Query: 3   LLEISDLSKTFGGVL-AVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           LL++ +L+ ++ G   A++ VSF+V +G   S++G NG+GK+T+  LI G+  P DG + 
Sbjct: 298 LLDVRNLTYSYDGEKNALEGVSFNVQRGEFVSILGKNGSGKSTITKLIMGVIEPDDGTMH 357

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           L G+ +S L   + ++K +G   QN           N M+  H+  D       + F   
Sbjct: 358 LNGQDLSELTIFERSQK-VGVVMQN----------PNHMISHHMIFDE------VAFGLR 400

Query: 122 RRA--DAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
            R   +  + +   E +   GL  Y +    A+SYG  KR+ IA  LA +P +L LDEP 
Sbjct: 401 NRGWDEQQVNDKVLEALELCGLSKYRHWPIEALSYGQKKRVTIASILALEPELLMLDEPT 460

Query: 180 AGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           AG + +    + + + K+  + GITVV++ HDM +V+  + R +V+   + + +    DV
Sbjct: 461 AGQDYRNYTSMLSFIEKLNRELGITVVIISHDMHLVLEYTTRSIVIADSQLVADAPMTDV 520

Query: 239 RDNPEVI 245
             NP ++
Sbjct: 521 FSNPALL 527



 Score = 60.1 bits (144), Expect = 2e-11
 Identities = 60/241 (24%), Positives = 114/241 (47%), Gaps = 31/241 (12%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITG-----IYTPCDGEIRLGGELVSGLAPH 73
           ++N++  +++G    +IGP+G+GK+TL   + G     I     G + + G+  +  A H
Sbjct: 20  LRNINLRIEKGEKIVIIGPSGSGKSTLGQCLNGLIPHAIKGEVSGSLTINGQETATFAMH 79

Query: 74  QLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLD-RNLVKSMLRFPSLRRADAVLREHA 132
           Q   + +G   Q+       +    + +G  ++    N + + +   SL +A A +    
Sbjct: 80  QFTEQ-VGTVLQDTD-----SQFVGLSIGEDIAFALENQLTANIEMYSLVKATAKM---- 129

Query: 133 AELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNP---KETAE 189
                 V LE  L      +S G  +R+ +A            DEP A  +P   K T E
Sbjct: 130 ------VDLEQMLQRSPHDLSGGQKQRVSLAGXXXXXXXXXXFDEPLAALDPKTGKRTIE 183

Query: 190 -IDNLVRKIADSGITVVLVEHDMKMVMNIS-DRILVLNYGRKLTEGSARDVRDNPEVIAA 247
            ID+L RK   +G TVV++EH ++ V++   DRI++++ G  + + +  ++  +P ++A 
Sbjct: 184 IIDDLHRK---TGKTVVIIEHRLEDVLHRHVDRIILMDGGEIIADTTPDELLASP-LLAQ 239

Query: 248 Y 248
           Y
Sbjct: 240 Y 240


>RGMG_GEOKA RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein;       
           EC=3.6.3.17;
          Length = 503

 Score =  112 bits (279), Expect = 5e-27
 Identities = 73/253 (28%), Positives = 130/253 (51%), Gaps = 21/253 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+ D++K F GV A+  V   V +G V++++G NGAGK+TL  ++ GIYTP  G+I L
Sbjct: 6   VLEMIDITKEFPGVKALDGVQLKVKRGTVHALMGENGAGKSTLMKILIGIYTPDRGKIIL 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE +          +G+    Q L    NMT  EN+ +G              R PS  
Sbjct: 66  DGEELKVSTIKHALDRGISMIHQELSPVPNMTVAENIFLG--------------REPSYP 111

Query: 123 RADAV----LREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
            A  V    L +   +L   + ++   N++ + +S   ++ +EIA+A++   +++ +DEP
Sbjct: 112 FAGWVKMKELVKKTRQLFERLEIDIDPNAKMADLSIANMQMVEIAKAISYHSKLIIMDEP 171

Query: 179 AAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKL-TEGSARD 237
            +    KE   +  ++R +   G++++ + H M  +  I+D + VL  G+ + T+ S + 
Sbjct: 172 TSAITEKEVHHLFRIIRSLKKEGVSIIYITHKMDELEQITDEVTVLRDGKYIGTKPSHQM 231

Query: 238 VRDNPEVIAAYLG 250
            RD  E+I   +G
Sbjct: 232 TRD--ELIQMMVG 242



 Score = 75.9 bits (185), Expect = 4e-16
 Identities = 58/219 (26%), Positives = 106/219 (48%), Gaps = 20/219 (9%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM 80
           +VSF V +G +    G  G+G+T +   + G+  P  G+I + G+  +  +     R GM
Sbjct: 274 DVSFEVRKGEIVGFAGLMGSGRTEVLESVFGVTKPDAGDIYVHGKKATIRSTRDAIRYGM 333

Query: 81  GRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR------FPSLRRADAVLREHAAE 134
           G   ++ ++               LS++ N++   +       F   R+    +RE    
Sbjct: 334 GLLTEDRKLTGLFLP---------LSVEDNMITVTVNQYTKAGFLQQRK----IREDCQR 380

Query: 135 LMVYVGLEA-YLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           L   + ++   L      +S G  ++  IAR L   P ILFLDEP  G +    AEI +L
Sbjct: 381 LAEQLSIKTPSLQQLIKYLSGGNQQKALIARWLLHNPDILFLDEPTRGIDVGAKAEIYHL 440

Query: 194 VRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
           + ++A +G  +++V  +M  ++ +SDR++V++ GRK+ E
Sbjct: 441 IFELAKNGKAIIVVSSEMPEILGLSDRVIVMHEGRKMGE 479


>RBSA_OCEIH RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 496

 Score =  112 bits (279), Expect = 5e-27
 Identities = 63/245 (25%), Positives = 123/245 (50%), Gaps = 12/245 (4%)

Query: 6   ISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGE 65
           + ++ K+FG    ++ V FS++ G +++++G NGAGK+TL N++TG++    G I + G 
Sbjct: 5   MENIHKSFGSNNVLEGVDFSLEPGEIHALMGENGAGKSTLMNILTGLFPSNQGSITIDGV 64

Query: 66  LVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRAD 125
                   +  + G+    Q L I   MT +EN+ +G  ++     ++           +
Sbjct: 65  KTQYKDSKESEQAGIAFIRQELNILPQMTVLENLFIGKEMTNSFGFLR-----------E 113

Query: 126 AVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPK 185
            V++E A E+   +      + EA   S G  + +EIA+AL    +I+ +DEP A    +
Sbjct: 114 KVMKEKAEEVFSRLDFSIPFDKEAGECSVGEQQLIEIAKALMLDAKIIIMDEPTAALTDR 173

Query: 186 ETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVI 245
           E  ++  +++++   G+ +V + H M+ +  I DRI V+  G  +     +D   N E++
Sbjct: 174 EIDKLFEIMKELTQQGVALVYISHRMEEIFAICDRITVMRDGISVKTSWIKDTNYN-EIV 232

Query: 246 AAYLG 250
              +G
Sbjct: 233 KQMVG 237



 Score = 71.6 bits (174), Expect = 7e-15
 Identities = 53/213 (24%), Positives = 101/213 (47%), Gaps = 18/213 (8%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM 80
           ++ FSV +G +  V G  GAG+T +   I GI     GEI L G+ ++   P    + G+
Sbjct: 269 DIKFSVREGEILGVSGLMGAGRTEIMRAIFGIDEVDQGEILLDGKKLTIKDPTDAMKAGL 328

Query: 81  GRTFQNLQ---ICMNMTAIENVMVGGHLSL-DRNLVKSMLR--FPSLRRADAVLREHAAE 134
               +N +   + ++ +  EN+ +    S  ++  +K      F  L      ++    E
Sbjct: 329 AFITENRKDEGLVLDFSIRENIGLSNLNSFSNKGFIKGKDEKDFVELMIKRLQIKTQTQE 388

Query: 135 LMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           L V              +S G  +++ IA+ +   PR+L +DEP  G +     EI  L+
Sbjct: 389 LPV------------GNLSGGNQQKVVIAKWVGTSPRVLIMDEPTRGIDVGAKREIYQLM 436

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            ++ + G+ ++++  D+  V+ +SDRI+V++ G
Sbjct: 437 NELTERGLAIIMISSDLPEVLGMSDRIMVIHEG 469


>POTA_THEMA RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 368

 Score =  112 bits (279), Expect = 5e-27
 Identities = 70/243 (28%), Positives = 125/243 (51%), Gaps = 25/243 (10%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + I ++SK F     ++NVS  + +G  +S++GP+G GKTTL  +I G      G++ L 
Sbjct: 6   VSIKNVSKFFDDFQVLKNVSLDIKKGEFFSILGPSGCGKTTLLRVIAGFEGVESGDVLLD 65

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+ +  L P+   ++ +   FQN  +  ++T  EN+     L                + 
Sbjct: 66  GKSILNLPPN---KRPVNIIFQNYALFPHLTVFENIAFPLKLK---------------KL 107

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           ++  + +   EL+  + +E +     S +S G  +R+ IARALA +PR+L LDEP +  +
Sbjct: 108 SENEINQRVNELLSLIRMEEHAQKMPSQLSGGQKQRVAIARALANEPRVLLLDEPLSALD 167

Query: 184 PK----ETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
            K       E+DNL  ++   GIT + V HD    +++SDR+ ++N G  +  G+  +V 
Sbjct: 168 AKLRQELLVELDNLHDRV---GITFIYVTHDQAEAISVSDRVALMNEGEIVQVGTPYEVY 224

Query: 240 DNP 242
           ++P
Sbjct: 225 ESP 227


>PHNC2_HALMA RecName: Full=Phosphonates import ATP-binding protein
           phnC 2;         EC=3.6.3.28;
          Length = 271

 Score =  112 bits (279), Expect = 5e-27
 Identities = 77/242 (31%), Positives = 128/242 (52%), Gaps = 15/242 (6%)

Query: 3   LLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L + +L KT+  G  A++ VSF V    + ++IGP+GAGK+TL   I  +  P  G I 
Sbjct: 1   MLTVDNLEKTYDSGDRALKGVSFEVSGNEIVAIIGPSGAGKSTLVRSINRLTEPTGGRIS 60

Query: 62  LGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVG--GHLSLDRNLVKSMLR 117
           L    V+GL    L   R+ MG  FQ   +   +T +EN++ G  G+LS   N  +    
Sbjct: 61  LDDTEVTGLEKSALRDVRRDMGMIFQEFNLVERLTVMENILSGRLGYLST-WNAFRRNFP 119

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
              +RRA         E++  V LE   N+ A  +S G  +R+ IARA+  +P+IL  DE
Sbjct: 120 PEDIRRA--------REILSRVNLEGVENNRADELSGGQRQRVGIARAVIQRPKILLADE 171

Query: 178 PAAGFNPKETAEIDNLVRKIA-DSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR 236
           P +  +P  + E+ +L+  IA +  I +++  H++ + ++ +DRI+ L+ G  +  G   
Sbjct: 172 PTSALDPDTSREVMSLLTDIAHEDDIPIIINIHEVDLAVDYADRIIGLSDGEIVFNGPPD 231

Query: 237 DV 238
           D+
Sbjct: 232 DL 233


>OPUBA_BACSU RecName: Full=Choline transport ATP-binding protein
           opuBA;
          Length = 381

 Score =  112 bits (279), Expect = 5e-27
 Identities = 76/253 (30%), Positives = 132/253 (52%), Gaps = 21/253 (8%)

Query: 3   LLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L + ++SKT+ GG  AV NV+  + +G     IGP+G GKTT   +I  +  P  G+I 
Sbjct: 1   MLTLENVSKTYKGGKKAVNNVNLKIAKGEFICFIGPSGCGKTTTMKMINRLIEPSAGKIF 60

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + GE +    P +L RK +G   Q + +  +MT  +N+          +LV  +L++P  
Sbjct: 61  IDGENIMDQDPVELRRK-IGYVIQQIGLFPHMTIQQNI----------SLVPKLLKWPEQ 109

Query: 122 RRADAVLREHAAELMVYVGL-EAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           +R     +E A EL+  V +   Y++     +S G  +R+ + RALAA+P ++ +DEP  
Sbjct: 110 QR-----KERARELLKLVDMGPEYVDRYPHELSGGQQQRIGVLRALAAEPPLILMDEPFG 164

Query: 181 GFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             +P     +    +K+  +   T+V V HDM   + ++DRI++L  G  +  G+  D+ 
Sbjct: 165 ALDPITRDSLQEEFKKLQKTLHKTIVFVTHDMDEAIKLADRIVILKAGEIVQVGTPDDIL 224

Query: 240 DNP--EVIAAYLG 250
            NP  E +  ++G
Sbjct: 225 RNPADEFVEEFIG 237


>NODI_RHISN RecName: Full=Nod factor export ATP-binding protein I;  
                 EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 343

 Score =  112 bits (279), Expect = 5e-27
 Identities = 78/250 (31%), Positives = 128/250 (51%), Gaps = 20/250 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E++++SK++G  + V  +SF++  G  + ++GPNGAGK+T+  L+ G+  P +G I + 
Sbjct: 45  IELTNVSKSYGDKVVVDQLSFTITSGECFGLLGPNGAGKSTVSRLVLGLAPPDEGTITVL 104

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE V   A  +LAR  +G   Q   +    TA EN++V G             R+  L  
Sbjct: 105 GEPVPARA--RLARSRIGVVPQFDTLDREFTARENLLVFG-------------RYFGLHT 149

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +  L E    L+ +  LE+  +   + +S G  +RL +A AL   P++L LDEP  G +
Sbjct: 150 RE--LEEAIPPLLDFARLESKADVPVAQLSGGMQRRLTLACALINDPQLLILDEPTTGLD 207

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP- 242
           P     I   +R +   G T++L  H M+    + DR+ V+ +GRK+ EG    + D   
Sbjct: 208 PHARHLIWERLRSLLALGKTILLTTHFMEEADRLCDRLCVIEHGRKIVEGRPHALIDEQI 267

Query: 243 --EVIAAYLG 250
             +VI  Y G
Sbjct: 268 GCDVIEIYGG 277


>NODI_RHILV RecName: Full=Nod factor export ATP-binding protein I;  
                 EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 311

 Score =  112 bits (279), Expect = 5e-27
 Identities = 71/230 (30%), Positives = 119/230 (51%), Gaps = 17/230 (7%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           ++++ +SK++GG + V ++SF++  G  + ++GPNGAGK+T+  +I G+ +P  G+I + 
Sbjct: 13  IDLAGVSKSYGGKIVVNDLSFTIAAGECFGLLGPNGAGKSTITRMILGMTSPSVGKITVL 72

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G    G      A+ G+   F NL +    T  EN++V G                S R 
Sbjct: 73  GAQEPGQVRLARAKIGIVSQFDNLDL--EFTVRENLLVYGRYFR-----------MSTRE 119

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            + V+      L+ +  LE+  N+  + +S G  +RL +A AL   P++L LDEP  G +
Sbjct: 120 IETVI----PSLLEFARLESKANTRVADLSGGMKRRLTLAGALINDPQLLILDEPTTGLD 175

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
           P     I   +R +   G T++L  H M+    + DR+ VL  GRK+ EG
Sbjct: 176 PHARHLIWERLRSLLARGKTILLTTHIMEEAERLCDRLCVLEAGRKIAEG 225


>METN1_STAAW RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  112 bits (279), Expect = 5e-27
 Identities = 66/252 (26%), Positives = 136/252 (53%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   +SKTF      + A+++VSF+V++  ++ VIG +GAGK+TL  L+  +    +G
Sbjct: 1   MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++  +   +   +K +G  FQ+  +  + T  +NV +   LS          
Sbjct: 61  QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                +++   +++   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 111 -----KKSKTEIKQRVTEMLEFVGLSDKKDQFPEELSGGQKQRVAIARALVTNPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  TA I  L++ +  + GIT++++ H+M+++ +I +R+ V+  G+ +  G+ 
Sbjct: 166 EATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGQVVETGTV 225

Query: 236 RDVRDNPEVIAA 247
           ++V  +P+   A
Sbjct: 226 KEVFSHPKTTIA 237


>METN1_STAAS RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  112 bits (279), Expect = 5e-27
 Identities = 66/252 (26%), Positives = 136/252 (53%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   +SKTF      + A+++VSF+V++  ++ VIG +GAGK+TL  L+  +    +G
Sbjct: 1   MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++  +   +   +K +G  FQ+  +  + T  +NV +   LS          
Sbjct: 61  QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                +++   +++   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 111 -----KKSKTEIKQRVTEMLEFVGLSDKKDQFPEELSGGQKQRVAIARALVTNPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  TA I  L++ +  + GIT++++ H+M+++ +I +R+ V+  G+ +  G+ 
Sbjct: 166 EATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGQVVETGTV 225

Query: 236 RDVRDNPEVIAA 247
           ++V  +P+   A
Sbjct: 226 KEVFSHPKTTIA 237


>RBSA2_BURS3 RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 506

 Score =  111 bits (278), Expect = 6e-27
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L +S ++K+F GV A+ ++   + +G +++++G NGAGK+TL  ++ GI+ P  G I +
Sbjct: 4   ILRLSHITKSFPGVKALADIDLEIARGEIHALLGENGAGKSTLMKILCGIHQPDTGTIEI 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G        H     G+G  FQ   +  ++ A++N+ +G  L   RN      R+ +  
Sbjct: 64  DGTARHFSDYHDAVAAGVGIVFQEFSLIPHLDAVDNLFLGREL---RN------RWGARD 114

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R    +R  AA +   +G+   L++   A+S    + +EI +AL+   RIL LDEP A  
Sbjct: 115 RKR--MRHAAAAIFARLGVAIDLDAPIRALSVAQQQFVEIGKALSLDARILILDEPTATL 172

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            P E   +  ++R++   G+ ++ + H +  +  + DRI VL  G+
Sbjct: 173 TPAEAEHLFAIMRELKRQGVAMIFISHHLDEIFAVCDRITVLRDGQ 218



 Score = 62.0 bits (149), Expect = 5e-12
 Identities = 56/247 (22%), Positives = 114/247 (46%), Gaps = 13/247 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+++L    GG +      F++  G +    G  G+G+T     + G       ++R+
Sbjct: 259 VLEVNELQIERGGPVN----RFTLHAGEILGFAGLVGSGRTETALAVIGATRAHRKDVRV 314

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V    P    R G+G   ++ +    +T+     +  ++SL+       +R+   R
Sbjct: 315 RGAAVKLADPADALRAGIGILPESRKTEGLVTSFS---IRDNISLNNLGKYRSMRWLIDR 371

Query: 123 RADAVLREHAAELMVYVGLEA-YLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           R +A       ++M  VG++A  +++E + +S G  +++ IAR L     +L  DEP  G
Sbjct: 372 RGEA---RTTHDVMRRVGVKAPSIHTEVATLSGGNQQKVVIARWLNHHTSVLIFDEPTRG 428

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
            +    AEI  L+R++   G  ++++  ++  ++ + DR+ V   GR   E +      +
Sbjct: 429 IDVGAKAEIYGLMRELTARGYAIIMISSELPEIVGMCDRVAVFRQGR--IEATLEGDEID 486

Query: 242 PEVIAAY 248
           P+ +  Y
Sbjct: 487 PDTVMTY 493


>POTA_LACDA RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 362

 Score =  111 bits (278), Expect = 6e-27
 Identities = 70/254 (27%), Positives = 131/254 (51%), Gaps = 22/254 (8%)

Query: 1   MALLEISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           M ++++  ++K +  G +A+++++  ++ G  YS++GP+G+GKTT+  +I G      G+
Sbjct: 1   MEIIKLDHITKQYDDGFVALKDINLELESGKFYSLLGPSGSGKTTILRIIAGFTEASAGK 60

Query: 60  IRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           +   G+ ++ L     +++ +   FQN  +  ++   ENV     L              
Sbjct: 61  VYFDGQDITNL---DASKRHINTVFQNYALFPHLNVYENVAFALKLR------------- 104

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
             +R ++ +RE   + +  V L+ Y N E S +S G  +R+ IARA+  +P++L LDE  
Sbjct: 105 --QRPESEIREKVKDALHTVRLDGYANREISELSGGQQQRVAIARAIINEPKVLLLDECL 162

Query: 180 AGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +  + +   E+   +R I    GIT + V HD +  + +SD I VLN G     GS  D+
Sbjct: 163 SALDKRLRKEMQFELRAIQKKLGITFIFVTHDQEEALAMSDEIFVLNDGEIKQSGSPVDI 222

Query: 239 RDNP--EVIAAYLG 250
            D P  + +A ++G
Sbjct: 223 YDEPVNDFVARFIG 236


>METN1_PSEU2 RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 335

 Score =  111 bits (278), Expect = 6e-27
 Identities = 75/248 (30%), Positives = 132/248 (53%), Gaps = 21/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E  ++ KT+      + A+   S  VD G V+ +IG +GAGK+TL  LI  + TP  G
Sbjct: 1   MIEFHNVHKTYRVAGKEIPALHPTSLRVDSGQVFGIIGHSGAGKSTLLRLINRLETPSGG 60

Query: 59  EIRLGGELVSGLAPHQLAR--KGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           +I + GE V+ L  + L R  + +G  FQ+  +  + T  +NV +   L+L  ++ +  +
Sbjct: 61  QIVVDGEDVTALDANGLRRFRQQVGMIFQHFNLLASRTVADNVAMP--LTLAGDMPRKQI 118

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                        +  AEL+  VGL  +     + +S G  +R+ IARALA KP+IL  D
Sbjct: 119 D------------QRVAELLERVGLSDHAKKYPAQLSGGQKQRVGIARALATKPKILLCD 166

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA +  L+ +I  +  +T+VL+ H+M ++  + D++ V++ G  +  G  
Sbjct: 167 EATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDAGVIVEHGKV 226

Query: 236 RDVRDNPE 243
            DV  +P+
Sbjct: 227 ADVFLHPQ 234


>METN1_PSEAB RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 369

 Score =  111 bits (278), Expect = 6e-27
 Identities = 73/243 (30%), Positives = 128/243 (52%), Gaps = 19/243 (7%)

Query: 4   LEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           + +  L K + GGV A++ +   + +G V+ +IG +GAGK++L   +  +  P +G++ +
Sbjct: 29  IRLHGLGKRYPGGVQALREIDLEIRRGEVFGIIGRSGAGKSSLIRTLNRLERPSEGQVLI 88

Query: 63  GGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            GE + G    +L   R+ +G  FQ+  +    T  +N+ +              LR   
Sbjct: 89  DGEDIGGYDGQRLVALRRRIGMIFQHFNLMSAKTVRQNIAL-------------PLRVAG 135

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + RA   + E  A L+  VGLE   ++  + +S G  +R+ IARAL  +P+IL  DE  +
Sbjct: 136 VPRAR--IEERVAGLLQLVGLEEKRDAYPAQLSGGQKQRVGIARALVHQPQILLCDEATS 193

Query: 181 GFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             +P+ T  I  L+R I    G+T+VL+ H+M ++  I DR++VL  GR + +G   +V 
Sbjct: 194 ALDPESTQAILALLRDINRRLGLTIVLITHEMAVIREICDRVVVLECGRIVEQGEVWEVF 253

Query: 240 DNP 242
            +P
Sbjct: 254 GDP 256


>METN1_BACC1 RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 346

 Score =  111 bits (278), Expect = 6e-27
 Identities = 70/248 (28%), Positives = 132/248 (53%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ ++SK F    G V A+++ S  V +G V+ +IG +GAGK+TL   +  +  P  G
Sbjct: 1   MIELKNVSKVFTTKKGNVEALKSTSLQVKKGEVFGIIGYSGAGKSTLIRCVNLLEKPTTG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I +  + ++ L+  +LA  R+ +G  FQ   +   +T  EN+ +              L
Sbjct: 61  NIIVNSQDLTTLSAKELAKARQKIGMIFQGFNLLKTVTVYENIALP-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           R   + + +  + +   + +  V L    ++  S +S G  +R+ IARAL+ +P +L  D
Sbjct: 108 RLAGISKVE--IEKRVEKYLRIVDLFTRKDAYPSELSGGQKQRVAIARALSHEPEVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+ KI +  GIT++L+ H+M ++  I DR+ V+ +G  +  G+ 
Sbjct: 166 EATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVVESGTV 225

Query: 236 RDVRDNPE 243
           +D+  NP+
Sbjct: 226 KDIFTNPQ 233


>RGMG1_AGRT5 RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 1;       
           EC=3.6.3.17;
          Length = 505

 Score =  111 bits (277), Expect = 8e-27
 Identities = 66/229 (28%), Positives = 116/229 (50%), Gaps = 12/229 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL + ++SK F GV A+ NV F +  G V++V G NGAGK+TL  +I+G+Y P +G I  
Sbjct: 9   LLRLENISKEFPGVKALSNVHFDLRSGEVHAVCGENGAGKSTLMKIISGVYQPSEGTILH 68

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V   +P Q    G+    Q L +  +++  EN+ +         + +  LR  + R
Sbjct: 69  KGEKVQYASPLQSEAAGIAIIHQELNLVPHLSVAENIYLAREPRRGFLVDRKKLRLDAKR 128

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             D             +G++   +    ++S    + +EIA+AL+    +L +DEP +  
Sbjct: 129 CLDR------------LGVDINPDQLVRSLSVAQCQMVEIAKALSLDAEVLIMDEPTSSL 176

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLT 231
             +ET  +  ++R +  SG+ +V + H +  +  I DR+ +L  GR ++
Sbjct: 177 TEQETRLLFKVIRDLKASGVGIVYISHRLDEMAEIVDRVTILRDGRYIS 225



 Score = 62.8 bits (151), Expect = 3e-12
 Identities = 57/233 (24%), Positives = 102/233 (43%), Gaps = 17/233 (7%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM 80
           +VSFS+ +G +    G  GAG+T +   I G      G+I   G  +S  +P     +G+
Sbjct: 276 DVSFSLRRGEILGFAGLMGAGRTEVARAIFGADPLDAGKIVFNGRELSIGSPQDAIEEGI 335

Query: 81  G-----RTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
                 R    L I M++ A   +   G +S    L+         ++ D V + +   L
Sbjct: 336 AYLSEDRKSDGLAIKMSVAANTTLANLGEVSNRFGLI-------DFKKHDDVAKRYVDLL 388

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            +       ++     +S G  +++ I + L  + R+LF DEP  G +      I  ++ 
Sbjct: 389 NIRT---PSIDQTVRLLSGGNQQKIIIGKWLFRQSRVLFFDEPTRGIDVGAKFAIYKIMD 445

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAY 248
           ++A  GI V+L+  ++  ++ ++DRI V + GR    G     + N E I  Y
Sbjct: 446 ELAAQGIGVILISSELPEILGLTDRIAVFHQGR--ITGVLETAKTNQEEIMRY 496


>RBSA_GEOKA RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 494

 Score =  111 bits (277), Expect = 8e-27
 Identities = 64/226 (28%), Positives = 114/226 (50%), Gaps = 10/226 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++++  + K+FG  + +  V F V  G V++++G NGAGK+TL  ++TGIY    G I +
Sbjct: 1   MIDMRSIQKSFGANIVLNGVDFEVLPGEVHALMGENGAGKSTLIKVLTGIYERDGGTIVV 60

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V    P +  R G+    Q L +   +T  EN+ +G    + R     ++R+    
Sbjct: 61  NGREVHYRHPKEAERDGIVVIHQELNVIPTLTVAENIFLGREPKIGRT---GVIRYKE-- 115

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                + + AA  +  +G++      A  +S G  + +EIARA++   + L +DEP A  
Sbjct: 116 -----MEQQAASYLRRLGMDLDPRELAGRLSVGKQQMIEIARAISTNAKCLIMDEPTAAL 170

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
             +E   + +++  +   G+ VV + H M+ +  I DRI VL  G+
Sbjct: 171 TEREIQALFSVIPTLKQQGVAVVYISHRMEEIFTICDRISVLRDGQ 216



 Score = 75.9 bits (185), Expect = 4e-16
 Identities = 60/219 (27%), Positives = 107/219 (48%), Gaps = 26/219 (11%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           +NVSFSV  G V  V G  G+G+T +   I G     +G+I + G  V   +P Q    G
Sbjct: 268 ENVSFSVRAGEVLGVAGLMGSGRTEIMEAIFGARPFDEGDIYIDGRPVRIRSPRQAVEHG 327

Query: 80  MGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELM 136
           +    ++ +   + + M+  EN+ +     L++      ++  S +  D VL        
Sbjct: 328 IAMITEDRKQKGLILEMSVHENLTLP---KLEQLATAGFIQ--SSKERDVVL-------- 374

Query: 137 VYVGLEAYLNSEAS-------AMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
            Y+ L   LN +AS       A+S G  +++   + LA  PRIL LDEP  G +     E
Sbjct: 375 TYIHL---LNIKASSPDLPVKALSGGNQQKVVFGKWLAMNPRILILDEPTRGVDVGAKKE 431

Query: 190 IDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           I  ++ ++A  G  ++++  ++  V+ +SDR++V++ G+
Sbjct: 432 IYEVINELAAQGAAIIMISSELPEVLGMSDRVMVVHEGK 470


>RBSA_CLOPS RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 501

 Score =  111 bits (277), Expect = 8e-27
 Identities = 69/250 (27%), Positives = 120/250 (48%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L++  +SK+F GV A+ NVS     G V +++G NGAGK+TL  +++G+Y   +G+I +
Sbjct: 7   MLKMVGVSKSFPGVKALDNVSLMAYGGEVTALMGENGAGKSTLMKILSGVYKKDEGKIFI 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGG--HLSLDRNLVKSMLRFPS 120
            G  V           G+    Q L +  N+T  EN+ +G   H      + K +     
Sbjct: 67  EGREVEVKGIKSAEEAGITIIHQELSVLNNLTVSENIFLGNEKHSKFTGRINKKL----- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                  L E +   +  +G +   N   S ++ G  + +EIA+AL    RI+ +DEP  
Sbjct: 122 -------LDERSKMFLEQIGCDIDPNRLVSTLNVGEKQMIEIAKALTKNARIIIMDEPTT 174

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
                ET  +  ++  +   GI ++ + H M+ +  I  R+ VL  G+       +D+ D
Sbjct: 175 ALTDVETENLFKVIENLRKKGIAIIYISHRMEEIFKICHRVEVLRDGKYTGSAEIKDI-D 233

Query: 241 NPEVIAAYLG 250
           N ++IA  +G
Sbjct: 234 NDKLIAMMVG 243



 Score = 77.0 bits (188), Expect = 2e-16
 Identities = 63/233 (27%), Positives = 113/233 (48%), Gaps = 25/233 (10%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           LE+ +LS   G    V+  SF++ +G +  + G  G+G+T L   I G Y    GEI L 
Sbjct: 262 LEVKNLSCKEG----VKGASFTLRKGEILGIAGLMGSGRTELAKTIFGEYKKTSGEISLN 317

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G L++          G+    ++ +       I  + VG +++L  NL K   +F SL +
Sbjct: 318 GSLININCISDAINNGICYLSEDRK---KEGCILGMSVGENMTLC-NLKKYENKFKSLDK 373

Query: 124 ADAVLREHAAELMVYV--------GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                +E A ++  Y+          E ++ +    +S G  +++ +A+ L   P +L +
Sbjct: 374 -----KEEAKDIEYYIKKINIKTPNKEQFIKN----LSGGNQQKVILAKWLMLSPEVLII 424

Query: 176 DEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           DEP  G +     EI  L+ ++  SG  ++++  D+  V+ ISDRI+V++ GR
Sbjct: 425 DEPTRGIDVGAKKEIYELLNELKASGKAIIMISSDLPEVLGISDRIMVMSEGR 477


>RBSA_CLOP1 RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 501

 Score =  111 bits (277), Expect = 8e-27
 Identities = 69/250 (27%), Positives = 120/250 (48%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L++  +SK+F GV A+ NVS     G V +++G NGAGK+TL  +++G+Y   +G+I +
Sbjct: 7   MLKMVGVSKSFPGVKALDNVSLMAYGGEVTALMGENGAGKSTLMKILSGVYKKDEGKIFI 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGG--HLSLDRNLVKSMLRFPS 120
            G  V           G+    Q L +  N+T  EN+ +G   H      + K +     
Sbjct: 67  EGREVEVKGIKSAEEAGITIIHQELSVLNNLTVSENIFLGNEKHSKFTGRINKKL----- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                  L E +   +  +G +   N   S ++ G  + +EIA+AL    RI+ +DEP  
Sbjct: 122 -------LDERSKMFLEQIGCDIDPNRLVSTLNVGEKQMIEIAKALTKNARIIIMDEPTT 174

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
                ET  +  ++  +   GI ++ + H M+ +  I  R+ VL  G+       +D+ D
Sbjct: 175 ALTDVETENLFKVIENLRKKGIAIIYISHRMEEIFKICHRVEVLRDGKYAGSAEIKDI-D 233

Query: 241 NPEVIAAYLG 250
           N ++IA  +G
Sbjct: 234 NDKLIAMMVG 243



 Score = 74.3 bits (181), Expect = 1e-15
 Identities = 62/233 (26%), Positives = 112/233 (48%), Gaps = 25/233 (10%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           LE+ +LS   G    V+  SF++ +G +  + G  G+G+T L   I G Y    GEI L 
Sbjct: 262 LEVKNLSCKEG----VKGASFTLRKGEILGIAGLMGSGRTELAKTIFGEYKKTSGEISLN 317

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G  ++          G+    ++ +       I  + VG +++L  NL K   +F SL +
Sbjct: 318 GSPININCISDAINNGICYLSEDRK---KEGCILGMSVGENMTLC-NLKKYENKFKSLDK 373

Query: 124 ADAVLREHAAELMVYV--------GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                +E A ++  Y+          E ++ +    +S G  +++ +A+ L   P +L +
Sbjct: 374 -----KEEAKDIEYYIKKINIKTPNKEQFIKN----LSGGNQQKVILAKWLMLSPEVLII 424

Query: 176 DEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           DEP  G +     EI  L+ ++  SG  ++++  D+  V+ ISDRI+V++ GR
Sbjct: 425 DEPTRGIDVGAKKEIYELLNELKASGKAIIMISSDLPEVLGISDRIMVMSEGR 477


>POTA_MARAV RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 373

 Score =  111 bits (277), Expect = 8e-27
 Identities = 71/242 (29%), Positives = 122/242 (50%), Gaps = 21/242 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL +S+L+K F G   + ++   +  G   +++GP+G GKTTL  ++ G   P DG I L
Sbjct: 5   LLSLSNLTKQFDGKKVLDSLDLDIFDGEFITLLGPSGCGKTTLLRMMAGFEHPDDGTIAL 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
           G + ++   P     + +   FQN  +  +M+  +NV  G  +                +
Sbjct: 65  GDQDLTHTPPE---HRPLNTVFQNYALFPHMSVFDNVAYGLKME---------------K 106

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP--AA 180
           R    +RE   + +  V LE +   +   +S G  +R+ IARA+  +P++L LDEP  A 
Sbjct: 107 RPKQEIRERVEDALAMVQLEDFARRKPHQLSGGQQQRVAIARAVVKRPKVLLLDEPLSAL 166

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
            +  + T +++ L R   + GIT V V HD +  +++SDR++VL  G     G+ R+V +
Sbjct: 167 DYKLRRTMQVE-LKRLQRELGITFVFVTHDQEEALSMSDRVVVLKDGLIQQLGTPREVYE 225

Query: 241 NP 242
            P
Sbjct: 226 RP 227


>METN_RALEJ RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 344

 Score =  111 bits (277), Expect = 8e-27
 Identities = 80/257 (31%), Positives = 135/257 (52%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+  LS+ F G    V A+++VS S+  G V+ +IG +GAGK+TL   I  +  P  G
Sbjct: 1   MIELQGLSQRFPGGSGEVHALRDVSLSIGAGEVFGIIGRSGAGKSTLVRAINLLNRPTSG 60

Query: 59  EIRLGGELVSGL--APHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG+ ++ L     +LAR+ +G  FQ+  +  + T  +NV +   L+      KS +
Sbjct: 61  RVIVGGQDLTALDNGALRLARRDIGMIFQHFNLLSSRTVFDNVALPLELA---GKTKSEI 117

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                   +A               + Y     S +S G  +R+ IARALA+KP++L  D
Sbjct: 118 --------EATXXXXXXXXXXXXXKDRY----PSQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+++I  + G+T+V++ H M+++  + DR+ VL  GR + EG  
Sbjct: 166 EATSALDPETTRSILDLLKQINRELGLTIVMITHQMEVIKQVCDRVAVLEAGRVVEEGRV 225

Query: 236 RDV--RDNPEVIAAYLG 250
            DV  R   EV  A +G
Sbjct: 226 IDVFLRPQHEVTRAMIG 242


>METN_MYXXD RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 330

 Score =  111 bits (277), Expect = 8e-27
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 20/236 (8%)

Query: 12  TFGG--VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSG 69
           T GG  V A++NVS  V+ G ++ V+G +GAGK+TL      +  P +G + + G+ +  
Sbjct: 12  TAGGREVAALRNVSLRVEAGEIHGVLGQSGAGKSTLIRCANLLERPTEGSVSVDGQDLLA 71

Query: 70  LAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           L+P  L  AR+G+G  FQ+  +  + T   NV     ++             + R A   
Sbjct: 72  LSPEALRKARQGIGMIFQHFNLFGSKTVAANVAYPLEVA------------GTPREA--- 116

Query: 128 LREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKET 187
           +RE   EL+  VGL     +  S +S G  +R+ IARALA +PR+L  DE  +  +P+ T
Sbjct: 117 IRERVEELLSLVGLSDKAQAYPSQLSGGQKQRVGIARALAPRPRVLLSDEATSALDPETT 176

Query: 188 AEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
             +  L+R I    G+T++L+ H M +V  I D + VL  GR + +G   ++  +P
Sbjct: 177 RSVLGLLRDINQKLGVTLLLITHQMDVVKAICDSVSVLERGRLVEQGKVTELLAHP 232


>METN2_PSESM RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 335

 Score =  111 bits (277), Expect = 8e-27
 Identities = 74/248 (29%), Positives = 133/248 (53%), Gaps = 21/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E  ++ KT+      + A+   +  VD G V+ +IG +GAGK+TL  LI  + TP  G
Sbjct: 1   MIEFHNVHKTYRVAGKEIPALHPTNLRVDDGQVFGIIGHSGAGKSTLLRLINRLETPSGG 60

Query: 59  EIRLGGELVSGLAPHQLAR--KGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           +I + GE V+ L  + L R  + +G  FQ+  +  + T  +NV +   L+L  ++ +  +
Sbjct: 61  QIVVDGEDVTALDANGLRRFRQQVGMIFQHFNLLASRTVADNVAMP--LTLAGDMPRKQI 118

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                        +  AEL+  VGL  +     + +S G  +R+ IARALA KP+IL  D
Sbjct: 119 D------------QRVAELLERVGLSDHAKKYPAQLSGGQKQRVGIARALATKPKILLCD 166

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA +  L+ +I  +  +T+VL+ H+M ++  + D++ V++ G  + +G  
Sbjct: 167 EATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDAGVIVEQGKV 226

Query: 236 RDVRDNPE 243
            DV  +P+
Sbjct: 227 ADVFLHPQ 234


>FBPC_ECOLI RecName: Full=Fe(3+) ions import ATP-binding protein
           fbpC;         EC=3.6.3.30;
          Length = 348

 Score =  111 bits (277), Expect = 8e-27
 Identities = 72/252 (28%), Positives = 130/252 (51%), Gaps = 21/252 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ +++K FG    + N++ ++ QG + +++GP+G GKTT+  L+ G+  P +G+I + 
Sbjct: 7   VELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSEGQIFID 66

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE V+             R+ Q   ICM     ++  +  H+SL  N V   L+   + R
Sbjct: 67  GEDVT------------HRSIQQRDICM---VFQSYALFPHMSLGEN-VGYGLKMLGVPR 110

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           A+  L+    E +  V LE + +     +S G  +R+ +ARAL  KP++L  DEP +  +
Sbjct: 111 AE--LKARVKEALAMVDLEGFEDRFVDQISGGQQQRVALARALILKPKVLLFDEPLSNLD 168

Query: 184 PKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
                 + + +R++     IT + V HD      +SD +LV+N G  +  GS +D+   P
Sbjct: 169 ANLRRSMRDKIRELQKQFDITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQDLYRQP 228

Query: 243 --EVIAAYLGTA 252
               +A+++G A
Sbjct: 229 ASRFMASFMGDA 240


>FBPC_ECO57 RecName: Full=Fe(3+) ions import ATP-binding protein
           fbpC;         EC=3.6.3.30;
          Length = 348

 Score =  111 bits (277), Expect = 8e-27
 Identities = 70/252 (27%), Positives = 131/252 (51%), Gaps = 21/252 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ +++K FG    + N++ ++ QG + +++GP+G GKTT+  L+ G+  P +G+I + 
Sbjct: 7   VELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSEGQIFID 66

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE V+             R+ Q   ICM     ++  +  H+SL  N V   L+   + R
Sbjct: 67  GEDVT------------HRSIQQRDICM---VFQSYALFPHMSLGEN-VGYGLKMLGVSR 110

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           ++  +++   E +  V LE + +     +S G  +R+ +ARAL  KP++L  DEP +  +
Sbjct: 111 SE--VKQRVKEALAMVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEPLSNLD 168

Query: 184 PKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
                 + + +R++     IT + V HD      +SD +LV+N G  +  GS +D+   P
Sbjct: 169 ANLRRSMRDKIRELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQDLYRQP 228

Query: 243 --EVIAAYLGTA 252
               +A+++G A
Sbjct: 229 ASRFMASFMGDA 240


>XYLG_ERWCT RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 513

 Score =  110 bits (276), Expect = 1e-26
 Identities = 74/250 (29%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           LLE+ +++K FG V AV NVS +++ G V S+ G NG+GK+TL  ++  IY     DG+I
Sbjct: 4   LLEMKNITKAFGAVKAVDNVSLTLEAGQVLSLCGENGSGKSTLMKVLCAIYPHGSYDGQI 63

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
              G+ +         +KG+    Q L +   MT +EN+ +G   +          RF  
Sbjct: 64  IFSGDELRANHIRDTEQKGIAIIHQELALVKEMTVLENMFLGNEWT----------RFGV 113

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           +   +  LR     ++  V L    N++   +  G  + +EIA+AL  + R+L LDEP A
Sbjct: 114 MDYDNMYLR--CQRMLEQVKLAVDPNTKVGELGLGQQQLVEIAKALNKQVRLLVLDEPTA 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
               +ET  +  +++ + D GI  + + H +  V  ISD I V+  G+ +    A ++ +
Sbjct: 172 SLTERETGILLEIIQDLRDHGIACIYISHKLNEVKAISDVICVIRDGKHIGTRPAAELSE 231

Query: 241 NPEVIAAYLG 250
           +  +IA  +G
Sbjct: 232 D-HIIAMMVG 240



 Score = 65.9 bits (159), Expect = 4e-13
 Identities = 59/239 (24%), Positives = 104/239 (43%), Gaps = 24/239 (10%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTP-CDGEIRLGGELVSGLAPHQLAR 77
           V +VSF++ +G +  + G  G+G+T     + G Y     G+I + G+ V+     Q   
Sbjct: 277 VDDVSFALHRGEILGIAGLVGSGRTETVQCLFGAYRGRWQGDIFIDGKPVTISNCQQAMA 336

Query: 78  KGMGRTFQN---------LQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
           +G+    ++         + +  NMT        G LS+              R  D ++
Sbjct: 337 QGIAMVPEDRKKDGIVPVMGVAQNMTLAALDQFTGPLSM----------LDDAREQD-II 385

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
           R+  A L V            + +S G  ++  +A+ L   PRIL LDEP  G +     
Sbjct: 386 RQSLANLKVKTSSPELA---IARLSGGNQQKAVLAKCLLLNPRILILDEPTRGIDIGAKY 442

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAA 247
           EI  L+  +    I V+++  ++  V+ +SDR+LV++ GR   +   RD+     + AA
Sbjct: 443 EIYKLINALVKQHIAVIVISSELPEVLGLSDRVLVMHQGRIKADLINRDLTQEQVMEAA 501


>UGPC2_RHIEC RecName: Full=sn-glycerol-3-phosphate import
           ATP-binding protein ugpC 2;         EC=3.6.3.20;
          Length = 369

 Score =  110 bits (276), Expect = 1e-26
 Identities = 75/263 (28%), Positives = 126/263 (47%), Gaps = 35/263 (13%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           MA + I D+ K++G    V  V   +  G    ++GP+G GK+TL  +I G+     GEI
Sbjct: 1   MAPISIRDVKKSYGKHPVVHGVDLEIQSGEFIVILGPSGCGKSTLLRMIAGLEEITGGEI 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENV----MVGGHLSLDRNLVKSML 116
            + G +V+ + P +   +G    FQN  +  +MT  EN+     V G    +R+      
Sbjct: 61  AIDGRVVNQMEPRE---RGCAMVFQNYALYPHMTVAENIGYALKVAGVAKTERS------ 111

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                           AE+   + LE +L+   +A+S G  +R+ + RA+  +P++   D
Sbjct: 112 -------------RRIAEVAKALSLEPFLDRRPAALSGGQRQRVAMGRAMIREPKVFLFD 158

Query: 177 EPAAGFNPK----ETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
           EP +  + K      AEI  L R++   G T + V HD    M ++DR++V+N GR    
Sbjct: 159 EPLSNLDAKLRIAMRAEIRRLHRRL---GATSIFVTHDQTEAMTLADRLVVMNGGRVEQV 215

Query: 233 GSARDVRDNP--EVIAAYLGTAA 253
           G+  +V  +P    +A ++GT A
Sbjct: 216 GTPEEVYHHPVSRFVAGFVGTPA 238


>RBSA_CLOPE RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 501

 Score =  110 bits (276), Expect = 1e-26
 Identities = 69/250 (27%), Positives = 120/250 (48%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L++  +SK+F GV A+ NVS     G V +++G NGAGK+TL  +++G+Y   +G+I +
Sbjct: 7   MLKMVGVSKSFPGVKALDNVSLMAYGGEVTALMGENGAGKSTLMKILSGVYKKDEGKIFI 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGG--HLSLDRNLVKSMLRFPS 120
            G  V           G+    Q L +  N+T  EN+ +G   H      + K +     
Sbjct: 67  EGREVEVKGIKSAEEAGITIIHQELSVLNNLTISENIFLGNEKHSKFTGRINKKL----- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                  L E +   +  +G +   N   S ++ G  + +EIA+AL    RI+ +DEP  
Sbjct: 122 -------LDERSKMFLEQIGCDIDPNRLVSTLNVGEKQMIEIAKALTKNARIIIMDEPTT 174

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
                ET  +  ++  +   GI ++ + H M+ +  I  R+ VL  G+       +D+ D
Sbjct: 175 ALTDVETENLFKVIENLRKKGIAIIYISHRMEEIFKICHRVEVLRDGKYAGSAEIKDI-D 233

Query: 241 NPEVIAAYLG 250
           N ++IA  +G
Sbjct: 234 NDKLIAMMVG 243



 Score = 73.9 bits (180), Expect = 1e-15
 Identities = 62/233 (26%), Positives = 112/233 (48%), Gaps = 25/233 (10%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           LE+ +LS   G    V+  SF++ +G +  + G  G+G+T L   I G Y    GEI L 
Sbjct: 262 LEVKNLSCKEG----VKGASFTLRKGEILGIAGLMGSGRTELAKTIFGEYKRTSGEISLN 317

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G  ++          G+    ++ +       I  + VG +++L  NL K   +F SL +
Sbjct: 318 GSPININCISDAINNGICYLSEDRK---KEGCILGMSVGENMTLC-NLKKYENKFKSLDK 373

Query: 124 ADAVLREHAAELMVYV--------GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                +E A ++  Y+          E ++ +    +S G  +++ +A+ L   P +L +
Sbjct: 374 -----KEEAKDIEYYIKKINIKTPNKEQFIKN----LSGGNQQKVILAKWLMLSPEVLII 424

Query: 176 DEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           DEP  G +     EI  L+ ++  SG  ++++  D+  V+ ISDRI+V++ GR
Sbjct: 425 DEPTRGIDVGAKKEIYELLNELKASGKAIIMISSDLPEVLGISDRIMVMSEGR 477


>RBSA_BACCR RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 496

 Score =  110 bits (276), Expect = 1e-26
 Identities = 65/224 (29%), Positives = 116/224 (51%), Gaps = 10/224 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ ++SK F G   ++N  F ++ G V++++G NGAGK+TL  ++TG+Y    G I++ 
Sbjct: 5   IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTGVYKKDGGTIKID 64

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+  +     +    G+    Q L I  N+T  EN+ +G  L   +     +LR    R+
Sbjct: 65  GQERTFKNAKEAEEYGIAFIHQELNILPNLTVAENMFLGKELMYGKT---GILR---TRQ 118

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +A+ ++  AEL    GL       A  +S G  + +EIA+AL     ++ +DEP A   
Sbjct: 119 MNAIAQQQLAEL----GLHVRGAMLAEELSVGQQQIIEIAKALMTNASVIIMDEPTAALT 174

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            +E   +  ++ K+   G++ V + H M+ + +I D I +L  G
Sbjct: 175 DREIETLFTVINKLRKEGVSFVYISHRMEEIFSICDAITILRDG 218



 Score = 76.6 bits (187), Expect = 2e-16
 Identities = 56/214 (26%), Positives = 112/214 (52%), Gaps = 16/214 (7%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD-GEIRLGGELVSGLAPHQLARK 78
           +NVSF V +G +  V G  GAG+T +   I G Y P D G+I + G+ V   +P    R+
Sbjct: 271 ENVSFQVRKGEILGVAGLMGAGRTDIMKAIFG-YEPLDSGQIFINGQEVKIDSPIDAIRQ 329

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
            +    ++ +   + ++ +  EN+ +    +L +  V S          + + ++   ++
Sbjct: 330 RIAFITEDRKSEGLVLDFSIRENLALPNLENLSKGSVLS----------NELEQQFTEDM 379

Query: 136 MVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           M  + ++A    +A  ++S G  +++ IA+ L   P++L LDEP  G +     EI +++
Sbjct: 380 MKLLNVKASSGEQAVKSLSGGNQQKIVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIM 439

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            K+ + G  V++V  ++  V+ +SDR+LV++ G+
Sbjct: 440 NKLTEQGDAVIMVSSELPEVLGMSDRVLVIHEGK 473


>RBSA_BACC1 RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 494

 Score =  110 bits (276), Expect = 1e-26
 Identities = 69/247 (27%), Positives = 126/247 (51%), Gaps = 11/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ ++SK F G   ++N  F ++ G V++++G NGAGK+TL  ++TG+Y    G I + 
Sbjct: 3   IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTGVYKKDGGTITID 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+  +     +    G+    Q L I  N+T  EN+ +G  L   +     +LR    R+
Sbjct: 63  GQEHTFKNAKEAEEYGIAFIHQELNILSNLTVAENMFLGKELMYGKT---GILR---TRQ 116

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +A+ ++  AEL    GL       A  +S G  + +EIA+AL     ++ +DEP A   
Sbjct: 117 MNAIAQQQLAEL----GLHVKGAMLAGELSVGQQQIIEIAKALMTNASVIIMDEPTAALT 172

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E   +  ++ K+   G++ V + H M+ + +I D I +L  G  + + S  +   + E
Sbjct: 173 DREIETLFTVINKLRKEGVSFVYISHRMEEIFSICDTITILRDGEYVGKRSIPETSFD-E 231

Query: 244 VIAAYLG 250
           V++  +G
Sbjct: 232 VVSMMVG 238



 Score = 77.8 bits (190), Expect = 1e-16
 Identities = 58/214 (27%), Positives = 112/214 (52%), Gaps = 16/214 (7%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD-GEIRLGGELVSGLAPHQLARK 78
           +NVSF V +G +  V G  GA +T +   I G Y P D G+I + G+ V   +P    R+
Sbjct: 269 ENVSFQVRKGEILGVAGLMGACRTDIMKAIFG-YEPLDSGQIFINGQEVKIDSPIDAIRQ 327

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
            +    ++ +   + ++ +  EN+ +    SL +  V S          D + ++  A++
Sbjct: 328 RIAFITEDRKSEGLVLDFSIRENLALPNLESLSKGSVLS----------DELEQQFTADM 377

Query: 136 MVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           M  + ++A    +A  ++S G  +++ IA+ L   P++L LDEP  G +     EI +++
Sbjct: 378 MKLLNVKASSGEQAVKSLSGGNQQKVVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIM 437

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            K+ + G  V++V  ++  V+ +SDR+LV++ G+
Sbjct: 438 NKLTEQGDAVIMVSSELPEVLGMSDRVLVIHEGK 471


>POTA_TREPA RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 379

 Score =  110 bits (276), Expect = 1e-26
 Identities = 74/252 (29%), Positives = 127/252 (50%), Gaps = 29/252 (11%)

Query: 6   ISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGE 65
           I  +SK +G  LAV   +  + QG  +S++GP+G GKTTL  +I G   P  G++     
Sbjct: 12  IDQVSKAYGHCLAVDRATVHIRQGEFFSILGPSGCGKTTLLRIIAGFEQPDSGDLTFDHV 71

Query: 66  LVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLS-LDRNLVKSMLRFPSLRRA 124
            V G+  +   ++     FQ+  +  +++  EN+     L  L +NL+            
Sbjct: 72  SVLGVGAN---KRRSNTVFQSYALFPHLSVYENIAFPLRLKRLSKNLI------------ 116

Query: 125 DAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNP 184
               RE   E +  V L+ +L+ +   +S G  +R+ IARAL  +P +L LDEP +  + 
Sbjct: 117 ----RERVHEYLHLVQLDEHLHKKPHQLSGGQQQRVAIARALVCEPGVLLLDEPLSALDA 172

Query: 185 KETA----EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           K  +    E+D L  +   +GIT V + HD    +++SDRI V+N G+ L  G+  ++ +
Sbjct: 173 KLRSNLLIELDTLHDQ---TGITFVFITHDQSEALSVSDRIAVMNKGKILQIGTPYEIYE 229

Query: 241 NP--EVIAAYLG 250
            P  + +A ++G
Sbjct: 230 QPATDFVAKFIG 241


>POTA_CLOPE RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 349

 Score =  110 bits (276), Expect = 1e-26
 Identities = 66/251 (26%), Positives = 124/251 (49%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  ++K++G    + N+S ++ +    +++GP+G GKTT   +I G  T   G++  
Sbjct: 6   IIELKGITKSYGKDTILDNLSLNIKKNEFLTLLGPSGCGKTTTLKIIAGFETADSGQVVF 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
              +++ + P++   + +   FQ   +  +M   EN+  G  L                +
Sbjct: 66  ENNIINDIPPYE---RQLNTVFQKYALFPHMNVYENIAFGLKLK---------------K 107

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
               V+ +   E++  V LE Y N +  A+S G  +R+ IARAL  +P++L LDEP    
Sbjct: 108 MPKDVIDQKVKEMLKLVALEGYENRDIEALSGGQQQRVAIARALVNEPKVLLLDEPLGAL 167

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K    +   +++I    GIT + V HD +  + +SD I+V+N G     GS  D+ + 
Sbjct: 168 DMKLRKGMQIELKRIQQKLGITFIFVTHDQEEALTMSDTIVVMNKGEIQQMGSPEDIYNE 227

Query: 242 P--EVIAAYLG 250
           P    +A ++G
Sbjct: 228 PANSFVAKFIG 238


>POTA_CLOP1 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 349

 Score =  110 bits (276), Expect = 1e-26
 Identities = 66/251 (26%), Positives = 124/251 (49%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  ++K++G    + N+S ++ +    +++GP+G GKTT   +I G  T   G++  
Sbjct: 6   IIELKGITKSYGKDTILDNLSLNIKKNEFLTLLGPSGCGKTTTLKIIAGFETADSGQVVF 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
              +++ + P++   + +   FQ   +  +M   EN+  G  L                +
Sbjct: 66  ENNIINDIPPYE---RQLNTVFQKYALFPHMNVYENIAFGLKLK---------------K 107

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
               V+ +   E++  V LE Y N +  A+S G  +R+ IARAL  +P++L LDEP    
Sbjct: 108 MPKDVIDQKVKEMLKLVALEGYENRDIEALSGGQQQRVAIARALVNEPKVLLLDEPLGAL 167

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K    +   +++I    GIT + V HD +  + +SD I+V+N G     GS  D+ + 
Sbjct: 168 DMKLRKGMQIELKRIQQKLGITFIFVTHDQEEALTMSDTIVVMNKGEIQQMGSPEDIYNE 227

Query: 242 P--EVIAAYLG 250
           P    +A ++G
Sbjct: 228 PANSFVAKFIG 238


>MGLA_CLOPE RecName: Full=Galactose/methyl galactoside import
           ATP-binding protein mglA;         EC=3.6.3.17;
          Length = 515

 Score =  110 bits (276), Expect = 1e-26
 Identities = 62/238 (26%), Positives = 119/238 (50%), Gaps = 16/238 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ ++SK F GV A+ NV+  V +G V++++G NGAGK+TL   + GIY P  GEI +
Sbjct: 7   LLEMRNISKEFPGVKALDNVTLKVKKGSVHALMGENGAGKSTLMKCLFGIYHPNSGEIFI 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP--S 120
            G+ V           G+    Q L        ++N+ +G              R+P   
Sbjct: 67  SGQKVQFKNSKHALDNGVSMVHQELNQVRERNVMDNLWLG--------------RYPKKG 112

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           L   +  + +   ++   + +      + S +S   ++ +EIA+A++   +I+ +DEP +
Sbjct: 113 LFIDEKKMYDETEKIFKDLDINVNPRDKVSTLSVSQMQMVEIAKAVSYNSKIIVMDEPTS 172

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
               KE + +  ++ K+   GI+++ + H M+ ++ ISD + ++  G+ +    A D+
Sbjct: 173 SLTEKEVSHLFKIINKLRKQGISIIYISHKMEEILEISDEVTIMRDGKWIATEKASDL 230



 Score = 64.3 bits (155), Expect = 1e-12
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 20/231 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           LE+++LS        ++NVSF + +G +  + G  GA +T     + G+     G+I L 
Sbjct: 260 LEVNNLSDAKN---ELKNVSFKLRKGEILGIAGLVGAKRTETLETLFGLREKGSGDIILH 316

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+ V    P +  + G     +  +            + G L +D N +  +    S + 
Sbjct: 317 GKKVDNSKPFKAMQNGFALVTEERR---------QTGIFGKLPIDFNSI--IANIDSYKT 365

Query: 124 ADAVLREHAAEL---MVYVGLEAYLNSEAS---AMSYGALKRLEIARALAAKPRILFLDE 177
           +  +L           V   ++    S+ +   ++S G  +++ I + L  KP IL LDE
Sbjct: 366 STGLLANERISKDTQWVIDSMKVKTPSQKTLIGSLSGGNQQKIVIGKWLLRKPEILLLDE 425

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P  G +     EI  L+ ++A     +++V  +M  ++ + DRILV++ GR
Sbjct: 426 PTRGIDVGAKFEIYQLINELAKEDKGIIMVSSEMPELLGVCDRILVMSNGR 476


>MGLA_CLOP1 RecName: Full=Galactose/methyl galactoside import
           ATP-binding protein mglA;         EC=3.6.3.17;
          Length = 515

 Score =  110 bits (276), Expect = 1e-26
 Identities = 62/238 (26%), Positives = 119/238 (50%), Gaps = 16/238 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ ++SK F GV A+ NV+  V +G V++++G NGAGK+TL   + GIY P  GEI +
Sbjct: 7   LLEMRNISKEFPGVKALDNVTLKVKKGSVHALMGENGAGKSTLMKCLFGIYHPNSGEIFI 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP--S 120
            G+ V           G+    Q L        ++N+ +G              R+P   
Sbjct: 67  SGQKVQFKNSKHALDNGVSMVHQELNQVRERNVMDNLWLG--------------RYPKKG 112

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           L   +  + +   ++   + +      + S +S   ++ +EIA+A++   +I+ +DEP +
Sbjct: 113 LFIDEKKMYDETEKIFKDLDINVNPRDKVSTLSVSQMQMVEIAKAVSYNSKIIVMDEPTS 172

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
               KE + +  ++ K+   GI+++ + H M+ ++ ISD + ++  G+ +    A D+
Sbjct: 173 SLTEKEVSHLFKIINKLRKQGISIIYISHKMEEILEISDEVTIMRDGKWIATEKASDL 230



 Score = 65.1 bits (157), Expect = 6e-13
 Identities = 56/232 (24%), Positives = 105/232 (45%), Gaps = 20/232 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+++LS        ++NVSF + +G +  + G  GA +T     + G+     G+I L
Sbjct: 259 ILEVNNLSDAKN---ELKNVSFKLRKGEILGIAGLVGAKRTETLETLFGLREKGSGDIIL 315

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V    P +  + G     +  +            + G L +D N +  +    S +
Sbjct: 316 HGKKVDNSKPFKAMQNGFALVTEERR---------QTGIFGKLPIDFNSI--IANIDSYK 364

Query: 123 RADAVL---REHAAELMVYVGLEAYLNSEAS---AMSYGALKRLEIARALAAKPRILFLD 176
            +  +L   R       V   ++    S+ +   ++S G  +++ I + L  KP IL LD
Sbjct: 365 TSTGLLANGRISKDTQWVIDSMKVKTPSQKTLIGSLSGGNQQKIVIGKWLLRKPEILLLD 424

Query: 177 EPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           EP  G +     EI  L+ ++A     +++V  +M  ++ + DRILV++ GR
Sbjct: 425 EPTRGIDVGAKFEIYQLINELAKEDKGIIMVSSEMPELLGVCDRILVMSNGR 476


>METN_CLOTE RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 318

 Score =  110 bits (276), Expect = 1e-26
 Identities = 75/240 (31%), Positives = 124/240 (51%), Gaps = 20/240 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++EI D+ K FG    ++N+S  + +G V+ +IG +GAGK+TL   + G+    +G I++
Sbjct: 1   MIEIKDVGKIFGDTKVLENISLDIKEGEVFGIIGRSGAGKSTLLRCLNGLENYDEGSIKV 60

Query: 63  GGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
             + V  L   +L   RK MG  FQ   I  +    +NV                L    
Sbjct: 61  MDKEVKDLNNIELRKLRKDMGMIFQGFNIMNSKNIYDNV---------------ALPLQV 105

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
            ++    + E   EL+  VGLE    S    +S G  +R+ IARAL  +P++L  DE  +
Sbjct: 106 WKKDKKYIDEKVRELLKLVGLENKAKSYPRELSGGQKQRVAIARALTMEPKVLLCDEATS 165

Query: 181 GFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE-GSARDV 238
             +P+ T  I  L++KI  +  ITVV+V H M+++  I +RI +++ GRK++  G  +D+
Sbjct: 166 ALDPETTKSILKLIQKINKELKITVVVVTHQMEVIKEICNRIALID-GRKVSAYGEVKDL 224


>RBSA_RHOSR RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 503

 Score =  110 bits (275), Expect = 1e-26
 Identities = 64/229 (27%), Positives = 118/229 (51%), Gaps = 11/229 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ D++K+FG V AVQ VSF +  G  ++++G NGAGK+T+  ++ G++ P  G + +
Sbjct: 9   LLEVRDVTKSFGNVAAVQGVSFPLYGGEAHALVGENGAGKSTIVKMLAGVHGPDTGSLLV 68

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
           GGE VS  +P     +G+   +Q   +  ++T  EN+ +G          +   R   + 
Sbjct: 69  GGEEVSLGSPSDAKARGIAVIYQEPTLFPDLTIAENIFIG---------TQPRARLGMID 119

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R  + +   A  L   +G+    +  AS +S    + +EIA+AL+    ++ +DEP A  
Sbjct: 120 R--SAMNTAARALFDRLGVPMDPDRLASGLSIADQQLVEIAKALSTDANVIVMDEPTAAL 177

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLT 231
           +  E   +  + R +  SG  V+ + H  + +  +  R+ V+  GR ++
Sbjct: 178 SGNEVERLFKVARSLCASGSAVMFISHRFEEIFALCQRVTVMRDGRHIS 226



 Score = 75.9 bits (185), Expect = 4e-16
 Identities = 59/251 (23%), Positives = 120/251 (47%), Gaps = 11/251 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LEI +LS+   GV +  ++SF V  G + ++ G  GAG++ +     G+     G++R+
Sbjct: 262 VLEIENLSRA--GVFS--DISFQVRAGEIVALSGLVGAGRSEVMQSAFGVDPRDSGDVRV 317

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ +   +P    R GM    ++ +       I ++ +  + +L R+   +        
Sbjct: 318 RGKSLRKGSPKAAMRAGMALVPEDRR---QQGLILDMSIERNATLTRSSALAXXXXXXXX 374

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                  E   +L       A +      +S G  +++ +A+ +A  P +L +DEP  G 
Sbjct: 375 XXXXSAYEWTKKLQTKY---ARITDPVGVLSGGNQQKVVLAKWMATAPSVLIVDEPTRGI 431

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
           +    AE+  ++  +A  G+ VV++  ++  V+ ++DR+LV+  GR ++E S R   D  
Sbjct: 432 DVGTKAEVHRIISTLASEGVAVVMISSELPEVLGMADRVLVMREGRIVSELS-RSEADEE 490

Query: 243 EVIAAYLGTAA 253
           +++ A  G+ A
Sbjct: 491 KIMFAATGSEA 501


>POTA_LACS1 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 362

 Score =  110 bits (275), Expect = 1e-26
 Identities = 65/238 (27%), Positives = 124/238 (52%), Gaps = 21/238 (8%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           V  +++VSF +++G  Y+++GP+G GKTT+ N+I G+     G++   G+ ++ +  +  
Sbjct: 19  VQVLKDVSFDIEEGKFYTLLGPSGCGKTTILNIIAGLSDATSGDVYFDGKRINDVPAN-- 76

Query: 76  ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
            ++ +   FQ+  +  ++   +N+  G            + + P+ +     ++E   E 
Sbjct: 77  -KRQVNTVFQDYALFQHLNVYDNIAFG----------LKIKKVPADK-----IKEKVTEA 120

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
           +  V L+ Y +   S MS G  +R+ IARA+   P++L LDEP +  + K  AE+   +R
Sbjct: 121 LRMVRLDGYEDRAISEMSGGQRQRVAIARAIVLDPKVLLLDEPLSALDQKLRAEMQYELR 180

Query: 196 KIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EVIAAYLG 250
            +    GIT + + HD +  + +SD I VLN G  +  G+  D+ D P    +A ++G
Sbjct: 181 SLQKKLGITFIFITHDQEEALAMSDEIFVLNNGNIVQSGTPVDIYDEPINHYVADFIG 238


>POTA_HAEDU RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 371

 Score =  110 bits (275), Expect = 1e-26
 Identities = 69/251 (27%), Positives = 134/251 (53%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+ +++K++G    +++++ +++ G   +++GP+G GKTT   LI G     +G I L
Sbjct: 9   IVELRNVTKSYGDKTILKDLNLTINDGEFLTILGPSGCGKTTALRLIAGFEDLTEGSIIL 68

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ VS ++     ++ +   FQ+  +  +MT  ENV  G            M + P+ +
Sbjct: 69  DGQDVSNVSAE---KRPVNTVFQSYALFPHMTIFENVAFG----------LRMQKVPNEQ 115

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
               V+     E +  V LE     + + +S G  +R+ IARA+  KP++L LDE  +  
Sbjct: 116 ITPRVM-----EALRMVRLEDRAEQKPAQLSGGQQQRIAIARAVVNKPKVLLLDESLSAL 170

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   E+ N ++ +    GIT + V HD +  + +SDRI+V+N G+   +G+ R++ + 
Sbjct: 171 DYKLRKEMQNELKALQRQLGITFIFVTHDQEEALTMSDRIIVMNAGKVAQDGTPREIYEE 230

Query: 242 PE--VIAAYLG 250
           P+   +A ++G
Sbjct: 231 PKNLFVARFIG 241


>METN_RHOPB RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 356

 Score =  110 bits (275), Expect = 1e-26
 Identities = 72/251 (28%), Positives = 134/251 (53%), Gaps = 28/251 (11%)

Query: 4   LEISDLSKTFGG------VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           + I +++KT+        V+A+ N++ +V +G +  VIG +GAGK++L  LI G+  P  
Sbjct: 12  ISIENVAKTYPARKGSAEVVALDNINLNVPEGSIVGVIGRSGAGKSSLIRLINGLEQPTK 71

Query: 58  GEIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLS--LDRNLVK 113
           G + + G  ++ L    L  AR+ +G  FQ+  +  + TA +N+ +   ++    R + K
Sbjct: 72  GRVIVNGTEITSLDEPALRQARRSIGMIFQHFNLLSSRTAFDNIALPLEIAGVAKREIAK 131

Query: 114 SMLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRIL 173
           ++L                  L+  VGL    +   + +S G  +R+ IARALA  P++L
Sbjct: 132 TVL-----------------PLLDMVGLADKRDRYPAELSGGQKQRVGIARALATSPKVL 174

Query: 174 FLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
             DE  +  +P+ T +I  L+++I AD  +T++ + H+M +V  ++DR+ VL  G  + E
Sbjct: 175 LSDEATSALDPETTDQILELLKRINADLRLTILFITHEMAVVKALADRVAVLERGHIVEE 234

Query: 233 GSARDVRDNPE 243
           G+  +V  +P+
Sbjct: 235 GTTYNVFASPQ 245


>METN4_OCEIH RecName: Full=Methionine import ATP-binding protein
           metN 4;         EC=3.6.3.-;
          Length = 345

 Score =  110 bits (275), Expect = 1e-26
 Identities = 71/250 (28%), Positives = 134/250 (53%), Gaps = 24/250 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+++++KTF G    + A+++VS SV +G +Y VIG +GAGK+TL   +  +  P  G
Sbjct: 1   MIELTNITKTFAGKQGDIQALKDVSLSVGKGEIYGVIGYSGAGKSTLIRCVNLLEQPDQG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLS-LDRNLVKSM 115
            +++    ++ L   +L   R  +G  FQ   +    T  +N+ +   L+ L++  VK  
Sbjct: 61  SVKVNDVELTTLKSGKLRETRSHIGMIFQGFNLLKTATVYDNIAIPLKLTGLNKKAVKDR 120

Query: 116 LRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
           ++                + +  VGL    ++  S +S G  +R+ IARAL+ +P +L  
Sbjct: 121 VQ----------------KYLDIVGLADKHDAYPSELSGGQKQRVAIARALSHEPEVLLS 164

Query: 176 DEPAAGFNPKET-AEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           DE  +  +P  T A +D L+R   + GIT++L+ H+M ++  + DR+ V+  G  + EG 
Sbjct: 165 DEATSALDPDTTEAILDLLLRINKELGITILLITHEMNVIQRVCDRVAVMENGEVIEEGY 224

Query: 235 ARDVRDNPEV 244
            +D+  +P++
Sbjct: 225 TKDIFISPQL 234


>METN2_ENTFA RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 345

 Score =  110 bits (275), Expect = 1e-26
 Identities = 76/250 (30%), Positives = 124/250 (49%), Gaps = 22/250 (8%)

Query: 1   MALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPC 56
           MAL+E+  + K F G    V A++++  +V+                TL  L+ G+ TP 
Sbjct: 1   MALIELRHVKKEFSGKAGKVTALKDIDLTVEXXXXXXXXXXXXXXXXTLVRLLNGLETPT 60

Query: 57  DGEIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKS 114
           +GE+ + G+ ++ L   +L   RK +G  FQ+  +  + T +EN+M          L   
Sbjct: 61  EGEVEIQGQDIALLPNKELRNFRKKIGMIFQHFNLLWSRTVLENIM----------LPLE 110

Query: 115 MLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILF 174
           +   P   R     +  A EL+  VGLE    +  S +S G  +R+ IARALA  P IL 
Sbjct: 111 IAGVPKQNR-----KSRAEELIKLVGLEGRETAYPSQLSGGQKQRVGIARALANNPDILL 165

Query: 175 LDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
            DE  +  +P+ T E+  L+ KI  +  +TVVL+ H+M ++  I +R+ V+ YG  + EG
Sbjct: 166 CDEATSALDPQTTDEVLELLLKINQELNLTVVLITHEMHVIRKICNRVAVMEYGEIVEEG 225

Query: 234 SARDVRDNPE 243
              D+   P+
Sbjct: 226 KVIDIFKKPQ 235


>METN1_SALTY RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 343

 Score =  110 bits (275), Expect = 1e-26
 Identities = 72/248 (29%), Positives = 132/248 (53%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFQQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            +++GG+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD    +   
Sbjct: 61  SVQVGGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELDNTPKEE-- 116

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  + +S G  +R+ IARALA+ P++L  D
Sbjct: 117 -----------IKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN1_SALCH RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 343

 Score =  110 bits (275), Expect = 1e-26
 Identities = 72/248 (29%), Positives = 132/248 (53%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFQQGARTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            +++GG+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD    +   
Sbjct: 61  SVQVGGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELDNTPKEE-- 116

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  + +S G  +R+ IARALA+ P++L  D
Sbjct: 117 -----------IKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>CYSA_ERWCT RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase;
          Length = 330

 Score =  110 bits (275), Expect = 1e-26
 Identities = 72/250 (28%), Positives = 130/250 (52%), Gaps = 17/250 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +EI +++K FG   A+  ++ S+  G + +++GP+G GKTTL  +I G+  P  G I   
Sbjct: 3   IEIRNINKQFGQFRALNEINLSIHSGELVALLGPSGCGKTTLLRIIAGLEQPDSGSIIFH 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+ VS    H + ++ +G  FQ+  +  +MT  +NV  G             ++  ++R 
Sbjct: 63  GQDVS---VHDVRKRNVGFVFQHYALFRHMTVFDNVAFG-----------LRMKPKNIRP 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           + + + +   EL+  V L+   +     +S G  +R+ +ARAL  +P IL LDEP    +
Sbjct: 109 SKSDIEKKVHELLNLVQLDWLGDRYPEQLSGGQRQRIALARALIVEPSILLLDEPFGALD 168

Query: 184 PKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            K   E+   + ++  D  +T V V HD +  M ++DRI+++N G     G+  +V ++P
Sbjct: 169 AKVRKELRRWLSQLHEDIDLTSVFVTHDQEEAMEVADRIVLMNKGVIEQIGTPAEVYNHP 228

Query: 243 --EVIAAYLG 250
             E +  +LG
Sbjct: 229 ASEFVYHFLG 238


>XYLG_GEOKA RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 504

 Score =  110 bits (274), Expect = 2e-26
 Identities = 67/250 (26%), Positives = 129/250 (51%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           +LE+  ++K F GV A+ NV+FSV +G ++++ G NGAGK+TL  +++G+Y     DG+I
Sbjct: 5   VLEMKGITKEFPGVRALDNVTFSVRKGEIHALCGENGAGKSTLMKVLSGVYPYGSYDGKI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            + G+ V      +    G+   +Q L +   MT  EN+ +G  L   + +  + L    
Sbjct: 65  YIEGKEVRFRNIKESQEAGIAIIYQELAVVEEMTVAENLFLGHELMRGKYIDWNRLY--- 121

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
                      A + +  +GL+    ++   ++ G  + +EIA+AL+   +I+ LDEP A
Sbjct: 122 ---------SEAQKWLQKIGLDIDPETKVRNLTVGKQQLIEIAKALSKNAKIIILDEPTA 172

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
                + A + N++  +   G+T + + H +  VM ++D + VL  G+ ++     ++  
Sbjct: 173 ALTDSDVATLKNILCDLRSQGVTCIYISHRLNEVMELADTVTVLRDGQTISTDRI-ELLT 231

Query: 241 NPEVIAAYLG 250
             ++IA  +G
Sbjct: 232 EEQIIAKMVG 241



 Score = 76.6 bits (187), Expect = 2e-16
 Identities = 58/215 (26%), Positives = 110/215 (51%), Gaps = 15/215 (6%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT-PCDGEIRLGGELVSGLAPHQLAR 77
           + +VSFS+  G +  + G  G+G+T LF  + G Y     G + + G+ V    P +  +
Sbjct: 277 IHDVSFSLKAGEILGISGLMGSGRTELFTSLFGAYHGKKKGTVWIDGKQVDIRRPAEAIQ 336

Query: 78  KGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAE 134
            GM    ++ +   + + M  I+N  +          +K + ++  +  A  V  + A E
Sbjct: 337 YGMAYVSEDRKKYGLVLEMDIIKNSTLVA--------LKKVTKWNVIDHALEV--KQAEE 386

Query: 135 LMVYVGLEA-YLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           +   + L+A  L ++ S +S G  +++ +++ L   P+IL LDEP  G +     EI  +
Sbjct: 387 ITKRMKLKAPTLEAKVSQLSGGNQQKVVLSKWLLNSPKILILDEPTRGIDVGAKYEIYKI 446

Query: 194 VRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           + ++A  G+ +VL+  ++  VM +SDRILV++ GR
Sbjct: 447 INELASQGVGIVLISSELPEVMGMSDRILVMSEGR 481


>RGMG_HAHCH RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein;       
           EC=3.6.3.17;
          Length = 515

 Score =  110 bits (274), Expect = 2e-26
 Identities = 72/240 (30%), Positives = 121/240 (50%), Gaps = 12/240 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE++++ K F GV+A+ NVS  +  G V++++G NGAGK+TL  +I GIY P  G++ L
Sbjct: 25  VLEVANVRKEFPGVVALDNVSLRIRPGTVHALMGENGAGKSTLMKIIAGIYQPDKGQVLL 84

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V    P      G+    Q L +   MT  EN+ +       R   K   RF  + 
Sbjct: 85  RGEPVRLEKPLDAQEAGIAMIHQELLLMNPMTVAENIWI-------RREPKG--RFGLID 135

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             +  +R    EL   + +     +E S +S  + + +EIA+A++    +L +DEP +  
Sbjct: 136 HDE--MRRRTQELFDRLNINLDPEAEISELSVASRQMVEIAKAVSFNSDVLIMDEPTSAI 193

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKL-TEGSARDVRDN 241
              E A + +++R +   GI +V + H M  +  I+D   V   G+ + T  S+   RD+
Sbjct: 194 TETEVAHLFDIIRDLRAKGIGIVYITHKMNELFEIADEFSVFRDGQYIGTHLSSNVTRDD 253



 Score = 75.9 bits (185), Expect = 4e-16
 Identities = 61/230 (26%), Positives = 113/230 (49%), Gaps = 17/230 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L + +LS+   GV   +NVSF V  G +    G  G+G++ +   + G+     G I++
Sbjct: 278 VLSVKNLSRE--GVF--RNVSFDVRAGEIVGFAGLVGSGRSNVAEALFGVAPADGGAIQI 333

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
            GE V   +P++  + GM    ++ +     + +T  EN+       L +N VK    F 
Sbjct: 334 NGEFVQIKSPNEAIQHGMAFLTEDRKETGCFLPLTIQENIQSA---VLHQNFVKK--GFX 388

Query: 120 SLRRADAVLREHAAELMVYV-GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
                         +L V   G++  + +    +S G  +++ I R L   P+IL LDEP
Sbjct: 389 XXXXXXXXXXXICNKLRVKTPGMDEVIEN----LSGGNQQKVLIGRWLLTHPKILILDEP 444

Query: 179 AAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
             G +    AEI +L+ ++A  G+ VV++  ++  ++ +SDR++V++ GR
Sbjct: 445 TRGIDVGAKAEIHSLITQLAHKGVAVVMISSELPEILGMSDRVVVMHEGR 494


>RGMG1_BURS3 RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 1;       
           EC=3.6.3.17;
          Length = 512

 Score =  110 bits (274), Expect = 2e-26
 Identities = 65/230 (28%), Positives = 114/230 (49%), Gaps = 18/230 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           L+ ++ + K F GV A+ +  F +  G V++++G NGAGK+TL  ++ G+Y   DGEIR+
Sbjct: 13  LIALTGIGKRFPGVQALDDCHFDLRAGEVHALMGENGAGKSTLMKILAGVYQRDDGEIRM 72

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V    P      G+G   Q L +  +++  +N+ +G              R P  R
Sbjct: 73  DGRAVEIADPRAAQALGIGIIHQELNLMNHLSVAQNIFIG--------------REPRGR 118

Query: 123 RA----DAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
                 +A L   AA +   + L+    +    ++    + +EIA+AL+   R+L +DEP
Sbjct: 119 FGVFVDEAALNRDAAAIFARMRLDLDPRTPVGQLTVAKQQMVEIAKALSFDSRVLIMDEP 178

Query: 179 AAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            A  N  E AE+  ++  +   G+ +V + H M  +  I+DR+ V+  G+
Sbjct: 179 TAALNNAEIAELFRIIGDLRAHGVGIVYISHKMDELRQIADRVTVMRDGK 228



 Score = 66.2 bits (160), Expect = 3e-13
 Identities = 63/237 (26%), Positives = 106/237 (44%), Gaps = 15/237 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           LE+  LS+      A+++V F++ +G +    G  GAG+T +   + G      GEIR+ 
Sbjct: 269 LEVRGLSRG----RAIRDVGFTLRRGEILGFAGLMGAGRTEVARAVFGADPVDAGEIRVH 324

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
           G+ VS  +P    R G+G   ++ +   + + M    N+     LS  R  V+  L F  
Sbjct: 325 GKTVSIRSPADAVRHGIGYLSEDRKHFGLAVGMDVQNNIA----LSSMRRFVRRGL-FLD 379

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
            R      + +  +L +       +   A  +S G  +++ IA+ L     ILF DEP  
Sbjct: 380 ARALRDTAQSYVRQLAIRT---PSVTQPARLLSGGNQQKIVIAKWLLRDCDILFFDEPTR 436

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
           G +    +EI          G  +V++  ++  V+ +S RILV+  GR   E  A D
Sbjct: 437 GIDVGAKSEIYKXXXXXXXXGKAIVMISSELPEVLRMSHRILVMCEGRVTGELRAAD 493


>RBSA_BACHK RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 494

 Score =  110 bits (274), Expect = 2e-26
 Identities = 69/247 (27%), Positives = 126/247 (51%), Gaps = 11/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ ++SK F G   ++N  F ++ G V++++G NGAGK+TL  ++TG+Y    G I + 
Sbjct: 3   IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTGVYKRDGGTITID 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+  +     +    G+    Q L I  N+T  EN+ +G  L   +     +LR    R+
Sbjct: 63  GQERTFKNAKEAEEYGIAFIHQELNILPNLTVAENMFLGKELMYGKT---GILR---TRQ 116

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +A+ ++  AEL    GL       A  +S G  + +EIA+AL     ++ +DEP A   
Sbjct: 117 MNAIAQQQLAEL----GLHVKGAMLAGELSVGQQQIIEIAKALMTNASVIIMDEPTAALT 172

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E   +  ++ K+   G++ V + H M+ + +I D I +L  G  + + S  +   + E
Sbjct: 173 DREIETLFTVINKLRKEGVSFVYISHRMEEIFSICDAITILRDGEYVGKRSIPETSFD-E 231

Query: 244 VIAAYLG 250
           V++  +G
Sbjct: 232 VVSMMVG 238



 Score = 79.3 bits (194), Expect = 3e-17
 Identities = 58/214 (27%), Positives = 113/214 (52%), Gaps = 16/214 (7%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD-GEIRLGGELVSGLAPHQLARK 78
           +NVSF V +G +  V G  GAG+T +   I G Y P D G+I + G+ V   +P    R+
Sbjct: 269 ENVSFQVRKGEILGVAGLMGAGRTDIMKAIFG-YEPLDSGQIFINGQEVKIDSPIDAIRQ 327

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
            +    ++ +   + ++ +  EN+ +    SL +  V S          + + ++  A++
Sbjct: 328 RIAFITEDRKSEGLVLDFSIRENLALPNLESLSKGSVLS----------NELEQQFTADM 377

Query: 136 MVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           M  + ++A    +A  ++S G  +++ IA+ L   P++L LDEP  G +     EI +++
Sbjct: 378 MKLLNVKASSGEQAVKSLSGGNQQKVVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIM 437

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            K+ + G  V++V  ++  V+ +SDR+LV++ G+
Sbjct: 438 NKLTEEGDAVIMVSSELPEVLGMSDRVLVIHEGK 471


>RBSA_BACCZ RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 494

 Score =  110 bits (274), Expect = 2e-26
 Identities = 69/247 (27%), Positives = 126/247 (51%), Gaps = 11/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ ++SK F G   ++N  F ++ G V++++G NGAGK+TL  ++TG+Y    G I + 
Sbjct: 3   IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTGVYKRDGGTITID 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+  +     +    G+    Q L I  N+T  EN+ +G  L   +     +LR    R+
Sbjct: 63  GQERTFKNAKEAEEYGIAFIHQELNILPNLTVAENMFLGKELMYGKT---GILR---TRQ 116

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +A+ ++  AEL    GL       A  +S G  + +EIA+AL     ++ +DEP A   
Sbjct: 117 MNAIAQQQLAEL----GLHVKGAMLAGELSVGQQQIIEIAKALMTNASVIIMDEPTAALT 172

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E   +  ++ K+   G++ V + H M+ + +I D I +L  G  + + S  +   + E
Sbjct: 173 DREIETLFTVINKLRKEGVSFVYISHRMEEIFSICDAITILRDGEYVGKRSIPETSFD-E 231

Query: 244 VIAAYLG 250
           V++  +G
Sbjct: 232 VVSMMVG 238



 Score = 79.0 bits (193), Expect = 4e-17
 Identities = 58/214 (27%), Positives = 113/214 (52%), Gaps = 16/214 (7%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD-GEIRLGGELVSGLAPHQLARK 78
           +NVSF V +G +  V G  GAG+T +   I G Y P D G+I + G+ V   +P    R+
Sbjct: 269 ENVSFQVRKGEILGVAGLMGAGRTDIMKSIFG-YEPLDSGQIFINGQEVKIDSPIDAIRQ 327

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
            +    ++ +   + ++ +  EN+ +    SL +  V S          + + ++  A++
Sbjct: 328 RIAFITEDRKSEGLVLDFSIRENLALPNLESLSKGSVLS----------NELEQQFTADM 377

Query: 136 MVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           M  + ++A    +A  ++S G  +++ IA+ L   P++L LDEP  G +     EI +++
Sbjct: 378 MKLLNVKASSGEQAVKSLSGGNQQKVVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIM 437

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            K+ + G  V++V  ++  V+ +SDR+LV++ G+
Sbjct: 438 NKLTEEGDAVIMVSSELPEVLGMSDRVLVIHEGK 471


>RBSA_BACAN RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 494

 Score =  110 bits (274), Expect = 2e-26
 Identities = 69/247 (27%), Positives = 126/247 (51%), Gaps = 11/247 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ ++SK F G   ++N  F ++ G V++++G NGAGK+TL  ++TG+Y    G I + 
Sbjct: 3   IEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTGVYKRDGGTITID 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+  +     +    G+    Q L I  N+T  EN+ +G  L   +     +LR    R+
Sbjct: 63  GQERTFKNAKEAEEYGIAFIHQELNILPNLTVAENMFLGKELMYGKT---GILR---TRQ 116

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +A+ ++  AEL    GL       A  +S G  + +EIA+AL     ++ +DEP A   
Sbjct: 117 MNAIAQQQLAEL----GLHVKGAMLAGELSVGQQQIIEIAKALMTNASVIIMDEPTAALT 172

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
            +E   +  ++ K+   G++ V + H M+ + +I D I +L  G  + + S  +   + E
Sbjct: 173 DREIETLFTVINKLRKEGVSFVYISHRMEEIFSICDAITILRDGEYVGKRSIPETSFD-E 231

Query: 244 VIAAYLG 250
           V++  +G
Sbjct: 232 VVSMMVG 238



 Score = 79.3 bits (194), Expect = 3e-17
 Identities = 58/214 (27%), Positives = 113/214 (52%), Gaps = 16/214 (7%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD-GEIRLGGELVSGLAPHQLARK 78
           +NVSF V +G +  V G  GAG+T +   I G Y P D G+I + G+ V   +P    R+
Sbjct: 269 ENVSFQVRKGEILGVAGLMGAGRTDIMKAIFG-YEPLDSGQIFINGQEVKIDSPIDAIRQ 327

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
            +    ++ +   + ++ +  EN+ +    SL +  V S          + + ++  A++
Sbjct: 328 RIAFITEDRKSEGLVLDFSIRENLALPNLESLSKGSVLS----------NELEQQFTADM 377

Query: 136 MVYVGLEAYLNSEA-SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLV 194
           M  + ++A    +A  ++S G  +++ IA+ L   P++L LDEP  G +     EI +++
Sbjct: 378 MKLLNVKASSGEQAVKSLSGGNQQKVVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIM 437

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            K+ + G  V++V  ++  V+ +SDR+LV++ G+
Sbjct: 438 NKLTEEGDAVIMVSSELPEVLGMSDRVLVIHEGK 471


>POTA_MESFL RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 350

 Score =  110 bits (274), Expect = 2e-26
 Identities = 67/251 (26%), Positives = 130/251 (51%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+ +++K + G + ++ +  ++ +G   +++GP+G GKTT   ++ G   P  G+I  
Sbjct: 5   ILELRNVTKDYDGKVVLKGIDLNIKEGEFITLLGPSGCGKTTTLRIVAGFEKPNSGQIMF 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+    L P  + ++     FQ+  +  ++   +N+  G             LR    +
Sbjct: 65  EGK---DLLPIPINKRQFNTIFQSYALFPHLNVFDNIAFG-------------LRTKKTK 108

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           +   +L+    + +  VGLE + +   + +S G  +R+ IARAL  KP++L LDEP A  
Sbjct: 109 K--DILQREVLKQIRQVGLEGFEDRNINDLSGGQKQRVAIARALVMKPKVLLLDEPLAAL 166

Query: 183 NPKETAEI-DNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + +    + + L R   + GIT ++V HD +  ++ISDR++V+N G     G+  D+ + 
Sbjct: 167 DVQLRQHMREELKRLQREIGITFLMVSHDQEEALSISDRVVVMNEGSIQQIGTPEDIYNE 226

Query: 242 PE--VIAAYLG 250
           PE   +A ++G
Sbjct: 227 PENLWVAKFIG 237


>POTA_LACBA RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 370

 Score =  110 bits (274), Expect = 2e-26
 Identities = 68/251 (27%), Positives = 125/251 (49%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  ++K +     + N++ +++ G  Y+++GP+G GKTT+   I G      G+I  
Sbjct: 5   IIELHQVTKRYADNTILSNINLTLESGKFYTLLGPSGCGKTTILRTIAGFTDATTGDILF 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ ++ +  +   ++ +   FQ+  +  +MT  ENV  G  L                +
Sbjct: 65  AGKRINDVPAN---KRNVNTVFQDYALFPHMTVAENVAFGLTLQ---------------K 106

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R  + + E   + +  V L  Y +   SA+S G  +R+ IARA+  +P++L LDEP +  
Sbjct: 107 RPKSEIAERVNQALRLVQLADYGDRAISALSGGQQQRIAIARAIVMQPQVLLLDEPLSAL 166

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   +R +    GIT + V HD +  + +SD I V+N G  L  GS  D+ D 
Sbjct: 167 DAKLRRQMQYELRDLQQRLGITFLFVTHDQEEALAMSDEIFVMNQGEILQSGSPVDIYDE 226

Query: 242 P--EVIAAYLG 250
           P    +A ++G
Sbjct: 227 PINHFVADFIG 237


>NODI1_RHIME RecName: Full=Nod factor export ATP-binding protein I; 
                  EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 335

 Score =  110 bits (274), Expect = 2e-26
 Identities = 78/250 (31%), Positives = 123/250 (49%), Gaps = 20/250 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           ++++ ++K++G    +  +SF+V  G  + ++GPNGAGK+T+  +I G+ TP  GEI + 
Sbjct: 37  IDVASVTKSYGDKPVINGLSFTVAAGECFGLLGPNGAGKSTITRMILGMTTPGTGEITVL 96

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G  V   A     R G+   F NL +    T  EN++V G                S R 
Sbjct: 97  GVPVPSRARLARMRIGVVPQFDNLDL--EFTVRENLLVFGRYFR-----------MSTRE 143

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            +AV+      L+ +  LE   ++  S +S G  +RL +ARAL   P++L LDEP  G +
Sbjct: 144 IEAVI----PSLLEFARLENKADARVSDLSGGMKRRLTLARALINDPQLLILDEPTTGLD 199

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR---DVRD 240
           P     I   +R +   G T++L  H M+    + DR+ VL  G K+ EG      D + 
Sbjct: 200 PHARHLIWERLRSLLARGKTILLTTHIMEEAERLCDRLCVLEAGHKIAEGRPHMLIDEKI 259

Query: 241 NPEVIAAYLG 250
             +VI  Y G
Sbjct: 260 GCQVIEIYGG 269


>METN_PASMU RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 344

 Score =  110 bits (274), Expect = 2e-26
 Identities = 73/248 (29%), Positives = 130/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++  +SK F      + A+ NVS  V +G +  VIG +GAGK+TL   +  + TP  G
Sbjct: 1   MIKLEKISKIFDVSGKKLTALDNVSLHVPKGQICGVIGASGAGKSTLIRCVNLLETPSSG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L    L   R+ +G  FQ+  +  + T   N+ +   L    N  K  +
Sbjct: 61  AVIVDGKDLTQLKNADLVHERRHIGMIFQHFNLLTSRTVFGNIALPLELE---NTPKEKI 117

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                        +   EL+  VGL    ++  S +S G  +R+ IARALA++P++L  D
Sbjct: 118 H------------QKVNELLALVGLTDKKDAYPSNLSGGQKQRVAIARALASEPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L+++I  + GIT++L+ H+M++V  I D + V++ GR + +GS 
Sbjct: 166 EATSALDPATTQSILTLLKEINRTLGITILLITHEMEVVKRICDHVAVIDKGRLIEQGSV 225

Query: 236 RDVRDNPE 243
            ++  NP+
Sbjct: 226 SEIFSNPQ 233


>LSRA_PHOTE RecName: Full=Autoinducer 2 import ATP-binding protein
           lsrA;         Short=AI-2 import ATP-binding protein
           lsrA;         EC=3.6.3.-;
          Length = 520

 Score =  110 bits (274), Expect = 2e-26
 Identities = 65/235 (27%), Positives = 118/235 (50%), Gaps = 19/235 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+S +SK F GV+ ++++ F++  G +++++G NGAGK+TL  +I GI  P  G I++
Sbjct: 11  LLEVSGISKQFSGVMVLKHIDFTLLPGQIHALLGGNGAGKSTLMKIIAGIEQPDKGSIKI 70

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  VS L P +  + G+    Q   +  N++  EN+               + R P   
Sbjct: 71  DGNNVSHLNPTKAHQLGIYLIPQEPLLFPNLSVQENI---------------LFRLPK-H 114

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           +AD    +H  EL+   G +  LN+ A +++    + +E+ R L     +L LDEP A  
Sbjct: 115 QADKARMKHLLELL---GCQLDLNANAGSLNVADQQLVEVMRGLIRNSNVLILDEPTASL 171

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            P ET  +   +R++    + ++ + H +  +  ++D++ V+  G     G   D
Sbjct: 172 TPAETERLFTQLRELQQQSVGIIFISHKIPEIHQLADQVSVMRDGGIALSGKTCD 226



 Score = 65.1 bits (157), Expect = 6e-13
 Identities = 48/219 (21%), Positives = 98/219 (44%), Gaps = 30/219 (13%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           +N++ SV  G +  + G  GAG+T L   + G+     GEI+L    ++ L   Q  ++G
Sbjct: 280 RNITLSVKPGEILGLAGVVGAGRTELAETLYGLRPVLSGEIKLKQCPITRLKTVQRLKQG 339

Query: 80  M---------GRTFQNLQICMNMTAI--ENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
           +            F +  +  N+ ++   N     H + D  +V+   +  +++ +    
Sbjct: 340 LVYLPEDRQSSGLFPDSSLSWNICSLTHNNRTFWVHPTYDATVVERYRQALNIKFS---- 395

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
                          ++N     +S G  +++ IA+ L A P +L +DEP  G +     
Sbjct: 396 ---------------HINQPVKTLSGGNQQKILIAKCLEAHPAVLIIDEPTRGVDIAARN 440

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           +I  L+  IA   + ++ +  D+  V+ ++DR+LV++ G
Sbjct: 441 DIYQLIHNIAQQQVAIIFISSDLDEVVQMADRVLVMHQG 479


>Y382_RHIME RecName: Full=Uncharacterized ABC transporter
           ATP-binding protein R00382;
          Length = 270

 Score =  109 bits (273), Expect = 2e-26
 Identities = 73/242 (30%), Positives = 115/242 (47%), Gaps = 15/242 (6%)

Query: 9   LSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVS 68
           L+K++     V  VS  V +G    ++GPNGAGKTT F +ITG+    +G I + G  V+
Sbjct: 39  LTKSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDEGSIEINGNDVT 98

Query: 69  GLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
            +  ++ AR G+G   Q   I   +T  +N+     +  D N+           R ++ L
Sbjct: 99  TMPMYRRARLGVGYLPQEASIFRGLTVEDNIRAVLEVH-DENV----------DRRESKL 147

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
            +   E  +         S A A+S G              P  + LDEP AG +P   A
Sbjct: 148 NDLLGEFSI----THLRKSPAIALSGGXXXXXXXXXXXXTDPTFMLLDEPFAGVDPISVA 203

Query: 189 EIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAY 248
           +I  LVR +   GI V++ +H+++  + + DR  +++ G  LT G A D+  NP+V   Y
Sbjct: 204 DIQALVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVTNPDVRRLY 263

Query: 249 LG 250
           LG
Sbjct: 264 LG 265


>XYLG_THEP3 RecName: Full=Xylose import ATP-binding protein xylG;   
                EC=3.6.3.17;
          Length = 505

 Score =  109 bits (273), Expect = 2e-26
 Identities = 70/250 (28%), Positives = 130/250 (52%), Gaps = 15/250 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYT--PCDGEI 60
           +LE+ +++K F GV A+ NV+F V +G +++++G NGAGK+TL  +++G+Y      G+I
Sbjct: 5   ILEMRNITKEFPGVKALDNVNFKVKRGEIHALVGENGAGKSTLMKILSGVYPYGTYKGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            + GE+          + G+   +Q L +   MT  EN+ +G    +   ++  M  +  
Sbjct: 65  IIDGEVKQFRNIKDSEKSGIAIIYQELTLVKYMTVGENIFLGEE-PVKGGIIDWMKVYSE 123

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
             R   +L+E    +  Y        ++   +  G  + +EIA+AL+ K RIL LDEP +
Sbjct: 124 TYR---LLKELQINVNPY--------TKVMNLGIGHQQMVEIAKALSKKARILILDEPTS 172

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
                ET  + N+++ +  +G+T + + H +  V  I+D I VL  G+ +      +  +
Sbjct: 173 ALTESETEHLLNILKDLKKNGVTCIYISHKLNEVFEIADSITVLRDGKTIMTDKKENFTE 232

Query: 241 NPEVIAAYLG 250
           N +VI+  +G
Sbjct: 233 N-KVISLMVG 241



 Score = 76.6 bits (187), Expect = 2e-16
 Identities = 54/219 (24%), Positives = 109/219 (49%), Gaps = 15/219 (6%)

Query: 15  GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPC-DGEIRLGGELVSGLAPH 73
           G   + NVSF   +G +  + G  GAG+T L   I G +    +GEI L G+ +    P 
Sbjct: 274 GKKIIDNVSFKARRGEILGIAGLMGAGRTELAASIFGAFKGRKEGEIYLNGKKIEINTPS 333

Query: 74  QLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDR-NLVKSMLRFPSLRRADAVLR 129
              + G+    ++ +   +   M   EN+ +  +  L + +++ +  +   ++ A+  ++
Sbjct: 334 DAIKHGIAYLSEDRKRFGLVTLMDVQENIALPNYDRLSKFSIINNNAK---IKHAEKYVK 390

Query: 130 EHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
           E   +          +    + +S G  +++ IA+ L + P++L LDEP  G +     E
Sbjct: 391 ELKIKTPT-------IRQRVANLSGGNQQKVVIAKWLMSDPKVLILDEPTRGIDVGAKFE 443

Query: 190 IDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           I NL+ K+ D G+ V+++  ++  ++ +SDRILV++ G+
Sbjct: 444 IYNLMNKLVDMGVCVIMISSELPEILGMSDRILVIHEGK 482


>RGMG2_AGRT5 RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 2;       
           EC=3.6.3.17;
          Length = 513

 Score =  109 bits (273), Expect = 2e-26
 Identities = 67/240 (27%), Positives = 118/240 (49%), Gaps = 19/240 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL    + K F GV+A+ +V F + +G V++++G NGAGK+TL  ++ GIY P +GEIRL
Sbjct: 23  LLAADGIRKEFPGVVALDDVQFHLKRGTVHALMGENGAGKSTLMKILAGIYQPDNGEIRL 82

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRF---- 118
            G  +   +P      G+    Q L +   MT  EN+ +       R   K+ L F    
Sbjct: 83  KGAPIRLDSPLDALENGIAMIHQELNLMAYMTVAENIWI-------RREPKNRLGFIDHG 135

Query: 119 PSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
              RR + +L          +G++    +    +S  + + +EIA+A++    +L +DEP
Sbjct: 136 EMYRRTETLLER--------LGIDLDPETRVGELSVASRQMVEIAKAVSYNSDVLIMDEP 187

Query: 179 AAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
            +    +E   +  ++R + + GI +V + H M  +  I+D   V   G+ +   ++ DV
Sbjct: 188 TSALTEREVEHLFRIIRDLRERGIGIVYITHKMNELFEIADEFSVFRDGKYIGTHASTDV 247



 Score = 76.6 bits (187), Expect = 2e-16
 Identities = 59/213 (27%), Positives = 105/213 (49%), Gaps = 15/213 (7%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAP-----HQL 75
           +VSF V  G +  V G  G+G++ +   + G+     G I + G+ VS  +P     H++
Sbjct: 290 DVSFDVRAGEILGVAGLVGSGRSNVAETVFGVTPASSGTISIDGKPVSIDSPTTAISHRM 349

Query: 76  ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           A     R      + +N+  +EN+ +   +  D+ +    ++  +L  A     E   +L
Sbjct: 350 AFLTEDRKDTGCLLILNI--LENMQIA--VLQDKYVANGFVQENALSEA---CEEMCRKL 402

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            V      +L      +S G  +++ I R +  KPRIL LDEP  G +    AEI  LV 
Sbjct: 403 RVKT---PHLYERIENLSGGNQQKVLIGRWMLTKPRILILDEPTRGIDVGAKAEIHKLVC 459

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           ++A  G+ V+++  +M  V+ +SDR++V++ GR
Sbjct: 460 EMARQGVAVIMISSEMPEVLGMSDRVMVMHEGR 492


>POTA_GEOKA RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 353

 Score =  109 bits (273), Expect = 2e-26
 Identities = 68/251 (27%), Positives = 124/251 (49%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++    ++K + G + + +VSF++++G  Y+++GP+G GKTT+  LI G   P +G I  
Sbjct: 6   IIRFERVTKEYDGTVVLDDVSFAMERGKFYTLLGPSGCGKTTILRLIAGFIEPTEGTIYF 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ +  + P+   ++ +   FQ+  +  ++   ENV  G             LR   ++
Sbjct: 66  HGKPIQNVPPN---KRQVNTVFQDYALFPHLDVFENVAFG-------------LRVKKMK 109

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            AD  +R+  +E + +V LE Y       MS G  +R+ IARA+  +P +          
Sbjct: 110 EAD--IRQKVSEALRFVNLEGYERRRIQEMSGGQRQRVAIARAIVNEPEVXXXXXXXXXX 167

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
                 E+   +R++    GIT + V HD +  + +SD I VLN G+    G+ +D+ D 
Sbjct: 168 XXXXRTEMQYELRELQRRLGITFIFVTHDQEEALAMSDYIFVLNKGKIQQFGTPKDIYDE 227

Query: 242 P--EVIAAYLG 250
           P    +A ++G
Sbjct: 228 PINRFVADFIG 238


>METN_STRMU RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 354

 Score =  109 bits (273), Expect = 2e-26
 Identities = 77/253 (30%), Positives = 131/253 (51%), Gaps = 27/253 (10%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++  +  TF      + AV+ V+  ++QG +Y ++G +GAGK+TL  +I  + TP  
Sbjct: 4   AIIKLDHIDITFHQKKRTIEAVKGVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQTPTK 63

Query: 58  GEIRLGGELV-----SGLAPHQLARK--GMGRTFQNLQICMNMTAIENVMVGGHLSLDRN 110
           G+I +  +++       L+  +L +K   +G  FQ+  +    TA +NV           
Sbjct: 64  GKITVDQDVIFENGEKRLSSQELRKKRHEIGMIFQHFNLMAQKTARQNVAFA-------- 115

Query: 111 LVKSMLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKP 170
                LR  +L  A         EL+  VGL     +  S +S G  +R+ IARALA  P
Sbjct: 116 -----LRHSNLSAAQK--ESKVTELLELVGLTDRAENYPSQLSGGQKQRVAIARALANDP 168

Query: 171 RILFLDEPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRK 229
           +IL  DE  +  +PK T +I  L++ +    G+TVV++ H+M++V +I +R+ V+  G  
Sbjct: 169 KILISDEATSALDPKTTKQILALLQDLNKKLGLTVVMITHEMQIVKDICNRVAVMQEGSL 228

Query: 230 LTEGSARDVRDNP 242
           + EGS  D+  NP
Sbjct: 229 IEEGSVLDIFSNP 241


>METN_RHORT RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 351

 Score =  109 bits (273), Expect = 2e-26
 Identities = 69/237 (29%), Positives = 120/237 (50%), Gaps = 18/237 (7%)

Query: 10  SKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSG 69
           S  FG +  ++ +   + +  V+ VIG +GAGK+TL   +  +  P  G + +GG  ++ 
Sbjct: 12  SGPFGAIEVLRGIDLEIAKSEVFGVIGRSGAGKSTLVRCLNLLERPTGGRVWVGGRELTS 71

Query: 70  LAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
                L  AR+ +G  FQ+  +  + TA +N+                            
Sbjct: 72  FDERSLRQARRDIGMIFQHFNVLSSRTAADNI---------------AXXXXXXXXXXXX 116

Query: 128 LREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKET 187
           +R   AEL+  VGL     +  + +S G  +R+ IARALA+KP +L  DE  +  +P+ T
Sbjct: 117 IRRRVAELLDLVGLTDKGEAYPAELSGGQKQRVGIARALASKPSVLLCDEATSALDPETT 176

Query: 188 AEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
             I  L++ I    G+T+VL+ H+M ++ +I+DR+ VL++GR + +G   DV  +P+
Sbjct: 177 KSILALLKDINRRLGLTIVLITHEMHVIKDIADRVAVLDHGRVVEQGRVFDVFTDPQ 233


>METN_RALME RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 344

 Score =  109 bits (273), Expect = 2e-26
 Identities = 75/257 (29%), Positives = 134/257 (52%), Gaps = 24/257 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+  LS+ F G    V A+++VS S+  G ++ +IG +GAGK+TL   I  +  P  G
Sbjct: 1   MIELQGLSQRFPGGSGEVHALRDVSLSIASGEIFGIIGRSGAGKSTLVRAINLLNRPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L    L  AR+ +G  FQ+  +  + T  +NV +   L+          
Sbjct: 61  RVIVAGQDLTALDKGALREARREIGMIFQHFNLLSSRTVYDNVALPLELA---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                 ++   +      L+  VGL    +   + +S G  +R+ IARALA+KP++L  D
Sbjct: 111 -----GKSKQEIASTVEPLLELVGLSKLRDRYPAQISGGQKQRVGIARALASKPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+++I  + G+T+V++ H M+++  + DR+ VL  G+ +  G  
Sbjct: 166 EATSALDPETTRAILDLLKQINRELGLTIVMITHQMEVIKQVCDRVAVLEAGQVVESGRV 225

Query: 236 RDV--RDNPEVIAAYLG 250
            DV  R   EV  A +G
Sbjct: 226 IDVFLRPQHEVTRAMIG 242


>METN_CORJK RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 368

 Score =  109 bits (273), Expect = 2e-26
 Identities = 71/233 (30%), Positives = 118/233 (50%), Gaps = 18/233 (7%)

Query: 18  AVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLA- 76
           A+Q+++  +  G +  +IG +GAGK+TL   I G+  P  G+I L G+ +  L   Q+  
Sbjct: 49  ALQDINTQIPAGSIVGIIGYSGAGKSTLVRQINGLDRPTSGQILLDGQDIVPLPESQMRK 108

Query: 77  -RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
            R  +G  FQ   +  +     NV     L             P  +R      E   EL
Sbjct: 109 LRSDIGMIFQQFNLFSSRNVAGNVAYPLRLQ----------GMPKQQR-----EERVKEL 153

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
           + +VGL     +    +S G  +R+ IARALA  P +L  DE  +  +P  T ++  L+R
Sbjct: 154 LEFVGLSDKGKAYPEQLSGGQKQRVGIARALATNPSLLLADEATSALDPSTTRDVLELLR 213

Query: 196 KI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAA 247
           K+  + GIT+V++ H+M++V +I+D ++V+  GR + +GS  +V  NP+   A
Sbjct: 214 KVNRELGITIVVITHEMEVVRSIADSVIVMESGRIVEQGSVYEVFSNPQTKTA 266


>METN3_ERWCT RecName: Full=Methionine import ATP-binding protein
           metN 3;         EC=3.6.3.-;
          Length = 343

 Score =  109 bits (273), Expect = 2e-26
 Identities = 75/248 (30%), Positives = 136/248 (54%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+S+++K F      + A+ +VS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIELSNITKVFQQNGRSITALADVSLHVPTGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G+ ++ L+  QL  AR+ +G  FQ+  +  + T      V G++SL        L
Sbjct: 61  KVLVDGQELTQLSDSQLTRARRQIGMIFQHFNLLSSRT------VFGNISLP-------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
              +  +AD   R +  EL+  VGL    +   + +S G  +R+ IARALA+ P++L  D
Sbjct: 108 ELDNTPKADITKRVN--ELLELVGLADKHDVYPANLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D++ V++ GR + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDQVAVISDGRLIEKDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN2_STAES RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  109 bits (273), Expect = 2e-26
 Identities = 70/252 (27%), Positives = 129/252 (51%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E  +++K F      + A++NVSF +DQ  ++ VIG +GAGK+TL  L+  + T  DG
Sbjct: 1   MIEFKNVNKVFRKKRETIQALKNVSFKIDQHDIFGVIGYSGAGKSTLVRLVNQLETVSDG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  +       L   +K +G  FQ+  +  + +  +NV +   L L +   K   
Sbjct: 61  QVIVDGHEIDTYKEKDLRDIKKDIGMIFQHFNLLNSKSVYKNVAM--PLILSKTNKKE-- 116

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++E   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 117 -----------IKEKVDEMLEFVGLADKKDQFPDELSGGQKQRVAIARALVTHPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T+ I NL+  +  + G+T++++ H+M ++  I  R+ V+  G  +  G+ 
Sbjct: 166 EATSALDPATTSSILNLLSNVNRTFGVTIMMITHEMSVIQKICHRVAVMENGEVIEMGTV 225

Query: 236 RDVRDNPEVIAA 247
           +DV  +P+   A
Sbjct: 226 KDVFSHPQTNTA 237


>METN1_STAEQ RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  109 bits (273), Expect = 2e-26
 Identities = 70/252 (27%), Positives = 129/252 (51%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E  +++K F      + A++NVSF +DQ  ++ VIG +GAGK+TL  L+  + T  DG
Sbjct: 1   MIEFKNVNKVFRKKRETIQALKNVSFKIDQHDIFGVIGYSGAGKSTLVRLVNQLETVSDG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  +       L   +K +G  FQ+  +  + +  +NV +   L L +   K   
Sbjct: 61  QVIVDGHEIDTYKEKDLRDIKKDIGMIFQHFNLLNSKSVYKNVAM--PLILSKTNKKE-- 116

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++E   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 117 -----------IKEKVDEMLEFVGLADKKDQFPDELSGGQKQRVAIARALVTHPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T+ I NL+  +  + G+T++++ H+M ++  I  R+ V+  G  +  G+ 
Sbjct: 166 EATSALDPATTSSILNLLSNVNRTFGVTIMMITHEMSVIQKICHRVAVMENGEVIEMGTV 225

Query: 236 RDVRDNPEVIAA 247
           +DV  +P+   A
Sbjct: 226 KDVFSHPQTNTA 237


>METN1_STAAR RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  109 bits (273), Expect = 2e-26
 Identities = 65/252 (25%), Positives = 136/252 (53%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   +SK+F      + A+++VSF+V++  ++ VIG +GAGK+TL  L+  +    +G
Sbjct: 1   MIEFRQVSKSFHKKKQTIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++  +   +   +K +G  FQ+  +  + T  +NV +   LS          
Sbjct: 61  QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                +++   +++   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 111 -----KKSKTEIKQRVTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  TA I  L++ +  + GIT++++ H+M+++ +I +R+ V+  G+ +  G+ 
Sbjct: 166 EATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGQVVETGTV 225

Query: 236 RDVRDNPEVIAA 247
           ++V  +P+   A
Sbjct: 226 KEVFSHPKTTIA 237


>METN1_SALPA RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 343

 Score =  109 bits (273), Expect = 2e-26
 Identities = 72/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFQQGARTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD    +   
Sbjct: 61  SVMVGGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELDNTPKEE-- 116

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  + +S G  +R+ IARALA+ P++L  D
Sbjct: 117 -----------IKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>CYSA2_SHEON RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA 2;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase 2;
          Length = 354

 Score =  109 bits (273), Expect = 2e-26
 Identities = 67/240 (27%), Positives = 118/240 (49%), Gaps = 15/240 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + I  ++K FG  +AV +V+  +  G + +++GP+G+GKTTL  +I G+     G ++  
Sbjct: 3   IHIQQVNKHFGNFVAVDSVNLEIKTGELTALLGPSGSGKTTLLRIIAGLEQADSGIVKFN 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE    +    ++ +G+G  FQ+  +  +MT  ENV  G             +R    R 
Sbjct: 63  GE---DITTQHVSERGVGFVFQHYALFKHMTVFENVAYG-----------LTVRPRKTRP 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           + A + E    L+  V L+   +   S +S G             +P++L LDEP    +
Sbjct: 109 SKAEIAEKVHSLLKLVQLDWTADRYPSQLSGGXXXXXXXXXXXXVEPKVLLLDEPFGALD 168

Query: 184 PKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            K  AE+   +R++ D   +T V V HD +  + ++D+I+V+N GR   +G+  +V D P
Sbjct: 169 AKVRAELRRWLRRLHDEINVTTVFVTHDQEEALEVADKIVVMNKGRIEQQGTPEEVYDTP 228


>CBIO_METMP RecName: Full=Cobalt import ATP-binding protein cbiO;   
                EC=3.6.3.-;
          Length = 278

 Score =  109 bits (273), Expect = 2e-26
 Identities = 68/247 (27%), Positives = 126/247 (51%), Gaps = 16/247 (6%)

Query: 1   MALLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           MA+LE  DL  ++  G +A+  ++F  ++G + +++GPNGAGK+T F    GI  P +G 
Sbjct: 1   MAILETRDLKYSYPDGTVALNGINFKAEKGEMIAILGPNGAGKSTTFLHFNGILKPSNGS 60

Query: 60  IRLGGELVSGLAPHQL-ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRF 118
           + L GE +       L  RK +G  FQN    +    +E  +  G ++L  +  +     
Sbjct: 61  VILKGEAIKYDNKSLLNVRKTVGIVFQNPDDQLFAPTVEQDVAFGPMNLGLSKEE----- 115

Query: 119 PSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
                    + +   + +  V +E +       +S G  KR+ IA  LA  P I+ LDEP
Sbjct: 116 ---------IEKRVKDSLKAVSMEGFERKPPHHLSGGQKKRIAIAGILAMNPEIIVLDEP 166

Query: 179 AAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
            +G +P   ++I  L+ ++   GIT+++  HD+ +V   ++++ +LN G+ +  G+ R++
Sbjct: 167 TSGLDPMGASQIMKLLYELNRQGITIIISTHDVDLVPIYANKVYLLNEGKIIKGGTPREI 226

Query: 239 RDNPEVI 245
             + E +
Sbjct: 227 FSDSETV 233


>RGMG_PSEF5 RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein;       
           EC=3.6.3.17;
          Length = 515

 Score =  109 bits (272), Expect = 3e-26
 Identities = 71/248 (28%), Positives = 118/248 (47%), Gaps = 12/248 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ ++SK F GV+A+ NV   V  G V +++G NGAGK+TL  +I GIY P  GE+RL
Sbjct: 24  LLEVLNVSKGFPGVVALANVQLRVRPGTVLALMGENGAGKSTLMKIIAGIYQPDSGELRL 83

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V+   P    + G+    Q L +  +M+  EN+ +G        L+          
Sbjct: 84  KGRPVTFATPLAALQAGIAMIHQELNLMPHMSIAENIWIGREQQNRLGLID--------- 134

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                +    A L+  + +E     +   +S    + +EIA+A++    +L +DEP +  
Sbjct: 135 --HREMHRCTAALLARLRIELDPEEQVGNLSIAERQMVEIAKAVSYDSDVLIMDEPTSAI 192

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
             KE A + +++  +   G  +V + H M  V  I+D + V   G  +    A D  D  
Sbjct: 193 TDKEVAHLFSIIADLKAQGKGIVYITHKMNEVFAIADEVAVFRDGAYIGLQRA-DSLDGD 251

Query: 243 EVIAAYLG 250
            +I+  +G
Sbjct: 252 SLISMMVG 259



 Score = 78.6 bits (192), Expect = 6e-17
 Identities = 68/233 (29%), Positives = 115/233 (49%), Gaps = 24/233 (10%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG-EIR 61
           LL++ DL     GV   + VSF +  G +  + G  G+G+T +   + GI TP DG EI 
Sbjct: 277 LLKVRDLR--LDGVF--KGVSFDLHAGEILGIAGLMGSGRTNVAETLFGI-TPSDGGEIV 331

Query: 62  LGGELVSGLAPHQLARKGMG-----RTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           L G+ +    PH+   KG+      R    L  C+++     V V  H +    + +  L
Sbjct: 332 LDGQPLRIGDPHRAIEKGLALLTEDRKLSGLFPCLSVLENMEVAVLPHYAGGGFVQQKAL 391

Query: 117 RFPSLRRADAVLREHAAELMVYV-GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
           R        A+  +   +L V    LE  +++    +S G  ++  +AR L  +PRIL L
Sbjct: 392 R--------ALCEDMCRKLRVKTPSLEQCIDT----LSGGNQQKALLARWLMTQPRILIL 439

Query: 176 DEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           DEP  G +    AEI  L+  +A  G+ V+++  ++  V+ +SDR++V++ G+
Sbjct: 440 DEPTRGIDVGAKAEIYRLIASLAGEGMAVIMISSELPEVLGMSDRVMVMHEGQ 492


>RGMG1_RHIME RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 1;       
           EC=3.6.3.17;
          Length = 501

 Score =  109 bits (272), Expect = 3e-26
 Identities = 74/250 (29%), Positives = 126/250 (50%), Gaps = 20/250 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           L+ +S +SK F GV A++ V F +  G V++++G NGAGK+TL  ++ G   P  G + +
Sbjct: 4   LVSLSGISKNFSGVQALKGVDFDLRAGEVHALVGENGAGKSTLMRVLAGEMKPTSGTVSI 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE +    P   A +G+    Q L +  ++T  EN+ +G            + R  + R
Sbjct: 64  HGETMQHSGPRGAAGRGISVIHQELALAPDLTVAENIFLG-----------RLPRIVNHR 112

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R    LR+ A+E++  +G +      A  ++    + +EIA+AL+ + RI+  DEP A  
Sbjct: 113 R----LRKAASEILERLGFDIDPAIHAGRLTVAHQQVVEIAKALSNRARIIVFDEPTAVL 168

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR--KLTEGSARDVRD 240
              +   +  ++R++   G   V + H +  V ++SDRI V+  G   +  E SA DV  
Sbjct: 169 ANTDAERLLAIIRELRAGGTGAVYISHRLNEVFDLSDRITVMKDGSHVETLETSATDV-- 226

Query: 241 NPEVIAAYLG 250
              VIA  +G
Sbjct: 227 -DAVIARMVG 235



 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 46/212 (21%), Positives = 93/212 (43%), Gaps = 16/212 (7%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM 80
           +VSFSV               +T +  L+ G      G + L G+ +   +P +  R  +
Sbjct: 268 DVSFSVRAXXXXXXXXXXXXXRTEVARLVFGADKMDSGTVELNGKPLHLSSPREAVRARI 327

Query: 81  GRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYVG 140
           G   ++ +        + V++   + ++  L K      S+ R   +      ++ V +G
Sbjct: 328 GLVPEDRKQ-------QGVILDAPIRINTTLAK----IRSISRLGFLDAGKERQVAVALG 376

Query: 141 LEAYLNSEA-----SAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            E  L + +     S++S G  +++ +A+   A   +L LDEP  G +     EI NL+ 
Sbjct: 377 AEMRLKASSVDAPVSSLSGGNQQKVALAKWFHADCDLLILDEPTRGVDVGAKGEIYNLIN 436

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            +A +G  ++++  + + +  I DR+LV+  G
Sbjct: 437 DLAKAGKAILVISSEHQELFGICDRVLVMAEG 468


>RBSA2_RHIL3 RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 512

 Score =  109 bits (272), Expect = 3e-26
 Identities = 73/251 (29%), Positives = 127/251 (50%), Gaps = 16/251 (6%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           A+LE+  +S+ F GV A+ NVS ++  G V ++IG NGAGK+TL  ++TGIY P +GEI 
Sbjct: 20  AILEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTGIYRPNEGEIL 79

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + G+ V+  +       G+    Q   +   +T  EN+ + GH    R           L
Sbjct: 80  VDGQPVTFASAQAAIDAGVTAIHQETVLFDELTVAENIFL-GHAPRTR-----------L 127

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKR--LEIARALAAKPRILFLDEPA 179
           R  D       A+ ++   LE+ ++       +   +R  + IARAL+ + RI+ +DEP 
Sbjct: 128 RTIDWQAMNSRAKALL-TALESNIDPTIRLKDFSIAQRHLVAIARALSIEARIVIMDEPT 186

Query: 180 AGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
           A  + KE  ++  +VR + + G  ++ + H    V  I+D  +V   GR + +G  ++  
Sbjct: 187 AALSRKEIDDLFRIVRGLKEKGKAILFISHKFDEVYEIADDFVVFRDGRAVGQGRLKETP 246

Query: 240 DNPEVIAAYLG 250
            + E++   +G
Sbjct: 247 QD-EIVRMMVG 256



 Score = 75.9 bits (185), Expect = 4e-16
 Identities = 62/246 (25%), Positives = 117/246 (47%), Gaps = 24/246 (9%)

Query: 13  FGG-VLAVQN---------VSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           FGG VL ++N         +SF++ QG +  + G  GAG++ L   + GI  P  G++ L
Sbjct: 270 FGGPVLEIRNYSHRTEFRDISFTLRQGEILGIYGLIGAGRSELSQSLFGITRPLSGKMML 329

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
            G  ++  +P    R G+    +      + + M   +N+ +    SL R   +  LR  
Sbjct: 330 EGREITIHSPQDAIRAGIVYVPEERGRHGLALPMPIFQNMTLP---SLTRTSRRGFLR-- 384

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
                 A+ R++A  L +     A L+     +S G  +++ I + LA  P+++ LDEP 
Sbjct: 385 -AAEEFALARKYAERLDLRA---AALSVPVGTLSGGNQQKVVIGKWLATAPKVIILDEPT 440

Query: 180 AGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
            G +    A +   + ++A  G+++++V  ++  ++ +SDR+LV+  G  L  G      
Sbjct: 441 KGIDIGSKAAVHGFISELAAEGLSIIMVSSELPEIIGMSDRVLVMKEG--LAAGIFERAE 498

Query: 240 DNPEVI 245
            +PE +
Sbjct: 499 LSPEAL 504


>POTA_LEUMM RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 368

 Score =  109 bits (272), Expect = 3e-26
 Identities = 72/252 (28%), Positives = 124/252 (49%), Gaps = 23/252 (9%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++  + +  +FG    + NV   ++ G  Y+++GP+G+GK+T+  LI+G  T   G+I  
Sbjct: 8   IIAFNQVDLSFGDTHVLNNVDLEIEAGKFYTLLGPSGSGKSTILKLISGQLTADSGDISF 67

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V+ +      ++ +   FQN  +  NM   +NV  G                P+L+
Sbjct: 68  EGQRVNDVPAE---KRKVNTVFQNYALFPNMNVFDNVAFG----------------PTLK 108

Query: 123 RADAV-LREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
             +   ++    E++  V L  +++ E   +S G  +R+ IARALA  P +L LDEP + 
Sbjct: 109 GMNKTEIKNKVKEMLNLVKLSDFVDREIDELSGGQQQRVAIARALANDPEVLLLDEPLSA 168

Query: 182 FNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
            + K    +   +R+I    GIT V V HD +  + +SD I V+N G     GS  D+ D
Sbjct: 169 LDYKLRKSMQYELREIQQRLGITFVFVTHDQEEALAMSDWIFVMNDGVIQQNGSPEDIYD 228

Query: 241 NP--EVIAAYLG 250
            P    +A ++G
Sbjct: 229 EPINHFVADFIG 240


>POTA_LACDB RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 362

 Score =  109 bits (272), Expect = 3e-26
 Identities = 69/254 (27%), Positives = 130/254 (51%), Gaps = 22/254 (8%)

Query: 1   MALLEISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           M ++++  ++K +  G +A+++++  ++ G  YS++GP+G+GKTT+  +I G      G+
Sbjct: 1   MEIIKLDHITKQYDDGFVALKDINLELESGKFYSLLGPSGSGKTTILRIIAGFTEASAGK 60

Query: 60  IRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           +   G+ ++ L     +++ +   FQN  +  ++   ENV     L              
Sbjct: 61  VYFDGQDITNL---DASKRHINTVFQNYALFPHLNVYENVAFALKLR------------- 104

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
             +R ++ +RE   + +  V L+ Y N E   +S G  +R+ IARA+  +P++L LDE  
Sbjct: 105 --QRPESEIREKVKDALHTVRLDGYANREIFELSGGQQQRVAIARAIINEPKVLLLDECL 162

Query: 180 AGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +  + +   E+   +R I    GIT + V HD +  + +SD I VLN G     GS  D+
Sbjct: 163 SALDKRLRKEMQFELRAIQKKLGITFIFVTHDQEEALAMSDEIFVLNDGEIKQSGSPVDI 222

Query: 239 RDNP--EVIAAYLG 250
            D P  + +A ++G
Sbjct: 223 YDEPVNDFVARFIG 236


>POTA_LACAC RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 365

 Score =  109 bits (272), Expect = 3e-26
 Identities = 67/254 (26%), Positives = 133/254 (52%), Gaps = 22/254 (8%)

Query: 1   MALLEISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           M ++++  ++K +  G +A+++++ +++ G  YS++GP+G+GK+T+  +I G   P  G+
Sbjct: 1   MDIIKLKHITKRYDDGFIALKDINITIESGKFYSLLGPSGSGKSTILRIIAGFTQPSSGQ 60

Query: 60  IRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           +   G+ ++ L     +++ +   FQN  +  ++   ENV  G  L + +  +       
Sbjct: 61  VFFDGKDITDL---DASKRHINTVFQNYALFPHLNVFENVAFG--LKIKKKPLNE----- 110

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
                   +R    + +  V L+ Y N E S +S G  +R+ IARA+  +P++L LDE  
Sbjct: 111 --------IRPAVKDALHMVRLDGYANREISELSGGQQQRVAIARAIVNEPKVLLLDESL 162

Query: 180 AGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +  + +   ++   +R I    GIT + V HD +  +++SD I VLN G+    GS   +
Sbjct: 163 SALDKRLRKDMQFELRAIQKKLGITFIFVTHDQEEALSMSDEIFVLNDGQIQQSGSPVAI 222

Query: 239 RDNP--EVIAAYLG 250
            D P  + +A ++G
Sbjct: 223 YDEPVNDFVARFIG 236


>MGLA_CLOTE RecName: Full=Galactose/methyl galactoside import
           ATP-binding protein mglA;         EC=3.6.3.17;
          Length = 504

 Score =  109 bits (272), Expect = 3e-26
 Identities = 63/226 (27%), Positives = 116/226 (51%), Gaps = 8/226 (3%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE++ +SK F GV A+  V   V +G V++++G NGAGK+TL   + GIY   DGEI L
Sbjct: 7   ILEMNGISKNFPGVKALDGVDLKVKKGTVHALMGENGAGKSTLMKCLFGIYRSDDGEIVL 66

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
           GG+ V           G+    Q L    + + +ENV +G      R  VK +     + 
Sbjct: 67  GGKKVQFKNAKDALENGISMIHQELHPVPHRSVMENVWLG------RFPVKKVFGLGIVD 120

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                + E   +L+  + +    N+  S +S   ++ LEIA+A++   +I+ +DEP +  
Sbjct: 121 HKK--MYEDTKDLLGKLKMNIDPNTLVSKLSVSQVQGLEIAKAVSYNSKIIVMDEPTSSL 178

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
              E   + N++  + + G+ ++ + H M+ ++ I+D + ++  G+
Sbjct: 179 TENEVTHLFNIISDLKNQGVAIIYISHKMEEILKIADEVTIMRDGK 224



 Score = 45.4 bits (106), Expect = 5e-07
 Identities = 46/211 (21%), Positives = 96/211 (45%), Gaps = 9/211 (4%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           +++SF + +G +  + G  GA +T L   I G+     G+I + G+ V   +P    + G
Sbjct: 278 KDISFELRKGEILGIGGLVGAQRTELVESIFGLRKIETGKIYINGQEVKIKSPINSKKYG 337

Query: 80  MGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSM-LRFP-SLRRADAVLREHAAELMV 137
           +    +  +     T I  V+  G  ++   L K + L+F  + +R    ++    +L +
Sbjct: 338 IALLTEERR----STGIFPVLTVGDNTIIAGLDKYIDLKFVVNQKRGMKDIKNSIEKLNI 393

Query: 138 YVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKI 197
                A   ++   +S G  +++  +R L  +P +L +DEP  G +     EI +++  +
Sbjct: 394 RTPSHA---TQIKNLSGGNQQKVIFSRWLLTEPDVLIMDEPTRGIDVGAKYEIYSIISDL 450

Query: 198 ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
                       +M  ++ +SDRI+++  GR
Sbjct: 451 XXXXXXXXXXXXEMPELIGMSDRIMIMCDGR 481


>METN_XANC5 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 335

 Score =  109 bits (272), Expect = 3e-26
 Identities = 71/231 (30%), Positives = 120/231 (51%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           ++A+  +   +  G V+ +IG +GAGK+TL  LI  +  P  G + +G E V+ L    L
Sbjct: 18  IVALHPLDLRIGPGEVFGIIGHSGAGKSTLIRLINRLEEPSGGRLLIGDEDVTALDGQGL 77

Query: 76  A--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +G  FQ+  +  + T   NV                L      RA+   R   A
Sbjct: 78  RALRRRIGMIFQHFNLLSSRTVAGNVAFP-------------LELAGTPRAEIDAR--VA 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+ + N   + +S G  +R+ IARALA +P+IL  DE  +  +P+ TA +  L
Sbjct: 123 ELLARVGLQEHANKYPAQLSGGQKQRVGIARALATRPQILLCDEATSALDPQTTASVLQL 182

Query: 194 VRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + +I  + G+T+VL+ H+M ++  + DR+ VL+ G+ +  G   +V  +P+
Sbjct: 183 LAQINRELGLTIVLITHEMDVIRRVCDRVAVLDAGKLVETGPVTEVFLHPK 233


>METN_LEGPL RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 341

 Score =  109 bits (272), Expect = 3e-26
 Identities = 71/248 (28%), Positives = 130/248 (52%), Gaps = 20/248 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  L K+F G LA+ +++  + +G V+ VIG +GAGK+TL   I  +  P +GE+ +
Sbjct: 1   MIELCGLKKSFSGKLALNDINLFIQEGEVFGVIGKSGAGKSTLLRCINILEKPDEGEVVI 60

Query: 63  GGELVSGLAPHQ--LARKGMGRTFQNLQICMNMTAIENVMVGGHL-SLDRNLVKSMLRFP 119
            G+ +  L+     LAR  +   FQ+  +  + T  +N+ +   +  +D   +K  +   
Sbjct: 61  DGQNLMSLSRKDLALARHKIAMIFQHFNLLNSKTVFDNIALPMRIQGIDEESIKQKIE-- 118

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
                         EL+  V L    ++  S +S G  +R+ IARAL+  P++L  DE  
Sbjct: 119 --------------ELLPVVELTDKKDAFPSQLSGGQKQRVAIARALSCSPKVLLCDEAT 164

Query: 180 AGFNPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +  +P  T  I +L++KI +  GIT+VL+ H+M +V  I  R+ V+  G+ +   +  ++
Sbjct: 165 SALDPATTDAILSLLKKINELYGITIVLITHEMDVVKRICQRLSVMVDGKIVETTALSNI 224

Query: 239 RDNPEVIA 246
            + PE +A
Sbjct: 225 FNKPESLA 232


>METN1_LACPL RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 355

 Score =  109 bits (272), Expect = 3e-26
 Identities = 73/249 (29%), Positives = 128/249 (51%), Gaps = 22/249 (8%)

Query: 2   ALLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           A++++ D++ TF      V AVQ+V+  +  G +Y +IG +GAGK+TL  +I  + +P  
Sbjct: 4   AIIDLKDIAVTFDDGHQVVHAVQDVNLQIQTGDIYGIIGYSGAGKSTLVRVINLLQSPTT 63

Query: 58  GEIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSM 115
           G++ + G+ +  L+P  L  ARK +G  FQ+  +  + T + NV+   +  L + + K  
Sbjct: 64  GQVVVNGQALQTLSPAALRQARKHVGMIFQHFNLMQSRTVMGNVI---YPLLGQKISKQN 120

Query: 116 LRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                      V            GL  Y  +    +S G  +R+ IARAL   P+IL  
Sbjct: 121 XXXXXXXXXXXV------------GLTDYAQTYPDKLSGGQKQRVAIARALVTDPQILIS 168

Query: 176 DEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
           DE  +  +PK T  I  L++++  + GIT+VL+ H+M+++ +I   + V+  GR +  G 
Sbjct: 169 DEATSALDPKTTTAILELLQRVNRELGITIVLITHEMQVIKSICHHVAVMADGRIIERGP 228

Query: 235 ARDVRDNPE 243
             +V   P+
Sbjct: 229 VAEVFTAPK 237


>METN1_BACLD RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 333

 Score =  109 bits (272), Expect = 3e-26
 Identities = 69/235 (29%), Positives = 118/235 (50%), Gaps = 18/235 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           V A+  +   VD+G +Y VIG +GAGK+TL   +  +  P  G++ +GG  +  L+  ++
Sbjct: 18  VHALNGIDLHVDKGEIYGVIGFSGAGKSTLIRCVNFLEKPTAGKVFVGGRDLMSLSKAEI 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              ++ +G  FQ+  +  + T   NV                L      +AD  +++   
Sbjct: 78  RTVKRKIGMVFQHFNLLNSKTIFANVA-------------EPLALVKTPKAD--IKKKVT 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+ +VGLE         +S G  +R+ IARALA  P +L  DE  +  +P+ T +I  L
Sbjct: 123 ELLRFVGLEDKARDYPDQLSGGQKQRVGIARALATNPEVLLCDEATSALDPQTTGDILKL 182

Query: 194 VRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAA 247
           ++++ +   IT++L+ H+M +   I D++ V+  GR +  GS  DV   PE   A
Sbjct: 183 LKRVNEQYNITILLITHEMNVAKEICDKVAVIEKGRIIESGSVFDVFSAPETETA 237


>WTPC_PYRKO RecName: Full=Molybdate/tungstate import ATP-binding
           protein wtpC;         EC=3.6.3.-;
          Length = 330

 Score =  108 bits (271), Expect = 4e-26
 Identities = 72/235 (30%), Positives = 122/235 (51%), Gaps = 21/235 (8%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           +++V+FSV++G  + ++GP+GAGKT L  +I GI  P  G I L GE ++ L P    ++
Sbjct: 17  LRDVTFSVEKGEHFIILGPSGAGKTVLLEVIAGIIEPDSGRIFLNGEDITDLPPE---KR 73

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
           G+    QN  +  NM+  +N+  G             L+   + +A+  +     EL   
Sbjct: 74  GLAYIPQNYALFPNMSVFDNIAFG-------------LKVRKVPKAE--IGRKVRELSEV 118

Query: 139 VGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE-IDNLVRKI 197
           +G+   L  +   +S G ++R+ IARALA +P +L LDEP A  + +     I+ + R  
Sbjct: 119 LGISHLLKRKPKTLSGGEMQRVAIARALAVEPELLLLDEPFANLDVQTRGRLINEMKRWR 178

Query: 198 ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EVIAAYLG 250
            + G T + V H  +  +++ DR+ V+  GR +  G  R+V   P  E +A +LG
Sbjct: 179 KELGFTALHVTHSFEEAVSLGDRVGVMLNGRLVQVGPVREVFSRPASEEVAKFLG 233


>RGMG3_BURCM RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 3;       
           EC=3.6.3.17;
          Length = 513

 Score =  108 bits (271), Expect = 4e-26
 Identities = 65/226 (28%), Positives = 117/226 (51%), Gaps = 10/226 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           L+E++ +SK F GV A+ +  F +  G V++++G NGAGK+TL  ++ G+Y    GEIR+
Sbjct: 14  LIELTGVSKRFPGVQALDDCRFDLRAGEVHALMGENGAGKSTLMKILAGVYQKDGGEIRM 73

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V    P      G+G   Q L +  +++  +N+ +G          +   RF    
Sbjct: 74  DGRAVEIDDPRAAQALGIGIIHQELNLMNHLSVAQNIFIGR---------EPRGRFGVFV 124

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             D + R+ AA +   + L+    +    ++    + +EIA+AL+   R+L +DEP A  
Sbjct: 125 DEDKLNRD-AAAIFARMRLDLDPRTLVGRLTVAKQQMVEIAKALSFDSRVLIMDEPTAAL 183

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           N  E AE+  ++ ++   G+ +V + H M  +  I+DR+ V+  G+
Sbjct: 184 NNAEIAELFRIIGELRAHGVGIVYISHKMDELRQIADRVTVMRDGK 229



 Score = 68.6 bits (166), Expect = 6e-14
 Identities = 64/237 (27%), Positives = 109/237 (45%), Gaps = 15/237 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           LE+  LS+      A+++V F++ +G +    G  GAG+T +   + G      GEIR+ 
Sbjct: 270 LEVRGLSRG----RAIRDVGFTLRRGEILGFAGLMGAGRTEVARAVFGADPVDAGEIRVH 325

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
           G+ V+   P      G+G   ++ +   + + M    N+     LS  R  V+  L F  
Sbjct: 326 GKTVTIRTPADAVAHGIGYLSEDRKHFGLAVGMDVQNNIA----LSSMRRFVRRGL-FLD 380

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
            R+     + +  +L +     A     A  +S G  +++ IA+ L     ILF DEP  
Sbjct: 381 ARQMRDTAQSYVRQLAIRTPSVA---QPARLLSGGNQQKIVIAKWLLRDCDILFFDEPTR 437

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
           G +    +EI  L+  +A  G  +V++  ++  V+ +S RILV+  GR   E  A D
Sbjct: 438 GIDVGAKSEIYKLLDALAAEGKAIVMISSELPEVLRMSHRILVMCEGRVTGELRAAD 494


>RGMG3_AGRT5 RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 3;       
           EC=3.6.3.17;
          Length = 499

 Score =  108 bits (271), Expect = 4e-26
 Identities = 72/246 (29%), Positives = 124/246 (50%), Gaps = 22/246 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           L +  +SK F GV A+ NV+F+V+ G +++V+G NGAGK+TL  +++G Y P  G   + 
Sbjct: 8   LRMRGISKIFPGVKALSNVNFTVEYGRIHAVVGENGAGKSTLMKILSGSYAPTTGTTEIA 67

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLV--KSMLRFPSL 121
           G  V    P    + G+    Q L +  ++T  EN+ + G +   R LV  ++MLR    
Sbjct: 68  GVEVQMRRPADAQKLGIRMVHQELNLVPDLTVAENIYL-GRMPHRRFLVDRQAMLR---- 122

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
                            +  +A L      +     + +EIA++ +A PRI+ LDEP + 
Sbjct: 123 -----XXXXXXXXXXXXIDPKARLGD----LPISQQQLVEIAKSYSADPRIIVLDEPTSS 173

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
            +  ET  + +++RK+   GI ++ + H +K V++I+D + +L       +GS  D R  
Sbjct: 174 LSEHETTALFSILRKMKSQGIAIIYISHRLKEVLDIADDVTILR------DGSMIDTRPA 227

Query: 242 PEVIAA 247
             + AA
Sbjct: 228 AGITAA 233



 Score = 68.6 bits (166), Expect = 6e-14
 Identities = 54/211 (25%), Positives = 101/211 (47%), Gaps = 12/211 (5%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM 80
           +V F V  G +  + G  GAG+T +   I G+     G I + G+ V+  +P    + G+
Sbjct: 273 DVGFDVRSGEILGLTGLVGAGRTEVAQAIFGLAPLATGRIEINGKAVTIGSPAAAVKAGV 332

Query: 81  GRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMV 137
               ++ +   I  +M+  EN+     L + R L  S L    + R   +  ++  +  +
Sbjct: 333 AYVPEDRKGDGIVPSMSVRENIS----LPVLRRL--SRLGRIGMSRDRGLAAKYTRDFSI 386

Query: 138 YVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKI 197
              +        + +S G  ++  I+R LAA P++L LDEP  G +    AEI  ++ ++
Sbjct: 387 ---VPPDPERRINLLSGGNQQKAIISRWLAAGPKVLILDEPTRGVDVGAKAEIHRIIGEL 443

Query: 198 ADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
              G+ VV++  ++  VM + DR++V+  GR
Sbjct: 444 VAGGMAVVMISSELPEVMGVCDRVVVMRDGR 474


>POTA_LEGPA RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 364

 Score =  108 bits (271), Expect = 4e-26
 Identities = 68/253 (26%), Positives = 129/253 (50%), Gaps = 21/253 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           L+EI  + K++G    + NVS +V+ G   +++GP+G GKTTL  LI+G   P  GEI +
Sbjct: 5   LIEIRQIYKSYGNTPILNNVSLNVNHGEFLTLLGPSGCGKTTLLRLISGFEQPTQGEIFI 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V+ L P    ++ +   FQ+  +  +++  ENV                      +
Sbjct: 65  NGQCVNQLPPQ---KRDVHTVFQSYALFPHLSVFENV---------------AFALRCKK 106

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            ++  ++E   + +  V LE         +S G  +R+ IARA+  +P++L LDEP +  
Sbjct: 107 TSNQEIKERVFDALKLVQLELLAERNVKQLSGGQQQRVAIARAIINRPQVLLLDEPLSSL 166

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + +    + + ++++  +  +T + V HD +  +++SDRI+V N+G     G+ + V + 
Sbjct: 167 DYRLRKAMQSELKQLQKTLNMTFIFVTHDQEEALSMSDRIVVFNHGHIEQIGTPKAVYET 226

Query: 242 PE--VIAAYLGTA 252
           P    +A ++G A
Sbjct: 227 PANLHVAMFIGEA 239


>METN_XANCP RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 335

 Score =  108 bits (271), Expect = 4e-26
 Identities = 71/231 (30%), Positives = 120/231 (51%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           ++A+  +   +  G V+ +IG +GAGK+TL  LI  +  P  G + +G E V+ L    L
Sbjct: 18  IVALHPLDLRIGPGEVFGIIGHSGAGKSTLIRLINRLEEPTGGRLLIGDEDVTALNSTGL 77

Query: 76  A--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +G  FQ+  +  + T   NV                L      RA+   R   A
Sbjct: 78  RALRRRVGMIFQHFNLLSSRTVAGNVAFP-------------LELAGTPRAEIDAR--VA 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGLE +     + +S G  +R+ IARALA +P+IL  DE  +  +P+ TA +  L
Sbjct: 123 ELLARVGLEQHATKYPAQLSGGQKQRVGIARALATRPQILLCDEATSALDPQTTASVLQL 182

Query: 194 VRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + +I  + G+T+VL+ H+M+++  + DR+ VL+ G+ +  G   +V  +P+
Sbjct: 183 LAQINRELGLTIVLITHEMEVIRRVCDRVAVLDAGKLVETGPVTEVFLHPQ 233


>METN_XANC8 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 335

 Score =  108 bits (271), Expect = 4e-26
 Identities = 71/231 (30%), Positives = 120/231 (51%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           ++A+  +   +  G V+ +IG +GAGK+TL  LI  +  P  G + +G E V+ L    L
Sbjct: 18  IVALHPLDLRIGPGEVFGIIGHSGAGKSTLIRLINRLEEPTGGRLLIGDEDVTALNSTGL 77

Query: 76  A--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +G  FQ+  +  + T   NV                L      RA+   R   A
Sbjct: 78  RALRRRVGMIFQHFNLLSSRTVAGNVAFP-------------LELAGTPRAEIDAR--VA 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGLE +     + +S G  +R+ IARALA +P+IL  DE  +  +P+ TA +  L
Sbjct: 123 ELLARVGLEQHATKYPAQLSGGQKQRVGIARALATRPQILLCDEATSALDPQTTASVLQL 182

Query: 194 VRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + +I  + G+T+VL+ H+M+++  + DR+ VL+ G+ +  G   +V  +P+
Sbjct: 183 LAQINRELGLTIVLITHEMEVIRRVCDRVAVLDAGKLVETGPVTEVFLHPQ 233


>METN_XANAC RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 335

 Score =  108 bits (271), Expect = 4e-26
 Identities = 71/231 (30%), Positives = 120/231 (51%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           ++A+  +   +  G V+ +IG +GAGK+TL  LI  +  P  G + +G E V+ L    L
Sbjct: 18  IVALHPLDLRIGPGEVFGIIGHSGAGKSTLIRLINRLEEPSGGRLLIGEEDVTALDRQGL 77

Query: 76  A--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
              R+ +G  FQ+  +  + T   NV                L      RA+   R   A
Sbjct: 78  RALRRRIGMIFQHFNLLSSRTVAGNVAFP-------------LELAGTPRAEIDAR--VA 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGL+ + N   + +S G  +R+ IARALA +P+IL  DE  +  +P+ TA +  L
Sbjct: 123 ELLARVGLQEHANKYPAQLSGGQKQRVGIARALATRPQILLCDEATSALDPQTTASVLQL 182

Query: 194 VRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           + +I  + G+T+VL+ H+M ++  + DR+ VL+ G+ +  G   +V  +P+
Sbjct: 183 LAQINRELGLTIVLITHEMDVIRRVCDRVAVLDAGKLVETGPVTEVFLHPK 233


>METN_LEGPH RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 341

 Score =  108 bits (271), Expect = 4e-26
 Identities = 70/248 (28%), Positives = 130/248 (52%), Gaps = 20/248 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  L K+F G LA+ +++  + +G ++ VIG +GAGK+TL   I  +  P +GE+ +
Sbjct: 1   MIELCGLKKSFSGKLALNDINLFIQEGEIFGVIGKSGAGKSTLLRCINILEKPDEGEVVI 60

Query: 63  GGELVSGLAPHQ--LARKGMGRTFQNLQICMNMTAIENVMVGGHL-SLDRNLVKSMLRFP 119
            G+ +  L+     LAR  +   FQ+  +  + T  +N+ +   +  +D   +K  +   
Sbjct: 61  DGQNLMSLSRKDLALARHKIAMIFQHFNLLNSKTVFDNIALPMRIQGIDEESIKQKIE-- 118

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
                         EL+  V L    ++  S +S G  +R+ IARAL+  P++L  DE  
Sbjct: 119 --------------ELLPVVELTDKKDAFPSQLSGGQKQRVAIARALSCSPKVLLCDEAT 164

Query: 180 AGFNPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +  +P  T  I +L++KI +  GIT+VL+ H+M +V  I  R+ V+  G+ +   +  ++
Sbjct: 165 SALDPATTDAILSLLKKINELYGITIVLITHEMDVVKRICQRLSVMVDGKIVETTALSNI 224

Query: 239 RDNPEVIA 246
            + PE +A
Sbjct: 225 FNKPESLA 232


>METN1_STAAN RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  108 bits (271), Expect = 4e-26
 Identities = 65/252 (25%), Positives = 136/252 (53%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   +SK+F      + A+++VSF+V++  ++ VIG +GAGK+TL  L+  +    +G
Sbjct: 1   MIEFRQVSKSFHKKKQTIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++  +   +   +K +G  FQ+  +  + T  +NV +   LS          
Sbjct: 61  QVIVDGHDITNYSEKGMREIKKDIGMIFQHFNLLNSATVFKNVAMPLILS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                +++   +++   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 111 -----KKSKTEIKQRVTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  TA I  L++ +  + GIT++++ H+M+++ +I +R+ V+  G+ +  G+ 
Sbjct: 166 EATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGQVVETGTV 225

Query: 236 RDVRDNPEVIAA 247
           ++V  +P+   A
Sbjct: 226 KEVFSHPKTTIA 237


>METN1_STAAM RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  108 bits (271), Expect = 4e-26
 Identities = 65/252 (25%), Positives = 136/252 (53%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   +SK+F      + A+++VSF+V++  ++ VIG +GAGK+TL  L+  +    +G
Sbjct: 1   MIEFRQVSKSFHKKKQTIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++  +   +   +K +G  FQ+  +  + T  +NV +   LS          
Sbjct: 61  QVIVDGHDITNYSEKGMREIKKDIGMIFQHFNLLNSATVFKNVAMPLILS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                +++   +++   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 111 -----KKSKTEIKQRVTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  TA I  L++ +  + GIT++++ H+M+++ +I +R+ V+  G+ +  G+ 
Sbjct: 166 EATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGQVVETGTV 225

Query: 236 RDVRDNPEVIAA 247
           ++V  +P+   A
Sbjct: 226 KEVFSHPKTTIA 237


>METN1_PSEAE RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 369

 Score =  108 bits (271), Expect = 4e-26
 Identities = 72/243 (29%), Positives = 127/243 (52%), Gaps = 19/243 (7%)

Query: 4   LEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           + +  L K + GGV A++ +   + +G V+ +IG +GAGK++L   +  +  P +G++ +
Sbjct: 29  IRLHGLGKRYPGGVQALREIDLEIRRGEVFGIIGRSGAGKSSLIRTLNRLERPSEGQVLI 88

Query: 63  GGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
             E + G    +L   R+ +G  FQ+  +    T  +N+ +              LR   
Sbjct: 89  DDEDIGGYDGQRLVALRRRIGMIFQHFNLMSAKTVRQNIALP-------------LRVAG 135

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + RA   + E  A L+  VGLE   ++  + +S G  +R+ IARAL  +P+IL  DE  +
Sbjct: 136 VPRAR--IEERVAGLLQLVGLEEKRDAYPAQLSGGQKQRVGIARALVHQPQILLCDEATS 193

Query: 181 GFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             +P+ T  I  L+R I    G+T+VL+ H+M ++  I DR++VL  GR + +G   +V 
Sbjct: 194 ALDPESTQAILALLRDINRRLGLTIVLITHEMAVIREICDRVVVLECGRIVEQGEVWEVF 253

Query: 240 DNP 242
            +P
Sbjct: 254 GDP 256


>METN1_BACAN RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 346

 Score =  108 bits (271), Expect = 4e-26
 Identities = 72/248 (29%), Positives = 132/248 (53%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ ++SK F    G V A+++ S  V +G V+ +IG +GAGK+TL   +  +  P  G
Sbjct: 1   MIELKNVSKVFTTKKGNVEALKSTSLQVKKGEVFGIIGYSGAGKSTLIRCVNLLEKPTTG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I +  + ++ L+  +LA  R+ +G  FQ   +   +T  EN+ +   L+        + 
Sbjct: 61  NIIVNEQDLTTLSTKELAKARQKIGMIFQGFNLLKTVTVYENIALPLRLA-------GVP 113

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           +    +R +  LR         V L    ++  S +S G  +R+ IARAL+ +P +L  D
Sbjct: 114 KLEIEKRVEKYLR--------IVDLFNRKDAYPSELSGGQKQRVAIARALSHEPEVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+ KI +  GIT++L+ H+M ++  I DR+ V+ +G  +  G+ 
Sbjct: 166 EATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVVESGTV 225

Query: 236 RDVRDNPE 243
           +D+  NP+
Sbjct: 226 KDIFTNPQ 233


>MACB_SYNFM RecName: Full=Macrolide export ATP-binding/permease
           protein macB;         EC=3.6.3.-;
          Length = 715

 Score =  108 bits (271), Expect = 4e-26
 Identities = 79/255 (30%), Positives = 129/255 (50%), Gaps = 24/255 (9%)

Query: 1   MALLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPC 56
           M L+E+ D+ KT+      V  ++ +S  V  G   +++G +G+GKTTL N++  +  P 
Sbjct: 1   MDLIELQDIRKTYRLGEIDVPVLRGISLKVSPGDFVALMGTSGSGKTTLMNILGCLDRPT 60

Query: 57  DGEIRLGGELVSGLAPHQ---LARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVK 113
            G  R  G+ V  L P Q   L  + +G  FQN  +   M+A+ENVM+            
Sbjct: 61  SGHYRFDGQDVVDLTPDQRAALRNRKIGFVFQNFNLLPRMSAVENVMMP----------- 109

Query: 114 SMLRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRIL 173
             L +     +D   RE A  L+  +GL  +L++E S +S G  +R+ IARAL   P +L
Sbjct: 110 --LSYAGGGVSDQNGRERAGALLTRMGLGEHLDNEPSQLSGGQQQRVAIARALINNPSLL 167

Query: 174 FLDEPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE 232
           F DEP    +   + E+  + +++  + G+T++LV HD   V   + RI+ +  G  + E
Sbjct: 168 FADEPTGNLDSATSEEVLRVFQRLNEEEGVTIILVTHD-PSVAQCARRIVRIRDG--VIE 224

Query: 233 GSARDVRDNPEVIAA 247
             +  V D P+V  A
Sbjct: 225 PESGAVGDMPQVSKA 239


>FBPC_PHOLL RecName: Full=Fe(3+) ions import ATP-binding protein
           fbpC;         EC=3.6.3.30;
          Length = 351

 Score =  108 bits (271), Expect = 4e-26
 Identities = 70/252 (27%), Positives = 126/252 (50%), Gaps = 21/252 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ +++K FG    + N+  S+ QG + +++GP+G GKTT+  L+ G+  P  G+I + 
Sbjct: 7   VELKNVTKRFGNNTVIDNLELSIPQGHMVTLLGPSGCGKTTVLRLVAGLEKPSAGKIFID 66

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE V+             R+ Q   ICM     ++  +  H+SL  N+   +     L +
Sbjct: 67  GEDVT------------DRSIQQRDICM---VFQSYALFPHMSLGENIGYGL---KMLGQ 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
             A +RE   E +  V L  + +     +S G  +R+ +ARAL  KP++L  DEP +  +
Sbjct: 109 PKAEIRERVKEALELVDLGGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEPLSNLD 168

Query: 184 PKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
                 +   +R++     IT + V HD      +SD +LV+N G+ +  G+ + +   P
Sbjct: 169 ANLRRSMREKIRELQQQFNITSLYVTHDQSEAFAVSDAVLVMNKGKIMQIGTPQTLYRQP 228

Query: 243 --EVIAAYLGTA 252
             E +A+++G A
Sbjct: 229 ASEFMASFMGDA 240


>BRAG_PSEAE RecName: Full=High-affinity branched-chain amino acid
           transport ATP-binding protein braG;
          Length = 233

 Score =  108 bits (271), Expect = 4e-26
 Identities = 74/248 (29%), Positives = 115/248 (46%), Gaps = 16/248 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L    +S  +G + A+ +VS  V +G + ++IG NGAGK+TL   + G      G IR 
Sbjct: 1   MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRY 60

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE + GL    + RK +    +  ++   +T  EN+ +GG  +   +    M       
Sbjct: 61  EGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQM------- 113

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             D VL        ++  L+      A  MS G  + L I RAL +KP++L LDEP+ G 
Sbjct: 114 --DKVLE-------LFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGL 164

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            P            +   G+TV LVE +    + ++DR  VL  GR +   +   +  NP
Sbjct: 165 APXXXXXXXXXXXXLRREGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNP 224

Query: 243 EVIAAYLG 250
           +V  AYLG
Sbjct: 225 KVRDAYLG 232


>Y133_METTH RecName: Full=Putative ABC transporter ATP-binding
           protein MTH_133;         EC=3.6.3.-;
          Length = 280

 Score =  108 bits (270), Expect = 5e-26
 Identities = 71/250 (28%), Positives = 129/250 (51%), Gaps = 22/250 (8%)

Query: 1   MALLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           M ++E  D+  T+  G  A++ ++F  ++G V +++GPNGAGK+TLF    GI  P  G+
Sbjct: 3   MRIIEAVDIRYTYPDGTEALRGINFHAERGEVVALLGPNGAGKSTLFLHFNGILQPTSGK 62

Query: 60  IRLGGELV----SGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSM 115
           I + GE +    SGL     AR+ +G  FQN    +    ++  +  G L++  +     
Sbjct: 63  IMIDGEELDYSKSGLIK---ARQKVGIVFQNPDDQLFAPRVDEDVAFGPLNMGLS----- 114

Query: 116 LRFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFL 175
                    +  + E   + +  VG+  Y +      S G  KR+ IA  +A KP I+ L
Sbjct: 115 ---------EDEVEERVRDALQKVGMLGYESKPPHHFSGGEKKRVAIAGIIAMKPDIMVL 165

Query: 176 DEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           DEP +G +P+  ++I  L+  + + G+T+++  HD+ +    SDRI +++ G  ++ G+ 
Sbjct: 166 DEPTSGLDPRGASQILRLLHNLNEEGMTIIISTHDVDLAPLYSDRIYIISDGEIISTGAP 225

Query: 236 RDVRDNPEVI 245
            +V  + + I
Sbjct: 226 SEVFSDIDTI 235


>RBSA_VIBCH RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 500

 Score =  108 bits (270), Expect = 5e-26
 Identities = 66/240 (27%), Positives = 117/240 (48%), Gaps = 11/240 (4%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           A+L +S + K F GV A+   S +V  G V +++G NGAGK+TL  ++TGIY+   G I 
Sbjct: 4   AILALSQIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSKDAGSIE 63

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
             G+ VS   P      G+    Q L +   +T  EN+ +G  ++            P  
Sbjct: 64  YQGQPVSFKGPRDSQLAGISIIHQELNLIPQLTIAENIFLGREMT-----------SPFG 112

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           R     +   A +L+  + ++    +    +S G  + +EIA+AL+ + +++ +DEP   
Sbjct: 113 RILWDEMHRKADQLLARLNVKHSAKTLLGELSLGEQQMVEIAKALSFESKVIIMDEPTDA 172

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
               ET  + N++ ++ + G  +V + H +K +  I D I VL  G+ + E    D  ++
Sbjct: 173 LTDTETESLFNVINELREQGCGIVYISHRLKEIFEICDDITVLRDGKFIGECRVCDTNED 232



 Score = 80.5 bits (197), Expect = 1e-17
 Identities = 64/239 (26%), Positives = 112/239 (46%), Gaps = 21/239 (8%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V +VSF++ +G +  V G  GAG+T L  +I G      G I L G  V+ ++P      
Sbjct: 269 VHDVSFTLKKGEILGVSGLMGAGRTELMKVIYGALPSERGVINLNGRTVNPVSPQDGLAN 328

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
           G+    ++ +             G  L L  ++ ++M      + +  V   HA E++  
Sbjct: 329 GIAYISEDRK-------------GDGLVLGLSVKENMSLCALDQLSKGVQIRHADEVIAV 375

Query: 139 VGLEAYLNSEASA-------MSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEID 191
                  N +  +       +S G  +++ IA+ L  KP++L LDEP  G +     EI 
Sbjct: 376 DDFIRLFNIKTPSREQIIGNLSGGNQQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIY 435

Query: 192 NLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYLG 250
            L+ +    G++++LV  +M  V+ +SDRILV++ GR   E  A +  D  +++A  +G
Sbjct: 436 QLINQFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRISGEFMASEA-DQEKLMACAVG 493


>POTA_LEGPH RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 364

 Score =  108 bits (270), Expect = 5e-26
 Identities = 68/253 (26%), Positives = 129/253 (50%), Gaps = 21/253 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           L+EI  + K++G    + NVS +V+ G   +++GP+G GKTTL  LI+G   P  GEI +
Sbjct: 5   LIEIRQIYKSYGNTPILNNVSLNVNHGEFLTLLGPSGCGKTTLLRLISGFEQPTQGEIFI 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V+ L P    ++ +   FQ+  +  +++  ENV                      +
Sbjct: 65  NGQCVNQLPPQ---KRDVHTVFQSYALFPHLSVFENV---------------AFALRCKK 106

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             +  +R+   + +  V LE+        +S G  +R+ IARA+  +P++L LDEP +  
Sbjct: 107 TPNQEIRKRVFDALKLVQLESLAERNVKQLSGGQQQRVAIARAIINRPQVLLLDEPLSSL 166

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + +    + + ++++  +  +T + V HD +  +++SDRI+V N+G     G+ + V + 
Sbjct: 167 DYRLRKAMQSELKQLQKTLNMTFIFVTHDQEEALSMSDRIVVFNHGHIEQIGTPKAVYET 226

Query: 242 PE--VIAAYLGTA 252
           P    +A ++G A
Sbjct: 227 PANLHVAMFIGEA 239


>POTA_CLOPS RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 349

 Score =  108 bits (270), Expect = 5e-26
 Identities = 66/251 (26%), Positives = 120/251 (47%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  ++K++G    + N+S ++ +    +++GP+G GKTT   +I G  T   G++  
Sbjct: 6   IIELKGITKSYGKDTILDNLSLNIKKNEFLTLLGPSGCGKTTTLKIIAGFETADSGQVVF 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
              +++ + P++   + +   FQ   +  +M   EN+  G                    
Sbjct: 66  ENNIINDIPPYE---RQLNTVFQKYALFPHMNVYENIAFG---------------XXXXX 107

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                      E++  V LE Y N +  A+S G  +R+ IARAL  +P++L LDEP    
Sbjct: 108 XXXXXXXXXXXEMLKLVALEGYENRDIEALSGGQQQRVAIARALVNEPKVLLLDEPLGAL 167

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   E+   ++KI    GIT + V HD +  + +SD I+V+N G     GS  D+ + 
Sbjct: 168 DMKLRKEMQIELKKIQQKLGITFIFVTHDQEEALTMSDTIVVMNKGEIQQMGSPEDIYNE 227

Query: 242 P--EVIAAYLG 250
           P    +A ++G
Sbjct: 228 PANSFVAKFIG 238


>MGLA_TREDE RecName: Full=Galactose/methyl galactoside import
           ATP-binding protein mglA;         EC=3.6.3.17;
          Length = 497

 Score =  108 bits (270), Expect = 5e-26
 Identities = 64/248 (25%), Positives = 122/248 (49%), Gaps = 13/248 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LEI +LSK+FG    +  ++ +V QG V  ++G NGAGK+T+   + GIYT  +G I L
Sbjct: 5   VLEIKNLSKSFGKNKVLDGINLTVRQGSVMGLMGENGAGKSTMMKCLFGIYTRDEGAISL 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             + +    P +    G+    Q L +C++ T  +N+ +G +   +  +V  +  F    
Sbjct: 65  LNKSIEFKNPKEALESGVAMVHQELNLCLDRTVTDNLFLGRY-PTNFGIVDEIKMF---- 119

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                  E A+ L   + +     +    MS    + +EIA+A++   +++ LDEP +  
Sbjct: 120 -------ESASSLFSSLNMNVNPKTIMRTMSVSQRQMVEIAKAVSYNAKLIVLDEPTSSL 172

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
             +E  ++ +++R +   G++ + + H M  V  + D + VL  G+ +          N 
Sbjct: 173 TEREVKKLFSIIRALQKKGVSFIYISHKMDEVFEVCDEVAVLRDGKMILSKPVAGTNMN- 231

Query: 243 EVIAAYLG 250
           E+I+A +G
Sbjct: 232 EIISAMVG 239



 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 51/227 (22%), Positives = 103/227 (45%), Gaps = 12/227 (5%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           L+I +L   +  VL  +++SF+V +G +  + G  GAG++ L   + GI T   G I + 
Sbjct: 258 LKIENLKTKYAPVL--EDISFTVRKGEILGLYGLVGAGRSELLEALFGIRTIESGSISIN 315

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
            + +   +  +    G     +  ++        N M G        ++ ++  + ++  
Sbjct: 316 DKYLKFKSSKEAMAHGFALLTEERKL--------NGMFGKDTIEFNTVITNLNNYKTIGV 367

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEA--SAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
                   AA   +       L+++   SA+S G  +++ I + L   P +  +DEP  G
Sbjct: 368 LSKRKIREAANREIETMRTRCLSADQGISALSGGNQQKVIIGKWLERSPDVFLMDEPTRG 427

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            +     EI  L+ K+A  G T+++V  +M  ++ I++RI V++  R
Sbjct: 428 IDVGAKYEIYQLIIKMAKEGKTIIVVSSEMPEILGITNRIAVMSNRR 474


>METN_HAEDU RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 344

 Score =  108 bits (270), Expect = 5e-26
 Identities = 71/247 (28%), Positives = 127/247 (51%), Gaps = 22/247 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ ++ K F      ++A+ NV+  V +G +  VIG +GAGK+TL   +  +  P  G
Sbjct: 1   MIELKNIGKQFEVNGKKIIALDNVNLVVPKGTICGVIGASGAGKSTLIRCVNLLERPTVG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +   FQ+  +  + T  ENV +   LS          
Sbjct: 61  NVIVDGQDLTTLSSQELISARRSIAMIFQHFNLLSSQTVFENVALPLRLS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      + +   EL+  VGL    +   S +S G  +R+ IARALA+ P++L  D
Sbjct: 111 -----NTPTEHITKKVNELLELVGLTERKDVYPSNLSGGQKQRVAIARALASDPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L+++I    G+T++L+ H+M +V  I DR+ V++ G+ +  GS 
Sbjct: 166 EATSALDPVTTQSILQLLKEINKRLGLTILLITHEMDVVKRICDRVAVIDQGKLIETGSV 225

Query: 236 RDVRDNP 242
            ++  NP
Sbjct: 226 SEIFANP 232


>METN_COXBU RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 351

 Score =  108 bits (270), Expect = 5e-26
 Identities = 69/248 (27%), Positives = 129/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ +++KT+    GGVLA+ +++  V  G ++ VIG +GAGK+TL   +  +  P  G
Sbjct: 1   MIELRNVTKTYSAKQGGVLALSDINLRVSAGEMFGVIGKSGAGKSTLIRCVNLLERPDKG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G++++ L+   L  AR  MG  FQ+  +    TA +N+     L           
Sbjct: 61  SVIVDGQVLTTLSSKVLRQARHRMGMVFQHFNLLSARTAYQNIAFPLQL----------- 109

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               L +    +R+    L+    L A +N+  S +S G  +R+ IARAL   P +L  D
Sbjct: 110 ----LGKNPTEIRKVVLPLLELTDLTAKINAYPSQLSGGQKQRVAIARALVTNPTVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L++ I  +  ++++L+ H+M+++  ++DR+ VL+ GR + E   
Sbjct: 166 EMTSALDPETTHSILQLLKNINRELNLSILLITHEMEVIKTVADRVAVLDQGRIVEENDV 225

Query: 236 RDVRDNPE 243
             +   P+
Sbjct: 226 VSLFKRPK 233


>METN2_PSEE4 RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 335

 Score =  108 bits (270), Expect = 5e-26
 Identities = 69/248 (27%), Positives = 132/248 (53%), Gaps = 21/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E  ++ KT+      + A+   S +++ G V+ +IG +GAGK+T+  LI  +  P  G
Sbjct: 1   MIEFQNVHKTYRVDGRDIPALNPTSLTIEDGQVFGLIGHSGAGKSTMLRLINRLEAPSGG 60

Query: 59  EIRLGGELVSGLAPHQLAR--KGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           +I + GE V+    +QL R  + +G  FQ+  +  + T  +NV +             ++
Sbjct: 61  KIIVDGEDVTAFDANQLRRFRQQVGMIFQHFNLLASKTVADNVAL------------PLV 108

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               L R +  + +   EL+  VGL+ +     + +S G  +R+ IARAL+  P+IL  D
Sbjct: 109 LAGELSRGE--IDKRVTELLARVGLQDHARKYPAQLSGGQKQRVGIARALSTNPKILLCD 166

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA +  L+ +I  +  +T+VL+ H+M ++  + DR+ V++ G+ + +G  
Sbjct: 167 EATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAGKIVEQGPV 226

Query: 236 RDVRDNPE 243
            +V  +PE
Sbjct: 227 AEVFLHPE 234


>LSRA_YERPS RecName: Full=Autoinducer 2 import ATP-binding protein
           lsrA;         Short=AI-2 import ATP-binding protein
           lsrA;         EC=3.6.3.-;
          Length = 527

 Score =  108 bits (270), Expect = 5e-26
 Identities = 67/235 (28%), Positives = 116/235 (49%), Gaps = 19/235 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL++  +SK F GV+ ++++ F++  G V++++G NGAGK+TL  +I GI  P  G I +
Sbjct: 11  LLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAGILPPDTGVIEM 70

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+    L P +  + G+    Q   +  N++  EN+               + R P   
Sbjct: 71  NGQPCFNLTPAKAHQLGIYLVPQEPMLFANLSVQENI---------------LFRLPK-H 114

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           +AD   ++  A+L+  +G    L+  A ++     + +EI R L    RIL LDEP A  
Sbjct: 115 QAD---KKKMAQLLKNLGCHLDLSVSAGSLEVADQQLVEIMRGLMRDSRILILDEPTASL 171

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            P ET  + + +R +   G+ VV + H +  +  ++D + V+  G     GS  D
Sbjct: 172 TPAETHRLFSQIRMLLQQGVGVVFISHKLPEIRQLADWVSVMRDGGIALSGSTAD 226



 Score = 65.1 bits (157), Expect = 6e-13
 Identities = 51/210 (24%), Positives = 99/210 (47%), Gaps = 14/210 (6%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM 80
           ++SF V  G +  + G  GAG+T L   + G+     G + L    ++ +        G+
Sbjct: 284 HISFHVQAGEILGLAGVVGAGRTELAETLYGLRPASTGNVILEEVNITAMKTANRLAAGL 343

Query: 81  GRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMV 137
               ++ Q   + ++     NV    H   DR   + +   P+  +  AVL  +   L +
Sbjct: 344 VYLPEDRQASGLYLDAPLSWNVCALAH---DR---QGLWTQPA--QEAAVLERYRRALNI 395

Query: 138 YVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKI 197
                ++L      +S G  ++L IA+ L A P +L +DEP  G +    ++I  L+R I
Sbjct: 396 KF---SHLEQPVRTLSGGNQQKLLIAKCLEANPLLLIIDEPTRGVDVSARSDIYQLIRSI 452

Query: 198 ADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           A+  + ++ +  D++ V+ ++DR+LV++ G
Sbjct: 453 AEQQVAIIFISSDLEEVVQMADRVLVMHQG 482


>LSRA_YERPB RecName: Full=Autoinducer 2 import ATP-binding protein
           lsrA;         Short=AI-2 import ATP-binding protein
           lsrA;         EC=3.6.3.-;
          Length = 527

 Score =  108 bits (270), Expect = 5e-26
 Identities = 67/235 (28%), Positives = 116/235 (49%), Gaps = 19/235 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL++  +SK F GV+ ++++ F++  G V++++G NGAGK+TL  +I GI  P  G I +
Sbjct: 11  LLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAGILPPDTGVIEM 70

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+    L P +  + G+    Q   +  N++  EN+               + R P   
Sbjct: 71  NGQPCFNLTPAKAHQLGIYLVPQEPMLFANLSVQENI---------------LFRLPK-H 114

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           +AD   ++  A+L+  +G    L+  A ++     + +EI R L    RIL LDEP A  
Sbjct: 115 QAD---KKKMAQLLKNLGCHLDLSVSAGSLEVADQQLVEIMRGLMRDSRILILDEPTASL 171

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            P ET  + + +R +   G+ VV + H +  +  ++D + V+  G     GS  D
Sbjct: 172 TPAETHRLFSQIRMLLQQGVGVVFISHKLPEIRQLADWVSVMRDGGIALSGSTAD 226



 Score = 65.1 bits (157), Expect = 6e-13
 Identities = 51/210 (24%), Positives = 99/210 (47%), Gaps = 14/210 (6%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM 80
           ++SF V  G +  + G  GAG+T L   + G+     G + L    ++ +        G+
Sbjct: 284 HISFHVQAGEILGLAGVVGAGRTELAETLYGLRPASTGNVILEEVNITAMKTANRLAAGL 343

Query: 81  GRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMV 137
               ++ Q   + ++     NV    H   DR   + +   P+  +  AVL  +   L +
Sbjct: 344 VYLPEDRQASGLYLDAPLSWNVCALAH---DR---QGLWTQPA--QEAAVLERYRRALNI 395

Query: 138 YVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKI 197
                ++L      +S G  ++L IA+ L A P +L +DEP  G +    ++I  L+R I
Sbjct: 396 KF---SHLEQPVRTLSGGNQQKLLIAKCLEANPLLLIIDEPTRGVDVSARSDIYQLIRSI 452

Query: 198 ADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           A+  + ++ +  D++ V+ ++DR+LV++ G
Sbjct: 453 AEQQVAIIFISSDLEEVVQMADRVLVMHQG 482


>FBPC_FUSNN RecName: Full=Fe(3+) ions import ATP-binding protein
           fbpC;         EC=3.6.3.30;
          Length = 371

 Score =  108 bits (270), Expect = 5e-26
 Identities = 69/250 (27%), Positives = 125/250 (50%), Gaps = 21/250 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           ++I +  K +G  + ++N+S  + QG  ++++GP+G GKTTL  +I G  +   G     
Sbjct: 5   IKIENAQKRYGDNIIIENLSLDIKQGEFFTLLGPSGCGKTTLLRMIAGFNSIEKGNFYFN 64

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
            + ++ L P   A++ +G  FQN  I  ++T  +NV  G     +R + K  ++      
Sbjct: 65  EKRINDLDP---AKRNIGMVFQNYAIFPHLTVEQNVEFG---LKNRKVSKEEMKI----- 113

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
                     + +  + ++ Y +     +S G  +R+ +ARAL  KP +L +DEP +  +
Sbjct: 114 -------EIDKFLKLMQIDEYKDRMPERLSGGQQQRVALARALVIKPDVLLMDEPLSNLD 166

Query: 184 PKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            K   E+   +++I +S GIT V V HD +  M +SDRI V+  G     G  +D+   P
Sbjct: 167 AKLRVEMRTAIKEIQNSIGITTVYVTHDQEEAMAVSDRIAVMKDGEIQHLGQPKDIYQRP 226

Query: 243 E--VIAAYLG 250
               +A ++G
Sbjct: 227 ANLFVATFIG 236


>CYSA_BURCE RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase;
          Length = 264

 Score =  108 bits (270), Expect = 5e-26
 Identities = 74/252 (29%), Positives = 121/252 (48%), Gaps = 17/252 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           + + +L K FG   A+ NVS     G + +++GP+G GKTTL  +I G+     G++ L 
Sbjct: 3   ITVRNLQKRFGDFTALDNVSLDFPPGELVALLGPSGCGKTTLLRVIAGLEHADAGQVVLQ 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G  V+ +       + +G  FQ+  +  +MT  ENV  G  +   R            R 
Sbjct: 63  GLDVASVGARD---RQVGFVFQHYALFRHMTVFENVAFGLRVKPRRE-----------RP 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           ++A +RE   EL+  V L+       S +S G             +P++L LDEP    +
Sbjct: 109 SEAAIREKVHELLKLVQLDWLAQRYPSELSGGXXXXXXXXXXXXVEPKVLLLDEPFGALD 168

Query: 184 PKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            K   E+   +R++ D   I+ + V HD +  + ++DRI+VLN G     GS +DV D+P
Sbjct: 169 AKVRKELRGWLRRLHDDLHISTIFVTHDQEEALEVADRIVVLNRGHVEQVGSPQDVYDHP 228

Query: 243 E--VIAAYLGTA 252
           +   +  +LG A
Sbjct: 229 QSAFVYEFLGAA 240


>UGPC2_AGRT5 RecName: Full=sn-glycerol-3-phosphate import
           ATP-binding protein ugpC 2;         EC=3.6.3.20;
          Length = 373

 Score =  108 bits (269), Expect = 7e-26
 Identities = 73/257 (28%), Positives = 127/257 (49%), Gaps = 23/257 (8%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           MA ++I  + K++G    +  V  S D G    ++GP+G GK+TL  +I G+     GEI
Sbjct: 1   MAQIDIRQVRKSYGKTPTLHGVDLSFDSGEFVVILGPSGCGKSTLLRMIAGLEEITSGEI 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            +GG +V+ L P +   +G    FQN  +  +M+   N+   G+           L+   
Sbjct: 61  AIGGRVVNTLEPRE---RGCAMVFQNYALYPHMSVAANI---GY----------ALKVAG 104

Query: 121 LRRADAVLR-EHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
           + +A+   R E  A++   VGL  YL  + +A+S G  +R+ +ARA+  +P +   DEP 
Sbjct: 105 VPKAERQRRIEETAKI---VGLSDYLERKPAALSGGQRQRVAMARAIIREPAVFLFDEPL 161

Query: 180 AGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +  + K    +   +RK+      T + V HD    M ++DR++V+N G     G   D+
Sbjct: 162 SNLDAKLRVSMRAEIRKLHQRLSATSIFVTHDQVEAMTLADRLVVMNKGNVEQVGHPLDI 221

Query: 239 RDNP--EVIAAYLGTAA 253
              P    +A+++G+ A
Sbjct: 222 YHRPASTFVASFIGSPA 238


>RBSA_STRA1 RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 492

 Score =  108 bits (269), Expect = 7e-26
 Identities = 58/224 (25%), Positives = 114/224 (50%), Gaps = 11/224 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +++ ++SK+FG    ++ +   +  G +++++G NGAGK+TL N++TG++    G I + 
Sbjct: 3   IDMRNISKSFGTNKVLEKIDLELQSGQIHALMGENGAGKSTLMNILTGLFPASTGTIYID 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE  +   P +    G+    Q +     MT +EN+ +G  +     L+   L       
Sbjct: 63  GEERTFSNPQEAEEFGISFIHQEMNTWPEMTVLENLFLGREIKTTFGLLNQKL------- 115

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
               +R+ A E    +G+   L+     +S G  + +EIA++L ++  IL +DEP A   
Sbjct: 116 ----MRQKALEAFKRLGVTIPLDIPIGNLSVGQQQMIEIAKSLLSQLSILVMDEPTAALT 171

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            +ET  +  ++R +   G+ +V + H M+ +  I+D + V+  G
Sbjct: 172 DRETENLFRVIRSLKQEGVGIVYISHRMEEIFKITDFVTVMRDG 215



 Score = 79.0 bits (193), Expect = 4e-17
 Identities = 54/218 (24%), Positives = 111/218 (50%), Gaps = 6/218 (2%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VSF V +G +    G  GAG+T +   I GI     G++++  + ++  +P Q  ++G
Sbjct: 267 EDVSFYVRKGEILGFSGLMGAGRTEVMRTIFGIDKKKSGKVKIDDQEITITSPSQAIKQG 326

Query: 80  MGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYV 139
           +G   +N +   +   I +  +  +++L      S   F   + +   +++    L +  
Sbjct: 327 IGFLTENRK---DEGLILDFNIKDNMTLPSTKDFSKHGFFDEKTSTTFVQQLINRLYIKS 383

Query: 140 GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIAD 199
           G     + E   +S G  +++ +A+ +   P++L LDEP  G +     EI  L+ ++AD
Sbjct: 384 GRP---DLEVGNLSGGNQQKVVLAKWIGIAPKVLILDEPTRGVDVGAKREIYQLMNELAD 440

Query: 200 SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            G+ +V+V  D+  ++ +SDRI+V++ GR   E S ++
Sbjct: 441 RGVPIVMVSSDLPEILGVSDRIMVMHEGRISGELSRKE 478


>NODI_BURPS RecName: Full=Nod factor export ATP-binding protein I;  
                 EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 304

 Score =  108 bits (269), Expect = 7e-26
 Identities = 74/236 (31%), Positives = 113/236 (47%), Gaps = 17/236 (7%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           +A ++   + K +   L V  +SF V  G  + ++GPNGAGKTT   ++ GI  P  G I
Sbjct: 3   VAPIDFQQVEKRYDDKLVVDGLSFHVQPGECFGLLGPNGAGKTTTLKMLLGITHPDAGSI 62

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE V   A H   R G+   F NL    + T  EN++V               R+  
Sbjct: 63  SLCGEPVPSRARHARQRVGVVPQFDNLD--PDFTVRENLLV-------------FARYFG 107

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           L    A  R     L+ +  LE+  +++   +S G  +RL +ARAL   P +L LDEP  
Sbjct: 108 LTAHAA--RALVPPLLEFAKLESKADAKVGELSGGMKRRLTLARALVNDPDVLVLDEPTT 165

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR 236
           G +P+    +   +R +   G T++L  H M+    +  R+ V+  GRK+ EG+ R
Sbjct: 166 GLDPQARHLMWERLRSLLARGKTILLTTHFMEEAERLCHRLCVIEEGRKIAEGAPR 221


>NODI_BURP1 RecName: Full=Nod factor export ATP-binding protein I;  
                 EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 304

 Score =  108 bits (269), Expect = 7e-26
 Identities = 74/236 (31%), Positives = 113/236 (47%), Gaps = 17/236 (7%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           +A ++   + K +   L V  +SF V  G  + ++GPNGAGKTT   ++ GI  P  G I
Sbjct: 3   VAPIDFQQVEKRYDDKLVVDGLSFHVQPGECFGLLGPNGAGKTTTLKMLLGITHPDAGSI 62

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE V   A H   R G+   F NL    + T  EN++V               R+  
Sbjct: 63  SLCGEPVPSRARHARQRVGVVPQFDNLD--PDFTVRENLLV-------------FARYFG 107

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           L    A  R     L+ +  LE+  +++   +S G  +RL +ARAL   P +L LDEP  
Sbjct: 108 LTAHAA--RALVPPLLEFAKLESKADAKVGELSGGMKRRLTLARALVNDPDVLVLDEPTT 165

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR 236
           G +P+    +   +R +   G T++L  H M+    +  R+ V+  GRK+ EG+ R
Sbjct: 166 GLDPQARHLMWERLRSLLARGKTILLTTHFMEEAERLCHRLCVIEEGRKIAEGAPR 221


>NODI_BURMA RecName: Full=Nod factor export ATP-binding protein I;  
                 EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 304

 Score =  108 bits (269), Expect = 7e-26
 Identities = 74/236 (31%), Positives = 113/236 (47%), Gaps = 17/236 (7%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           +A ++   + K +   L V  +SF V  G  + ++GPNGAGKTT   ++ GI  P  G I
Sbjct: 3   VAPIDFQQVEKRYDDKLVVDGLSFHVQPGECFGLLGPNGAGKTTTLKMLLGITHPDAGSI 62

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            L GE V   A H   R G+   F NL    + T  EN++V               R+  
Sbjct: 63  SLCGEPVPSRARHARQRVGVVPQFDNLD--PDFTVRENLLV-------------FARYFG 107

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           L    A  R     L+ +  LE+  +++   +S G  +RL +ARAL   P +L LDEP  
Sbjct: 108 LTAHAA--RALVPPLLEFAKLESKADAKVGELSGGMKRRLTLARALVNDPDVLVLDEPTT 165

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR 236
           G +P+    +   +R +   G T++L  H M+    +  R+ V+  GRK+ EG+ R
Sbjct: 166 GLDPQARHLMWERLRSLLARGKTILLTTHFMEEAERLCHRLCVIEEGRKIAEGAPR 221


>METN_XANOM RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 335

 Score =  108 bits (269), Expect = 7e-26
 Identities = 75/248 (30%), Positives = 130/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   L K++      ++A+  +   +  G V+ +IG +GAGK+TL  LI  +  P  G
Sbjct: 1   MIEFQRLHKSYSVDGRQIVALHPLDLRIGPGEVFGIIGHSGAGKSTLIRLINRLEEPSGG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +G E V+ L    L   R+ +G  FQ+  +  + T      V G+++    LV +  
Sbjct: 61  RLLIGDEDVTALDSQGLRALRRRIGMIFQHFNLLSSRT------VAGNVAFPLELVGTP- 113

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                 RA+   R   AEL+  VGL+   N   + +S G  +R+ IARALA  P+IL  D
Sbjct: 114 ------RAEIDAR--VAELLARVGLQEQANQYPAQLSGGQKQRVGIARALATGPQILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA +  L+ +I  + G+T+VL+ H+M ++  + DR+ VL+ G+ +  G  
Sbjct: 166 EATSALDPQTTASVLQLLAQINRELGLTIVLITHEMDVIRRVCDRVAVLDAGKLVETGPV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 TEVFLHPK 233


>METN_SYNWW RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 345

 Score =  108 bits (269), Expect = 7e-26
 Identities = 75/247 (30%), Positives = 127/247 (51%), Gaps = 22/247 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++EIS+L+K +G     V+A++ VS S+ +G ++ +IG +GAGK+TL   I  +  P  G
Sbjct: 1   MIEISNLTKIYGSGPQEVMALKEVSLSIRKGEIFGIIGLSGAGKSTLIRCINMLERPTQG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I + G+ V  L   +L   R+ +G  FQ+  +  + T  ENVM               L
Sbjct: 61  TIMVDGQDVGSLNSLELRRLRQKIGMIFQHFNLLSSRTVFENVMF-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
              ++ + +A  + +A  L+  VGL          +S G  +R+ IARALA  P++L  D
Sbjct: 108 EIAAVPKNEAAQKVNA--LLELVGLTDKAQVYPEQLSGGQKQRVGIARALANDPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L++ I    G+T+VL+ HDM ++ +  DR+ V++    +  G  
Sbjct: 166 EATSALDPQTTRSILGLLKDINRKLGLTIVLITHDMNVIKDACDRVAVIDDSTIVEVGDV 225

Query: 236 RDVRDNP 242
            +   NP
Sbjct: 226 LNTFSNP 232


>METN1_SALTI RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 343

 Score =  108 bits (269), Expect = 7e-26
 Identities = 72/248 (29%), Positives = 130/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFQQGARTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +GG+ ++ L+   L  AR+ +G  FQ+  +  + T   NV +   L LD    +   
Sbjct: 61  SVMVGGQELTTLSESGLTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELDNTPKEE-- 116

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  + +S G  +R+ IARALA+ P++L  D
Sbjct: 117 -----------IKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN1_RHOPA RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 373

 Score =  108 bits (269), Expect = 7e-26
 Identities = 70/235 (29%), Positives = 124/235 (52%), Gaps = 18/235 (7%)

Query: 11  KTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGL 70
           K+   V+A+ ++S +V +G +  VIG +GAGK+TL  LI G+  P  G + + G  ++ L
Sbjct: 42  KSSAEVVALDDISLTVPKGSILGVIGRSGAGKSTLIRLINGLDKPSSGRVIVNGVEITAL 101

Query: 71  APHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
           +   L  AR+ +G  FQ+  +  + TA  NV +              L      +A+  +
Sbjct: 102 SERDLRTARRSIGMVFQHFNLLSSRTAFGNVAL-------------PLEIAGTPKAE--I 146

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
            +    L+  VGL    +   + +S G  +R+ IARALA +P +L  DE  +  +P+ T 
Sbjct: 147 EKRVLPLLDMVGLADKRDRYPAELSGGQKQRVGIARALATEPSVLLSDEATSALDPETTD 206

Query: 189 EIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
           +I  L+++I  D  +T++ + H+M +V  ++DR+ V+  GR + +G+  DV   P
Sbjct: 207 QILELLKQINRDLHLTILFITHEMAVVKALADRVAVIEGGRIVEDGATFDVFATP 261


>FBPC_BRUAB RecName: Full=Fe(3+) ions import ATP-binding protein
           fbpC;         EC=3.6.3.30;
          Length = 353

 Score =  108 bits (269), Expect = 7e-26
 Identities = 74/248 (29%), Positives = 124/248 (50%), Gaps = 21/248 (8%)

Query: 8   DLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELV 67
           +++K FG   A+ N+S +V+ G + +++GP+G GKTT   L+ G+  P  G I +GG+ V
Sbjct: 13  NVTKKFGNFTALPNLSLTVEPGTLVTLLGPSGCGKTTTLRLLAGLEHPTSGRILIGGKDV 72

Query: 68  SGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           + L  ++   + +   FQ+  +  +MT++ENV  G             L     ++ +A 
Sbjct: 73  TNLPANE---RDVSMVFQSYALFPHMTSLENVAYG-------------LESSGFKKNEA- 115

Query: 128 LREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKET 187
            RE A E +  VGL    +   + +S G  +R+ +ARAL  +P++L LDEP +  +    
Sbjct: 116 -RERAEEGLKLVGLGGMGHRLPAELSGGQQQRVAVARALVLEPQVLLLDEPLSTLDAXXX 174

Query: 188 AEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EV 244
                         G T V V HD    + +SD I+V+  G    +GS RD+ + P    
Sbjct: 175 XXXXXXXXXXQQRLGFTAVYVTHDQDEALAVSDTIIVMKEGGIAQKGSPRDLYEAPASAF 234

Query: 245 IAAYLGTA 252
           IA ++G A
Sbjct: 235 IADFMGEA 242


>FBPC_BRUA2 RecName: Full=Fe(3+) ions import ATP-binding protein
           fbpC;         EC=3.6.3.30;
          Length = 353

 Score =  108 bits (269), Expect = 7e-26
 Identities = 74/248 (29%), Positives = 124/248 (50%), Gaps = 21/248 (8%)

Query: 8   DLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELV 67
           +++K FG   A+ N+S +V+ G + +++GP+G GKTT   L+ G+  P  G I +GG+ V
Sbjct: 13  NVTKKFGNFTALPNLSLTVEPGTLVTLLGPSGCGKTTTLRLLAGLEHPTSGRILIGGKDV 72

Query: 68  SGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           + L  ++   + +   FQ+  +  +MT++ENV  G             L     ++ +A 
Sbjct: 73  TNLPANE---RDVSMVFQSYALFPHMTSLENVAYG-------------LESSGFKKNEA- 115

Query: 128 LREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKET 187
            RE A E +  VGL    +   + +S G  +R+ +ARAL  +P++L LDEP +  +    
Sbjct: 116 -RERAEEGLKLVGLGGMGHRLPAELSGGQQQRVAVARALVLEPQVLLLDEPLSTLDAXXX 174

Query: 188 AEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EV 244
                         G T V V HD    + +SD I+V+  G    +GS RD+ + P    
Sbjct: 175 XXXXXXXXXXQQRLGFTAVYVTHDQDEALAVSDTIIVMKEGGIAQKGSPRDLYEAPASAF 234

Query: 245 IAAYLGTA 252
           IA ++G A
Sbjct: 235 IADFMGEA 242


>UGPC1_RHIL3 RecName: Full=sn-glycerol-3-phosphate import
           ATP-binding protein ugpC 1;         EC=3.6.3.20;
          Length = 369

 Score =  107 bits (268), Expect = 9e-26
 Identities = 73/259 (28%), Positives = 126/259 (48%), Gaps = 27/259 (10%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           MA + I  + K +G    V  V   +  G    ++GP+G GK+TL  +I G+     GEI
Sbjct: 1   MAPISIRGVKKNYGKTPVVHGVDLDIQSGEFIVILGPSGCGKSTLLRMIAGLEEITGGEI 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            + G +V+ L P +   +G    FQN  +  +M+  EN+   G+           L+   
Sbjct: 61  AIDGRVVNQLEPRE---RGCAMVFQNYALYPHMSVAENI---GY----------ALKVAG 104

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           + +A+   +    E+   + LE +L    +A+S G  +R+ + RA+  +P++   DEP +
Sbjct: 105 VSKAER--QRRIGEVAKALSLEPFLERRPAALSGGQRQRVAMGRAMIREPKVFLFDEPLS 162

Query: 181 GFNPK----ETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR 236
             + K      AEI  L R++   G T + V HD    M ++DR++V+N GR    G+  
Sbjct: 163 NLDAKLRIAMRAEIRRLHRRL---GATSIFVTHDQTEAMTLADRLVVMNGGRVEQVGTPE 219

Query: 237 DVRDNP--EVIAAYLGTAA 253
           +V  +P    +A ++GT A
Sbjct: 220 EVYHHPVSRFVAGFVGTPA 238


>RGMG2_RHIEC RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 2;       
           EC=3.6.3.17;
          Length = 513

 Score =  107 bits (268), Expect = 9e-26
 Identities = 66/236 (27%), Positives = 113/236 (47%), Gaps = 11/236 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL    + K F GV+A+ +V F + +  V++++G NGAGK+TL  ++ GIYTP  G+IRL
Sbjct: 23  LLSAEGVRKEFPGVVALDDVQFRLKRASVHALMGENGAGKSTLMKILAGIYTPDKGDIRL 82

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  +   +P      G+    Q L +   MT  EN+ +       R   K+   F    
Sbjct: 83  KGVEIQLKSPLDALENGIAMIHQELNLMPFMTVAENIWI-------RREPKNRFGFID-- 133

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
               V+     EL   + ++   + E   +S    + +EIA+A++    +L +DEP +  
Sbjct: 134 --HGVMHSMTEELFARLNIDIDPDIEVRHLSVANRQMVEIAKAVSYNSDVLIMDEPTSAL 191

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
             +E   +  ++R +   GI +V + H M  +  I+D   V   GR +   ++ DV
Sbjct: 192 TEREVEHLFRIIRDLRSQGIGIVYITHKMNELFEIADEFSVFRDGRYIGTHASTDV 247



 Score = 78.2 bits (191), Expect = 7e-17
 Identities = 59/211 (27%), Positives = 101/211 (47%), Gaps = 11/211 (5%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           +NVSF V  G +  V G  G+G++ +   + G+  P  G + L G+ V+  +P +  R  
Sbjct: 289 RNVSFEVRAGEILGVAGLVGSGRSNVAETLFGVTPPSSGTVELFGKPVTISSPTEAIRHQ 348

Query: 80  MGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELM 136
           M    ++ +     + +  +EN+ +     L    VK    F      +A   + A  L 
Sbjct: 349 MAFLTEDRKDTGCLLILDILENMQIA---VLQDKFVKG--GFVQQGALEATCEDMAKRLR 403

Query: 137 VYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRK 196
           V       L      +S G  +++ I R L   P+IL LDEP  G +    AEI  LV +
Sbjct: 404 VKT---PNLYERVENLSGGNQQKVLIGRWLLTHPKILILDEPTRGIDVGAKAEIHRLVTE 460

Query: 197 IADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           +A +G+ V+++  +M  V+ +SDRI+V++ G
Sbjct: 461 MARNGVAVIMISSEMPEVLGMSDRIMVMHEG 491


>RBSA_SHIDS RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 495

 Score =  107 bits (268), Expect = 9e-26
 Identities = 62/226 (27%), Positives = 119/226 (52%), Gaps = 12/226 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+ +++K FG   A++ V  +V     ++++G NGAGK+TL  ++ G YT   GEI +
Sbjct: 6   VLEMRNIAKAFGKFYALKGVDLTVYPSENHALMGENGAGKSTLMKVLAGAYTATSGEILI 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+             G+   +Q +Q+  N++  EN+ +G  LS              ++
Sbjct: 66  DGKPFHIRTQKDALSAGITLIYQEMQLAPNLSVAENISLGSELS----------HGGLVQ 115

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R + +++  A +++  +G +   + +   ++    +++EIARAL    RIL +DEP A  
Sbjct: 116 RKEMLVQ--AQKVIDRLGAQFNASDKVMTLTIAEQQQVEIARALHRNSRILVMDEPTAAL 173

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           + +ET  +  L+ ++ D G+ ++ + H M  V  +SDR+ VL  G+
Sbjct: 174 SSRETHRLFELIMRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQ 219



 Score = 71.6 bits (174), Expect = 7e-15
 Identities = 57/223 (25%), Positives = 109/223 (48%), Gaps = 18/223 (8%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           VQ  S  V  G +  + G  GAG++ L  LI G+     G I + GE V   +P +    
Sbjct: 271 VQPSSLLVRSGKIVGLAGLVGAGRSELAQLIFGVRKATGGMIEVDGEPVVIHSPREAIDL 330

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           G+G   +N +   + + M A EN+ +    +L+R+           R     + + A +L
Sbjct: 331 GIGFLTENRKEQGLFLEMAAAENITMA---TLERDA----------RWEAQTISDDAIKL 377

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
           +      A +   A  +S G  +++ I+R +A  PRIL LDEP  G +    +EI  ++ 
Sbjct: 378 LNIRVPHAQVR--AGGLSGGNQQKMLISRWVAIGPRILLLDEPTRGVDVGAKSEIYRIMN 435

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           ++A  G+ ++++  ++  ++ +SDR+ V++ G    E + +++
Sbjct: 436 EMARKGVAILMISSELPEIVGMSDRVYVMHEGSIAGELNGKNI 478


>RBSA2_RHIME RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 512

 Score =  107 bits (268), Expect = 9e-26
 Identities = 65/236 (27%), Positives = 114/236 (48%), Gaps = 12/236 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LEI ++SK FG V A+  V F + +G V+++ G NGAGK+TL N+I G+  P +GE+ +
Sbjct: 6   VLEIRNVSKHFGAVKALTAVDFRLARGEVHALCGENGAGKSTLMNVIAGVLQPSEGEVLI 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  V   +P      G+    Q + +C + T  EN+     ++       +++ +  L 
Sbjct: 66  EGAPVKIASPAVAQSLGIALVHQEIALCPDATIAENMF----MAATNRRRSALMNYAQLE 121

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R    +    A + V        + +   +   + + +EIA+AL    R+L  DEP A  
Sbjct: 122 RDAQAVMNRLAPIDV--------SQKVGDLPISSQQLVEIAKALTLDCRVLIFDEPTAAL 173

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
              E   +  ++R +   GI+++ + H M  V ++ DR+ V   GR +      DV
Sbjct: 174 TETEAQVLFGIIRDLKARGISIIYISHRMAEVFSLCDRVTVFRDGRYVATEMVSDV 229



 Score = 74.3 bits (181), Expect = 1e-15
 Identities = 61/231 (26%), Positives = 113/231 (48%), Gaps = 26/231 (11%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELV----------SG 69
           ++VSF +  G +  V G  G+G+T +   I  +     GEIRL  +++          +G
Sbjct: 273 RDVSFELRYGEILGVGGLIGSGRTEIAEGICALRPVTQGEIRLHDKVLRLRRYSDAAKAG 332

Query: 70  LAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLR 129
           +      RKG G  F +L I  N+ A           LD   + S+    S R   A+  
Sbjct: 333 VVYLSEDRKGSG-VFLDLSIAQNIAA-----------LDLKALTSLGLLNS-REERALAE 379

Query: 130 EHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
           +    L V +G    ++   S++S G  +++ IA+ LA  P+++ +DEP  G +    +E
Sbjct: 380 DLTRRLGVRMG---GVDMPVSSLSGGNQQKVAIAKQLAVDPKVILMDEPTRGIDVGAKSE 436

Query: 190 IDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
           I  L+R++A +GI ++++  ++  ++ + DR+LV+  GR   E S  ++ +
Sbjct: 437 IHRLLRELARAGIGILVISSELPELIGLCDRVLVVREGRIAGEVSGNEMTE 487


>RBSA2_BURP1 RecName: Full=Ribose import ATP-binding protein rbsA 2;
                   EC=3.6.3.17;
          Length = 517

 Score =  107 bits (268), Expect = 9e-26
 Identities = 69/226 (30%), Positives = 112/226 (49%), Gaps = 9/226 (3%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIY-TPCDGEIR 61
           LLE+  +SKTF  V A+  VS +V  G V+S++G NGAGK+TL  +++G Y     GEI 
Sbjct: 10  LLEMRGISKTFPAVRALAGVSLTVHPGEVHSLMGENGAGKSTLMKILSGAYQADPGGEIL 69

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + G  +S   P      G+   +Q L +  N++  EN+ V            ++ R    
Sbjct: 70  IDGRPISIDGPLAAREAGVAVIYQELCLAPNLSVAENIHVXXXXXXXXXXXXTIDRAAMA 129

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           R    VL          +G +   N+    +S    + +EIARA+  + RIL +DEP   
Sbjct: 130 RGCQDVLER--------LGADFGPNTLVGTLSIAEQQLVEIARAVHTRARILVMDEPTTP 181

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            + +ET  +  L+R++   G+ ++ + H M  +  +SDR+ VL  G
Sbjct: 182 LSSRETDNLFRLIRQLRAEGLAIIYISHRMAEIYELSDRVSVLRDG 227



 Score = 73.6 bits (179), Expect = 2e-15
 Identities = 57/233 (24%), Positives = 106/233 (45%), Gaps = 13/233 (5%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V+  S  +  G V  + G  GAG+T L  LI G      GE+ L G+  +  +P +    
Sbjct: 281 VRGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRVRGEVTLAGKAFAAHSPREAIDA 340

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           G+    ++ +   + ++M+  EN+    ++S+                        A  +
Sbjct: 341 GLVYLTEDRKRQGLFLDMSVRENI----NISVCXXXXXXXXXXXXXXXXXXXXXIAALSI 396

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            V      + N    A+S G  +++ ++R L  KPR+L LDEP  G +    +EI  ++ 
Sbjct: 397 RV-----PHANVNVGALSGGNQQKVLLSRLLETKPRVLILDEPTRGVDIGAKSEIYRIIN 451

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE-GSARDVRDNPEVIAA 247
           ++A +G+ V+++  ++  ++ ++DR+LV+  GR   E G   D     E I A
Sbjct: 452 ELARAGVGVIVISSELPEIIGVADRVLVMREGRIAGELGGRTDAPITQEAIIA 504


>POTA_HAES1 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 372

 Score =  107 bits (268), Expect = 9e-26
 Identities = 73/251 (29%), Positives = 125/251 (49%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  L+K++               G   +++GP+G GKTT+  LI G     +G I L
Sbjct: 10  IIELRSLTKSYDXXXXXXXXXXXXXXGEFLTILGPSGCGKTTVLRLIAGFEELNEGRIIL 69

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V+ +      R+ +   FQ+  +  +MT  ENV  G             LR   + 
Sbjct: 70  DGEDVTDIPAE---RRHINTVFQSYALFPHMTIFENVAFG-------------LRMQKVP 113

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            AD  ++    E +  V LE   + + + +S G  +R+ IARA+  KP++L LDE  +  
Sbjct: 114 NAD--IKPRVMEALRMVRLEEMADRKPTQLSGGQQQRVAIARAVVNKPKVLLLDESLSAL 171

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   E+ N ++ +    GIT + V HD +  + +SDRI+V+N G    +GS RD+ ++
Sbjct: 172 DYKLRKEMQNELKALQRQLGITFIFVTHDQEEALTMSDRIIVMNKGTIQQDGSPRDIYED 231

Query: 242 PE--VIAAYLG 250
           P+   +A ++G
Sbjct: 232 PKNLFVAKFIG 242


>PHNC_LACPL RecName: Full=Phosphonates import ATP-binding protein
           phnC;         EC=3.6.3.28;
          Length = 256

 Score =  107 bits (268), Expect = 9e-26
 Identities = 74/242 (30%), Positives = 129/242 (53%), Gaps = 11/242 (4%)

Query: 3   LLEISDLSKTFGGVL-AVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L++  L KT+G    +++ V+F+   G V ++IGP+GAGKTT+   I  +     G+I 
Sbjct: 1   MLKVIQLDKTYGSNKHSLKAVNFTAKPGEVTAIIGPSGAGKTTILRSINQLIRDDSGQIL 60

Query: 62  LGGELV--SGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           L    +  +  A  +  R  +G  FQN  +   +TA+ENV+  G L   ++ V  ML   
Sbjct: 61  LDDTDIRQANKAELRKVRHHIGMIFQNYNLISPLTALENVL-HGRLGA-KSTVAGMLGLY 118

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
           S     +  ++ A +L+  VGL+ Y       +S G  +R+ IARAL   P+++  DEP 
Sbjct: 119 S-----SAEKQEALQLLDEVGLKEYAYQRCDQLSGGQQQRVGIARALMQHPKMILCDEPI 173

Query: 180 AGFNPKETAEIDNLVRKIADSGITVVLVE-HDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           A  +PK T  + +++R++A     ++L+  H + + M  +D I+ +N G  + EG+  +V
Sbjct: 174 ASLDPKSTTIVMDILRRLAKEKQLIILINLHQVDIAMAYTDHIVGINSGAIVFEGATNEV 233

Query: 239 RD 240
            D
Sbjct: 234 DD 235


>METN_SHISS RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  107 bits (268), Expect = 9e-26
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K   
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELD-NTPKD-- 115

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 116 ----------EIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN_SHIDS RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  107 bits (268), Expect = 9e-26
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K   
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELD-NTPKD-- 115

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 116 ----------EIKRRVTELLSMVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN_SHIBS RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  107 bits (268), Expect = 9e-26
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRIIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K   
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELD-NTPKD-- 115

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 116 ----------EIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN_ECOUT RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  107 bits (268), Expect = 9e-26
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K   
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELD-NTPKD-- 115

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 116 ----------EIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN_ECOL6 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  107 bits (268), Expect = 9e-26
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K   
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELD-NTPKD-- 115

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 116 ----------EIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN_ECOL5 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  107 bits (268), Expect = 9e-26
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K   
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELD-NTPKD-- 115

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 116 ----------EIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN_ECO57 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  107 bits (268), Expect = 9e-26
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K   
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELD-NTPKD-- 115

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 116 ----------EIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN2_YERPS RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 343

 Score =  107 bits (268), Expect = 9e-26
 Identities = 71/248 (28%), Positives = 132/248 (53%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           +++++ +SK F      + A+ +VS  V  G +Y VIG +GAGK+TL      +  P  G
Sbjct: 1   MIKLTHISKVFQQGSRTITALSDVSLHVPAGQIYGVIGASGAGKSTLIRCANMLERPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G+ ++ L+  QL  AR+ +G  FQ+  +  + T   N+ +              L
Sbjct: 61  QVLVDGQDLTTLSEGQLTRARRQIGMIFQHFNLLSSRTVYGNIAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
              +  RAD  +++   EL+  VGL    ++  + +S G  +R+ IARALA+ P++L  D
Sbjct: 108 ELDNTSRAD--IKKRVNELLDLVGLTDKQDAYPANLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D++ V++ G+ + + S 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDQVAVISEGKLIEKDSV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN2_SALPA RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 338

 Score =  107 bits (268), Expect = 9e-26
 Identities = 71/229 (31%), Positives = 116/229 (50%), Gaps = 18/229 (7%)

Query: 18  AVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL-- 75
           AV NVS  +  G ++ ++G +GAGK+TL   +  +  P  G + + G  +S L    L  
Sbjct: 21  AVDNVSLHIAAGEIFGIVGTSGAGKSTLLRTLNALTRPSQGRVNVNGVEISALDGKALRQ 80

Query: 76  ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           AR+ +G  FQ+  +    T  +NV                L+     R+    R   AE+
Sbjct: 81  ARQRIGMIFQHFNLMHTRTVAQNVAFS-------------LKAAGWERSKIAPR--VAEI 125

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
           +  VGL    N     +S G  +R+ IARA+A  P +L  DEP +  + + +A I  L+R
Sbjct: 126 LTLVGLADKANRFPVQLSGGQKQRVGIARAIANHPDVLLCDEPTSALDLETSATILALLR 185

Query: 196 KI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           +I A  GIT+VL+ H+M ++ +I DR+ V++ G+ +  G   DV  +P+
Sbjct: 186 QINAQLGITIVLITHEMNVIKSICDRVAVMSGGKVVESGEVFDVFAHPQ 234


>METN2_BACHK RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  107 bits (268), Expect = 9e-26
 Identities = 71/235 (30%), Positives = 118/235 (50%), Gaps = 22/235 (9%)

Query: 14  GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPH 73
           G V AV N +  +D+G ++ VIG +GAGK++L  L   +  P  G+I +   ++S +   
Sbjct: 16  GDVTAVDNANLKIDKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISAITGS 75

Query: 74  QL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP-SLRRAD-AVLR 129
           +L  AR+ +G  FQ+  +  + T  EN+                  FP  +   D A  R
Sbjct: 76  ELRKARQEIGMIFQHFNLLWSRTVRENI-----------------EFPLEIAGVDKAARR 118

Query: 130 EHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
           +   EL+  VGLE   ++  S +S G  +R+ IARALA  P++L  DE  +  +P+ T +
Sbjct: 119 KRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQ 178

Query: 190 IDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
                       G+T+VL+ H+M ++  I +R+ V+  G+ +  G   DV  NP+
Sbjct: 179 XXXXXXXXNKRLGLTIVLITHEMHVIRKICNRVAVMEKGKIVETGPVLDVFRNPQ 233


>METN1_STAAB RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 341

 Score =  107 bits (268), Expect = 9e-26
 Identities = 64/252 (25%), Positives = 135/252 (53%), Gaps = 22/252 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   +SK+F      + A+++VSF+V++  ++ VIG +GAGK+TL  L+  +    +G
Sbjct: 1   MIEFRQVSKSFHKKKQTIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ +    ++  +   +   +K +G  FQ+  +  + T  +NV +   LS          
Sbjct: 61  QVIVDAHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILS---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                +++   +++   E++ +VGL    +     +S G  +R+ IARAL   P+IL  D
Sbjct: 111 -----KKSKTEIKQRVTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  TA I  L++ +  + GIT++++ H+M+++ +I +R+ V+  G+ +  G+ 
Sbjct: 166 EATSALDPSTTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGQVVETGTV 225

Query: 236 RDVRDNPEVIAA 247
           ++V  +P+   A
Sbjct: 226 KEVFSHPKTTIA 237


>METN1_RHOSR RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 338

 Score =  107 bits (268), Expect = 9e-26
 Identities = 78/247 (31%), Positives = 123/247 (49%), Gaps = 22/247 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+  ++K FG     V  + ++ FSV  G + +VIG +GAGKTTL  +I+ +  P +G
Sbjct: 1   MIEVRSVTKRFGKGSRSVEVLHDIDFSVGTGQIAAVIGQSGAGKTTLSRIISLLERPSEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I L G  VSGL+  +L   R+ +G  FQ   +    TA ENV +              L
Sbjct: 61  RILLDGTDVSGLSERRLRDQRRAIGTIFQASSLLARRTAAENVAL-------------PL 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
            F  + R++   R   AEL+  VGL    +     +S G  +R+ IAR+LA  P++L  D
Sbjct: 108 EFAGVGRSER--RARVAELLGRVGLSDKADLYPRQLSGGQRQRVGIARSLALAPKVLVSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +G +P  T  I  L+R++ D  G+T+VL+ H+M               GR +  G  
Sbjct: 166 EATSGLDPNTTRSILALLRELRDDLGLTIVLITHEMXXXXXXXXXXXXXXAGRVVESGPV 225

Query: 236 RDVRDNP 242
            ++  +P
Sbjct: 226 IELLRDP 232


>METN1_BACCZ RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 346

 Score =  107 bits (268), Expect = 9e-26
 Identities = 71/248 (28%), Positives = 132/248 (53%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ ++SK F    G V A+++ S  V +G V+ +IG +GAGK+TL   +  +  P  G
Sbjct: 1   MIELKNVSKVFTTKKGNVEALKSTSLQVKKGEVFGIIGYSGAGKSTLIRCVNLLEKPTTG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I +  + ++ L+  +LA  R+ +G  FQ   +   +T  EN+ +   L+        + 
Sbjct: 61  NIIVNEQDLTTLSTKELAKARQKIGMIFQGFNLLKTVTVYENIALPLRLA-------GVP 113

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           +    +R +  LR         V L    ++  S +S G  +R+ IARAL+ +P +L  D
Sbjct: 114 KLEIEKRVEKYLR--------IVDLFNRKDAYPSELSGGQKQRVAIARALSHEPEVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+ KI +  GIT++L+ H+M ++  I DR+ V+ +G  +  G+ 
Sbjct: 166 EATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVIESGTV 225

Query: 236 RDVRDNPE 243
           +++  NP+
Sbjct: 226 KEIFTNPQ 233


>CBIO_METJA RecName: Full=Putative cobalt import ATP-binding protein
           cbiO;         EC=3.6.3.-;
          Length = 279

 Score =  107 bits (268), Expect = 9e-26
 Identities = 72/247 (29%), Positives = 127/247 (51%), Gaps = 16/247 (6%)

Query: 1   MALLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           M ++E  DL   +  G   ++ ++F V +G + S++GPNGAGK+TLF    GI  P  GE
Sbjct: 1   MYIVETKDLYFRYPDGTAVLKGINFKVKKGEMVSLLGPNGAGKSTLFLHFNGILRPTKGE 60

Query: 60  IRLGGELVSGLAPHQL-ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRF 118
           + + G+ +       +  RK +G  FQN    +    ++  +  G L+L           
Sbjct: 61  VLIKGKPIKYDKKSLVEVRKTVGLVFQNPDDQIFAPTVKEDVAFGPLNL----------- 109

Query: 119 PSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
             L + +  + +   E +  VG+E + N     +S G  KR+ IA  LA +P ++ LDEP
Sbjct: 110 -GLPKEE--VEKRVKEALKAVGMEGFENKPPHHLSGGQKKRVAIAGILAMQPEVIVLDEP 166

Query: 179 AAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
            AG +P   ++I  L+  +   G+T+++  HD+ +V   +D++ V+  G+ L EG+ ++V
Sbjct: 167 TAGLDPVGASKIMKLLYDLNKKGMTIIISTHDVDLVPVYADKVYVMYDGKILKEGTPKEV 226

Query: 239 RDNPEVI 245
             + E I
Sbjct: 227 FSDVETI 233


>RBSA_THETN RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 496

 Score =  107 bits (267), Expect = 1e-25
 Identities = 61/236 (25%), Positives = 122/236 (51%), Gaps = 11/236 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L++  +SK FG V  + NV  ++ +G V +++G NGAGK+TL  ++ GIY   +G I L
Sbjct: 4   ILQMKGISKKFGNVKVLDNVDLTLYRGRVLALLGENGAGKSTLMKILCGIYEKDEGSIYL 63

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V+        + G+    Q L +  +++  EN+ +G      R  V++       +
Sbjct: 64  KGKKVNIRNVRDAEKYGIAMIHQELNLVPSLSVAENIFLG------REYVRTFNSIDWKK 117

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                +++ +A+++  +G++  ++     +S G  + +EIAR+L     IL +DEP A  
Sbjct: 118 -----IKQESAKILHELGMDLNVDRLVKHLSVGEQQMVEIARSLLMNAEILVMDEPTAAL 172

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
              ET  +  +++++   G +++ + H M  +  I D  +VL  G  +++G   +V
Sbjct: 173 TEGETRRLFEVIKRLRKEGKSIIYISHRMNEIFEICDDYIVLRDGCLISQGEISEV 228



 Score = 84.0 bits (206), Expect = 1e-18
 Identities = 63/245 (25%), Positives = 110/245 (44%), Gaps = 33/245 (13%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           + VSF V +G V    G  GAG+T +   I G Y    G+I LGGE V   +P     KG
Sbjct: 270 EKVSFVVKKGEVVGFAGLIGAGRTEVAKTIFGFYKKTSGKIYLGGEEVKINSPRDAIEKG 329

Query: 80  ---MGRTFQNLQICMNMTAIENVMVGG-----------HLSLDRNLVKSMLRFPSLRRAD 125
              +    +N  + +  T  EN+ +             + S +R++V  M++  +++   
Sbjct: 330 IMYLSEDRRNEGLIIKHTLKENMTLSALKKISDYIGTINFSKERSIVNEMIQKLNIKSFS 389

Query: 126 AVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPK 185
                               N +   +S G  +++ IA+ L   P+++ LDEP  G +  
Sbjct: 390 P-------------------NQKIFRLSGGNQQKVAIAKCLLTNPKLIILDEPTRGIDVG 430

Query: 186 ETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVI 245
              EI  L+  +   GI ++L+  ++  V+NISDRI+V++ G+   E S  +  +   ++
Sbjct: 431 AKNEIYKLINDLKRQGIGIILISSELPEVLNISDRIIVMHEGKITGEISREEATEEKVML 490

Query: 246 AAYLG 250
            A  G
Sbjct: 491 KAVGG 495


>POTA_LISW6 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 366

 Score =  107 bits (267), Expect = 1e-25
 Identities = 68/235 (28%), Positives = 117/235 (49%), Gaps = 21/235 (8%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           + NVSF +++G  Y+++GP+G GKTT+  LI G     +G+I LG ++++ +  +   ++
Sbjct: 24  LDNVSFEIEKGKFYTLLGPSGCGKTTILRLIAGFLEASEGQIYLGDKVINQIPAN---KR 80

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
            +   FQ+  +  ++   ENV  G  +              +LR               +
Sbjct: 81  PVNTVFQDYALFPHLNVYENVAFGLRIXXXXXXXXXXXVQEALR---------------F 125

Query: 139 VGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIA 198
           V L+ Y   E S MS G  +R+ IARA+  +P ++ LDEP +  + K   E+   +R + 
Sbjct: 126 VNLKGYEKREISEMSGGQRQRVAIARAIVNEPEVILLDEPLSALDLKLRTEMQYELRDLQ 185

Query: 199 DS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EVIAAYLG 250
              GIT + V HD +  + +SD I VLN G     G+  D+ D P  + +A ++G
Sbjct: 186 KRLGITFIFVTHDQEEALAMSDEIFVLNKGEIQQSGTPIDIYDEPINKFVADFIG 240


>PHNC1_RHOPB RecName: Full=Phosphonates import ATP-binding protein
           phnC 1;         EC=3.6.3.28;
          Length = 272

 Score =  107 bits (267), Expect = 1e-25
 Identities = 76/254 (29%), Positives = 132/254 (51%), Gaps = 17/254 (6%)

Query: 3   LLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L I  L+KT+  G  A++ VS SV  G +  +IGP+GAGK+TL   +  +  P  G ++
Sbjct: 1   MLRIQALTKTYKNGEAALRGVSLSVGAGEIIGLIGPSGAGKSTLIRCVNRLIEPSSGRVQ 60

Query: 62  LGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVG--GHLSLDRNLVKSMLR 117
           LG   ++GL+   L   R+ +G  FQ   +   +T +ENV+ G  G+     +  +    
Sbjct: 61  LGEVELTGLSSGALRRERRRIGMIFQEYALIERLTVMENVLAGRLGYTGFWNSWFRRFAE 120

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
              ++RA A+L          VGL  +++  A A+S G  +R+ IARAL  +P +L +DE
Sbjct: 121 -QDIQRAIALLER--------VGLIDHIDKRADALSGGQRQRVGIARALIQQPELLLVDE 171

Query: 178 PAAGFNPKETAEIDNLVRKIA-DSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSAR 236
           P A  +PK +  +  L+ ++  ++ +  ++  HD+ +      RI+ LN G  + +G A 
Sbjct: 172 PTASLDPKTSRSVMRLLTELCIENRLAAIVNIHDVVLAQAFLPRIVGLNAGIVVYDGPAS 231

Query: 237 DVRDNPEVIAAYLG 250
            +    EV+ +  G
Sbjct: 232 GL--TAEVLTSIYG 243


>MGLA1_PHOPR RecName: Full=Galactose/methyl galactoside import
           ATP-binding protein mglA 1;         EC=3.6.3.17;
          Length = 497

 Score =  107 bits (267), Expect = 1e-25
 Identities = 68/248 (27%), Positives = 124/248 (50%), Gaps = 11/248 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+  ++KTF GV A+ NV  ++ +G V +++G NGAGK+TL  ++ GIY    G IR 
Sbjct: 5   LLEMRGITKTFPGVKALDNVQLTLKKGRVMALMGENGAGKSTLMKVLFGIYQRDCGTIRY 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V+     +    G+    Q L   ++ +  EN+ +G      R  +K  LR     
Sbjct: 65  QGEQVNYSGAKEALEAGVSMIHQELSPILHRSIAENIWLG------REPLKGPLRLID-- 116

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
              A +     EL+  + L     +  S ++   ++ +EI++A++   +I+ +DEP +  
Sbjct: 117 --HAKMYRDTTELLKKLDLHLDPRTPMSELTVATMQMIEISKAISYNSKIIIMDEPTSAL 174

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
             KE   +  ++ K+   G+++V + H M  +  I D I V   G  + E  A++  ++ 
Sbjct: 175 TGKEVDHLFEIIEKLKKQGVSIVYISHKMDEIFRICDDITVFRDGCYIGEREAQNT-NHD 233

Query: 243 EVIAAYLG 250
           E++   +G
Sbjct: 234 ELVQMMVG 241



 Score = 78.6 bits (192), Expect = 6e-17
 Identities = 67/228 (29%), Positives = 116/228 (50%), Gaps = 20/228 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           LE+ +LS    GV    N+SF + +G +  + G  GAG+T L   + G+     GEI + 
Sbjct: 260 LEVKNLSVE--GVF--DNISFKLHEGEILGIAGLVGAGRTELIETLFGVRKHDVGEIWIN 315

Query: 64  GELVSGLAP-----HQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRF 118
           GE V    P     H++A     R    L + +++ A  ++    HL   RN V ++L  
Sbjct: 316 GENVEIKTPQDAISHKMAFLTEDRRQSGLYLMLDIFANTSI---AHLDAYRNKVVNVLDV 372

Query: 119 PSLRRADAVLREHAAELMVYV-GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
            S+++  A       +L V   G+   +++    +S G  +++ +AR +  KP ILFLDE
Sbjct: 373 RSMQKDCA---SQCTKLKVKTPGMAEKIDN----LSGGNQQKVLLARWMLTKPDILFLDE 425

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLN 225
           P  G +    +EI  L+R +   G ++V++  ++  V+ +SDRILV++
Sbjct: 426 PTRGIDIGAKSEIYKLMRLLTGMGKSLVMISSELPEVIGMSDRILVMH 473


>METN_ECOLI RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  107 bits (267), Expect = 1e-25
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K   
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL--PLELD-NTPKD-- 115

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                      ++    EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 116 ----------EVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN_DESHY RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 340

 Score =  107 bits (267), Expect = 1e-25
 Identities = 68/248 (27%), Positives = 128/248 (51%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ I +L+K +      V+A++++S  + +G +Y +IG +GAGK+TL   I  +  P  G
Sbjct: 1   MIRIENLTKIYTSRKEQVVAIEDISLDIPKGAIYGIIGLSGAGKSTLVRCINRLEEPTGG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           +I + G+ ++ ++  +L  AR+ +G  FQ+  +  + T  +N+                L
Sbjct: 61  KIIIDGQDLTAMSAVELRQARQKIGMIFQHFHLLQSRTVFDNIAFP-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                ++ +   R    EL+  VGLE   +   S +S G  +R+ IARALA  P++L  D
Sbjct: 108 EIAGFKKPEIEAR--VKELLPLVGLEDKAHVYPSQLSGGQKQRVGIARALATNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I NL++ I    G+T++++ H+MK+V  I   + V++  +   +G  
Sbjct: 166 EATSALDPQTTLSILNLLKDINQRFGLTIIMITHEMKVVKEICTDVAVIHESKIAEQGPV 225

Query: 236 RDVRDNPE 243
             V   P+
Sbjct: 226 ESVFIQPQ 233


>METN_BACHD RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 338

 Score =  107 bits (267), Expect = 1e-25
 Identities = 72/248 (29%), Positives = 125/248 (50%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++ +  + K F    G V AV  V+  +++G ++ VIG +GAGK+TL  ++  +  P +G
Sbjct: 1   MISLDGIRKVFKAKRGSVTAVDGVNLKINEGEIFGVIGYSGAGKSTLIRMLNMLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ +S L+   L   R+ +G  FQ+  +  + T  +N+               + 
Sbjct: 61  SVIVAGKDLSKLSDRDLRIERQKIGMIFQHFNLLWSRTVRKNIA----------FPLEIA 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
             P   R      +   EL+  VGLE    +  S +S G  +R+ IARALA  P++L  D
Sbjct: 111 GVPKKER-----EKRVDELINLVGLEGREEAYPSQLSGGQKQRVGIARALANNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +PK T  I +L+  I +  G+T+VL+ H+M ++  I  R+ V+  G+ + EG  
Sbjct: 166 EATSALDPKTTDSILDLLVDINEKLGLTIVLITHEMHVIRKICHRVAVMEAGKVVEEGPV 225

Query: 236 RDVRDNPE 243
            DV   P+
Sbjct: 226 LDVFRKPK 233


>METN2_BACSK RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 341

 Score =  107 bits (267), Expect = 1e-25
 Identities = 75/248 (30%), Positives = 128/248 (51%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E S+L+K +      V+ V NVSF V +G ++ ++G +GAGK++L   I  +  P  G
Sbjct: 1   MIEASELTKVYKTKKKRVIGVDNVSFKVGKGEIFGIVGYSGAGKSSLLRCINLLERPTSG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            IR+ G  ++ L   +L  AR  +G  FQ+  +    T   N+                L
Sbjct: 61  TIRVDGLDLTKLGTRELRQARLKIGMIFQHFYLINQKTVFGNIAFA-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           +   + RAD ++     EL+  VGL    N+  + +S G  +R+ IARALA KP +L  D
Sbjct: 108 KAAGV-RAD-LIPARVEELLELVGLSNKRNAYPAQLSGGQKQRVGIARALANKPSVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++K+ +  G+T+VL+ H+M +V  I  ++ ++  G+ + +G  
Sbjct: 166 EATSALDPTTTKSILALLKKLNEELGLTIVLITHEMAVVKEICHKMAIMQDGKMIEQGDV 225

Query: 236 RDVRDNPE 243
            DV   P+
Sbjct: 226 YDVFAAPK 233


>LSRA_YERPY RecName: Full=Autoinducer 2 import ATP-binding protein
           lsrA;         Short=AI-2 import ATP-binding protein
           lsrA;         EC=3.6.3.-;
          Length = 527

 Score =  107 bits (267), Expect = 1e-25
 Identities = 66/235 (28%), Positives = 116/235 (49%), Gaps = 19/235 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL++  +SK F GV+ ++++ F++  G V++++G NGAGK+TL  +I GI  P  G I +
Sbjct: 11  LLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAGILPPDTGVIEM 70

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+    L P +  + G+    Q   +  N++  EN+               + R P   
Sbjct: 71  NGQPCFNLTPAKAHQLGIYLVPQEPMLFANLSVQENI---------------LFRLPK-H 114

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           +AD   ++  A+L+  +G    L+  A ++     + +EI R L    RIL LDEP A  
Sbjct: 115 QAD---KKKMAQLLKNLGCHLDLSVSAGSLEVADQQLVEIMRGLMRDSRILILDEPTASL 171

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            P ET  + + +R +   G+ VV + H +  +  ++D + V+  G     G+  D
Sbjct: 172 TPAETHRLFSQIRMLLQQGVGVVFISHKLPEIRQLADWVSVMRDGGIALSGATAD 226



 Score = 65.1 bits (157), Expect = 6e-13
 Identities = 51/210 (24%), Positives = 99/210 (47%), Gaps = 14/210 (6%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM 80
           ++SF V  G +  + G  GAG+T L   + G+     G + L    ++ +        G+
Sbjct: 284 HISFHVQAGEILGLAGVVGAGRTELAETLYGLRPASTGNVILEEVNITAMKTANRLAAGL 343

Query: 81  GRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMV 137
               ++ Q   + ++     NV    H   DR   + +   P+  +  AVL  +   L +
Sbjct: 344 VYLPEDRQASGLYLDAPLSWNVCALAH---DR---QGLWTQPA--QEAAVLERYRRALNI 395

Query: 138 YVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKI 197
                ++L      +S G  ++L IA+ L A P +L +DEP  G +    ++I  L+R I
Sbjct: 396 KF---SHLEQPVRTLSGGNQQKLLIAKCLEANPLLLIIDEPTRGVDVSARSDIYQLIRSI 452

Query: 198 ADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           A+  + ++ +  D++ V+ ++DR+LV++ G
Sbjct: 453 AEQQVAIIFISSDLEEVVQMADRVLVMHQG 482


>RGMG_RHIL3 RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein;       
           EC=3.6.3.17;
          Length = 513

 Score =  107 bits (266), Expect = 1e-25
 Identities = 67/236 (28%), Positives = 113/236 (47%), Gaps = 11/236 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL    + K F GV+A+ +V F + +  V++++G NGAGK+TL  ++ GIYTP  G+IRL
Sbjct: 23  LLSAEGVRKEFPGVVALDDVQFRLKRASVHALMGENGAGKSTLMKILAGIYTPDKGDIRL 82

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  +   +P      G+    Q L +   MT  EN+ +       R   K+ L F    
Sbjct: 83  KGIEIQLKSPLDALENGIAMIHQELNLMPFMTVAENIWI-------RREPKNRLGFID-- 133

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
               V+     EL   + +    + E   +S    + +EIA+A++    +L +DEP +  
Sbjct: 134 --HGVMHRMTEELFTRLNIAIDPDIEVRFLSVANRQMVEIAKAVSYNSDVLIMDEPTSAL 191

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
             +E   +  ++R +   GI +V + H M  +  I+D   V   GR +   ++ DV
Sbjct: 192 TEREVEHLFRIIRDLKAQGIGIVYITHKMNELFEIADEFSVFRDGRYIGTHASTDV 247



 Score = 80.9 bits (198), Expect = 1e-17
 Identities = 67/229 (29%), Positives = 108/229 (47%), Gaps = 15/229 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L + DL     GV   +NVSF V  G +  V G  G+G++ +   + G+     G I L
Sbjct: 276 MLSVKDLC--LNGVF--KNVSFEVRAGEILGVAGLVGSGRSNVAETLFGVTPASSGSIEL 331

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
            G+ V+  +P +  R  M    ++ +     + +  +EN+ +     L    VK    F 
Sbjct: 332 YGKPVAISSPTEAIRNRMAFLTEDRKDTGCLLILDILENMQIA---VLQDRYVKG--GFV 386

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
                +A   + A +L V       L      +S G  +++ I R L   PRIL LDEP 
Sbjct: 387 QQGAVEATCEDMAKKLRVKT---PNLYERVENLSGGNQQKVLIGRWLLTNPRILILDEPT 443

Query: 180 AGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            G +    AEI  LV ++A  G+ VV++  +M  V+ +SDRI+V++ GR
Sbjct: 444 RGIDVGAKAEIHRLVTEMARDGVAVVMISSEMPEVLGMSDRIMVMHEGR 492


>RBSA_STRA3 RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 492

 Score =  107 bits (266), Expect = 1e-25
 Identities = 58/224 (25%), Positives = 113/224 (50%), Gaps = 11/224 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +++ ++SK+FG    ++ +   +  G +++++G NGAGK+TL N++TG++    G I + 
Sbjct: 3   IDMRNISKSFGTNKVLEKIDLELQSGQIHALMGENGAGKSTLMNILTGLFPASTGTIYID 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE  +   P +    G+    Q +     MT +EN+ +G  +     L+   L       
Sbjct: 63  GEERTFSNPQEAEEFGISFIHQEMNTWPEMTVLENLFLGREIKTTFGLLNQKL------- 115

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
               +R+ A E    +G+   L+     +S G  + +EIA++L  +  IL +DEP A   
Sbjct: 116 ----MRQKALEAFKRLGVTIPLDIPIGNLSVGQQQMIEIAKSLLNQLSILVMDEPTAALT 171

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            +ET  +  ++R +   G+ +V + H M+ +  I+D + V+  G
Sbjct: 172 DRETENLFRVIRSLKQEGVGIVYISHRMEEIFKITDFVTVMRDG 215



 Score = 78.6 bits (192), Expect = 6e-17
 Identities = 54/218 (24%), Positives = 110/218 (50%), Gaps = 6/218 (2%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VSF V +G +    G  GAG+T +   I GI     G++++  + ++  +P Q  ++G
Sbjct: 267 EDVSFYVRKGEILGFSGLMGAGRTEVMRTIFGIDKKKSGKVKIDNQEITITSPSQAIKQG 326

Query: 80  MGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYV 139
           +G   +N +   +   I +  +  +++L      S   F   +     +++    L +  
Sbjct: 327 IGFLTENRK---DEGLILDFNIKDNMTLPSTKDFSKHGFFDEKTRTTFVQQLINRLYIKS 383

Query: 140 GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIAD 199
           G     + E   +S G  +++ +A+ +   P++L LDEP  G +     EI  L+ ++AD
Sbjct: 384 GRP---DLEVGNLSGGNQQKVVLAKWIGIAPKVLILDEPTRGVDVGAKREIYQLMNELAD 440

Query: 200 SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            G+ +V+V  D+  ++ +SDRI+V++ GR   E S ++
Sbjct: 441 RGVPIVMVSSDLPEILGVSDRIMVMHEGRISGELSRKE 478


>RBSA_BURPS RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 517

 Score =  107 bits (266), Expect = 1e-25
 Identities = 69/226 (30%), Positives = 112/226 (49%), Gaps = 9/226 (3%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIY-TPCDGEIR 61
           LLE+  +SKTF  V A+  VS +V  G V+S++G NGAGK+TL  +++G Y     GEI 
Sbjct: 10  LLEMRGISKTFPAVRALAGVSLTVHPGEVHSLMGENGAGKSTLMKILSGAYQADPGGEIL 69

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + G  +S   P      G+   +Q L +  N++  EN+ V            ++ R    
Sbjct: 70  IDGRPISIDGPLAARDAGVAVIYQELCLAPNLSVAENIHVXXXXXXXXXXXXTIDRAAMA 129

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           R    VL          +G +   N+    +S    + +EIARA+  + RIL +DEP   
Sbjct: 130 RGCQDVLER--------LGADFGPNTLVGTLSIAEQQLVEIARAVHTRARILVMDEPTTP 181

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            + +ET  +  L+R++   G+ ++ + H M  +  +SDR+ VL  G
Sbjct: 182 LSSRETDNLFRLIRQLRAEGLAIIYISHRMAEIYELSDRVSVLRDG 227



 Score = 73.6 bits (179), Expect = 2e-15
 Identities = 57/233 (24%), Positives = 106/233 (45%), Gaps = 13/233 (5%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V+  S  +  G V  + G  GAG+T L  LI G      GE+ L G+  +  +P +    
Sbjct: 281 VRGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRVRGEVTLAGKAFAAHSPREAIDA 340

Query: 79  GMGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           G+    ++ +   + ++M+  EN+    ++S+                        A  +
Sbjct: 341 GLVYLTEDRKRQGLFLDMSVRENI----NISVCXXXXXXXXXXXXXXXXXXXXXIAALSI 396

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            V      + N    A+S G  +++ ++R L  KPR+L LDEP  G +    +EI  ++ 
Sbjct: 397 RV-----PHANVNVGALSGGNQQKVLLSRLLETKPRVLILDEPTRGVDIGAKSEIYRIIN 451

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTE-GSARDVRDNPEVIAA 247
           ++A +G+ V+++  ++  ++ ++DR+LV+  GR   E G   D     E I A
Sbjct: 452 ELARAGVGVIVISSELPEIIGVADRVLVMREGRIAGELGGRTDAPITQEAIIA 504


>POTA_MANSM RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 373

 Score =  107 bits (266), Expect = 1e-25
 Identities = 70/251 (27%), Positives = 125/251 (49%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E+  L K++     + N + +++ G   +++GP+G GKTT+  LI G      G+I L
Sbjct: 10  IIELRSLKKSYNENTIIDNFNLTINNGEFLTILGPSGCGKTTVLRLIAGFEEANGGQIIL 69

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V+ L       + +   FQ+  +  +MT  ENV  G             LR   + 
Sbjct: 70  DGEDVTDLPAE---HRPVNTVFQSYALFPHMTIFENVAFG-------------LRMQKVP 113

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             +  ++    E +  V LE   + + + +S G  +R+ IARA+  KP++L LDE  +  
Sbjct: 114 NEE--IKPRVLEALRMVQLEEMADRKPTQLSGGQQQRIAIARAVVNKPKVLLLDESLSAL 171

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++ N ++ +    GIT + V HD +  + +SDRI+VL  G    +GS R++ + 
Sbjct: 172 DYKLRKQMQNELKALQRKLGITFIFVTHDQEEALTMSDRIIVLRKGNIEQDGSPREIYEE 231

Query: 242 PE--VIAAYLG 250
           P    +A ++G
Sbjct: 232 PSNLFVAKFIG 242


>POTA_LEGPL RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 364

 Score =  107 bits (266), Expect = 1e-25
 Identities = 68/253 (26%), Positives = 129/253 (50%), Gaps = 21/253 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           L+EI  + K++G    + NVS +V+ G   +++GP+G GKTTL  LI+G   P  GEI +
Sbjct: 5   LIEIRQIYKSYGNTPILNNVSLNVNHGEFLTLLGPSGCGKTTLLRLISGFEQPTLGEIFI 64

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V+ L P    ++ +   FQ+  +  +++  ENV                      +
Sbjct: 65  NGQCVNQLPPQ---KRDVHTVFQSYALFPHLSVFENV---------------AFALRCKK 106

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
             +  +R+   + +  V LE+        +S G  +R+ IARA+  +P++L LDEP +  
Sbjct: 107 TPNQEIRKRVFDALKLVQLESLAERNVKQLSGGQQQRVAIARAIINRPQVLLLDEPLSSL 166

Query: 183 NPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + +    + + ++++  +  +T + V HD +  +++SDRI+V N+G     G+ + V + 
Sbjct: 167 DYRLRKAMQSELKQLQKTLNMTFIFVTHDQEEALSMSDRIVVFNHGHIEQIGTPKAVYET 226

Query: 242 PE--VIAAYLGTA 252
           P    +A ++G A
Sbjct: 227 PANLHVAMFIGEA 239


>PHNC_THICR RecName: Full=Phosphonates import ATP-binding protein
           phnC;         EC=3.6.3.28;
          Length = 272

 Score =  107 bits (266), Expect = 1e-25
 Identities = 74/231 (32%), Positives = 123/231 (53%), Gaps = 14/231 (6%)

Query: 15  GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQ 74
           G  AV+NVS  +++G    ++GP+GAGK+TL N++ G+  P  GEI L G +++     Q
Sbjct: 14  GTQAVKNVSVHLEKGEFCVLLGPSGAGKSTLMNMVNGLVEPSSGEIILDGGVLN-KKNLQ 72

Query: 75  LARKGMGRTFQNLQICMNMTAIENVMVG--GHLSLDRNLVKSMLRFPSLRRADAVLREHA 132
           L ++ +    Q L +   ++ + NV+ G     +   +LVKS   FP         ++ A
Sbjct: 73  LIQRSVSMIHQQLYLIPRLSVLHNVLTGILPTANFWTSLVKS---FP------VKDQQRA 123

Query: 133 AELMVYVGL-EAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEID 191
            EL+  VGL E +L   ASA+S G  +R+ IARA  A P+++  DEP A  +P  +  + 
Sbjct: 124 FELLSEVGLEEKHLMRRASALSGGQQQRVAIARAFMANPKVVLADEPVASLDPAMSRSVL 183

Query: 192 NLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           N ++  A  +G TV+   H +   +  +DRI+ L  G    +G   D+ ++
Sbjct: 184 NSLKHAAQTNGATVLCTLHQIDYALEFADRIVALREGEVFFDGHPSDMDED 234


>PHNC3_ANASP RecName: Full=Phosphonates import ATP-binding protein
           phnC 3;         EC=3.6.3.28;
          Length = 262

 Score =  107 bits (266), Expect = 1e-25
 Identities = 76/243 (31%), Positives = 131/243 (53%), Gaps = 15/243 (6%)

Query: 3   LLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           ++++  LS T+ GGV A+Q VS + + G    ++G +G+GK+TL   + G+  P  G I 
Sbjct: 2   MIQLECLSVTYPGGVQALQAVSLNFNPGEFTVILGASGSGKSTLLRCLNGLIQPTAGTIT 61

Query: 62  LGG--ELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR-F 118
           + G  ++      HQ  R+  G  FQ  Q+    TA++NV+ G      R    S +R F
Sbjct: 62  IEGYRQINDPKVLHQ-HRQRTGMIFQQHQLIARQTALQNVLTG------RLAYHSTVRSF 114

Query: 119 PSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
             L +AD  +   A E +  VGL +   +    +S G  +R+ IARALA +PR++  DEP
Sbjct: 115 FPLPKADKYI---ALECLDRVGLLSKALARVDNLSGGQQQRVGIARALAQQPRLMLADEP 171

Query: 179 AAGFNPKETAEIDNLVRKIA-DSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            A  +P  + ++ + +R+I  + GI  ++  H + +    +DRI+ ++ GR + +GSA D
Sbjct: 172 VASLDPASSHKVISFLRQICQEDGIAAIMSLHQVDLAKAYADRIVGISQGRIVFDGSAAD 231

Query: 238 VRD 240
           + +
Sbjct: 232 IEE 234


>PHNC1_ROSDO RecName: Full=Phosphonates import ATP-binding protein
           phnC 1;         EC=3.6.3.28;
          Length = 263

 Score =  107 bits (266), Expect = 1e-25
 Identities = 73/237 (30%), Positives = 123/237 (51%), Gaps = 15/237 (6%)

Query: 3   LLEISDLSKTFG-GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L +  L KT+  G  A++ V   + QG V ++IGP+GAGK+TL   +  +  P  G++ 
Sbjct: 1   MLRLEKLVKTYKTGDQALKEVDLEIPQGQVLALIGPSGAGKSTLIRCVNRLVEPSSGKVY 60

Query: 62  LGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVG--GHLSLDRNLVKSMLR 117
           LG   ++GL+   L      MG  FQ   +   +T +ENV+ G  G++   R+    M R
Sbjct: 61  LGNVELTGLSSSALXXXXXXMGMIFQEYALVERLTVMENVLSGRLGYVGFWRSF---MRR 117

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           FP   +AD    + A  L+  VGL    +  A  +S G  +R+ I RAL   P +L +DE
Sbjct: 118 FP---QADV---DEAFRLLDRVGLAHMADKRADELSGGQRQRVGICRALIQDPALLLVDE 171

Query: 178 PAAGFNPKETAEIDNLVRKIA-DSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
           P A  +PK + +I  L+ ++  + G+  ++  HD+ +      R++ L +G  + +G
Sbjct: 172 PTASLDPKTSRQIMRLICELCRERGLAAIINIHDVALAQMFVQRVIGLRFGAMVYDG 228


>METN_XANOR RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 335

 Score =  107 bits (266), Expect = 1e-25
 Identities = 75/248 (30%), Positives = 129/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   L K++      ++A+  +   +  G V+ +IG +GAGK+TL  LI  +  P  G
Sbjct: 1   MIEFQRLHKSYSVDGRQIVALHPLDLRIGPGEVFGIIGHSGAGKSTLIRLINRLEEPSGG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +G E V+ L    L   R+ +G  FQ+  +    T      V G+++    LV +  
Sbjct: 61  RLLIGDEDVTALDSQGLRALRRRIGMIFQHFNLLSART------VAGNVAFPLELVGTP- 113

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                 RA+   R   AEL+  VGL+   N   + +S G  +R+ IARALA  P+IL  D
Sbjct: 114 ------RAEIDAR--VAELLARVGLQEQANQYPAQLSGGQKQRVGIARALATGPQILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA +  L+ +I  + G+T+VL+ H+M ++  + DR+ VL+ G+ +  G  
Sbjct: 166 EATSALDPQTTASVLQLLAQINRELGLTIVLITHEMDVIRRVCDRVAVLDAGKLVETGPV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 TEVFLHPK 233


>METN3_BACCZ RecName: Full=Methionine import ATP-binding protein
           metN 3;         EC=3.6.3.-;
          Length = 341

 Score =  107 bits (266), Expect = 1e-25
 Identities = 71/235 (30%), Positives = 118/235 (50%), Gaps = 22/235 (9%)

Query: 14  GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPH 73
           G V AV N +  +D+G ++ VIG +GAGK++L  L   +  P  G+I +   ++S +   
Sbjct: 16  GDVTAVDNANLKIDKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISAITGS 75

Query: 74  QL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP-SLRRAD-AVLR 129
           +L  AR+ +G  FQ+  +  + T  EN+                  FP  +   D A  R
Sbjct: 76  ELRKARQEIGMIFQHFNLLWSRTVRENI-----------------EFPLEIAGVDKAKRR 118

Query: 130 EHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
           +   EL+  VGLE   ++  S +S G  +R+ IARALA  P++L  DE  +  +P+ T +
Sbjct: 119 KRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQ 178

Query: 190 IDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
                       G+T+VL+ H+M ++  I +R+ V+  G+ +  G   DV  NP+
Sbjct: 179 XXXXXXXXNKRLGLTIVLITHEMHVIRKICNRVAVMEKGKIVETGPVLDVFRNPQ 233


>METN3_BACAN RecName: Full=Methionine import ATP-binding protein
           metN 3;         EC=3.6.3.-;
          Length = 341

 Score =  107 bits (266), Expect = 1e-25
 Identities = 71/235 (30%), Positives = 118/235 (50%), Gaps = 22/235 (9%)

Query: 14  GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPH 73
           G V AV N +  +D+G ++ VIG +GAGK++L  L   +  P  G+I +   ++S +   
Sbjct: 16  GDVTAVDNANLKIDKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISAITGS 75

Query: 74  QL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP-SLRRAD-AVLR 129
           +L  AR+ +G  FQ+  +  + T  EN+                  FP  +   D A  R
Sbjct: 76  ELRKARQEIGMIFQHFNLLWSRTVRENI-----------------EFPLEIAGVDKAKRR 118

Query: 130 EHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
           +   EL+  VGLE   ++  S +S G  +R+ IARALA  P++L  DE  +  +P+ T +
Sbjct: 119 KRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQ 178

Query: 190 IDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
                       G+T+VL+ H+M ++  I +R+ V+  G+ +  G   DV  NP+
Sbjct: 179 XXXXXXXXNKRLGLTIVLITHEMHVIRKICNRVAVMEKGKIVETGPVLDVFRNPQ 233


>METN2_LISIN RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 340

 Score =  107 bits (266), Expect = 1e-25
 Identities = 69/231 (29%), Positives = 120/231 (51%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V   ++QG ++ V+G +GAGK+TL  +  G+  P +G + +   L+S +   +L
Sbjct: 18  VLAVDHVDLEIEQGEIFGVVGYSGAGKSTLIRMFNGLELPTEGSVEVDNLLISQIRGSKL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
             AR+ +G  FQ+  +  + T  EN+       L+   V+   R           R    
Sbjct: 78  RKARQQIGMIFQHFNLLWSRTVAENIA----FPLEIAGVRGEKR-----------RFRVN 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGLE   N+  + +S G  +R+ IARALA  P++L  DE  +  +P+ T E+  L
Sbjct: 123 ELIRLVGLEGKENAYPAELSGGQKQRVGIARALANNPKVLLCDEATSALDPQTTDEVLEL 182

Query: 194 VRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           +  I     +T++++ H+M ++  I +R+ V+  G+    G   DV  +P+
Sbjct: 183 LLDINKRLNLTIIVITHEMHVIRKICNRVAVMENGKVAELGDVLDVFRHPK 233


>FBPC1_ERWCT RecName: Full=Fe(3+) ions import ATP-binding protein
           fbpC 1;         EC=3.6.3.30;
          Length = 352

 Score =  107 bits (266), Expect = 1e-25
 Identities = 66/254 (25%), Positives = 127/254 (50%), Gaps = 21/254 (8%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           + +E+  ++K FG    + +++ ++ QG + +++GP+G GKTT+   + G+  P +G+I 
Sbjct: 9   SFVELKHITKRFGNNTVIDDLNLAIPQGKMVTLLGPSGCGKTTVLRAVAGLEKPTEGQIF 68

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + GE V+             R+ Q   ICM     ++  +  H+SL  N+   +     L
Sbjct: 69  IDGEDVT------------ERSIQQRDICM---VFQSYALFPHMSLGENIGYGL---KML 110

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
            R  A + +   E +  V LE + +     +S G  +R+ +ARAL  KP++L  DEP + 
Sbjct: 111 GRPKAEINQRVKEALALVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEPLSN 170

Query: 182 FNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
            +      +   +R++     IT + V HD      +SD +LV+N G+ +  G+ +++  
Sbjct: 171 LDANLRRSMREKIRELQQQFNITSLYVTHDQSEAFAVSDMVLVMNKGKIMQLGAPQELYR 230

Query: 241 NP--EVIAAYLGTA 252
            P    +A+++G A
Sbjct: 231 QPASRFMASFMGDA 244


>CYSA_BACC1 RecName: Full=Sulfate/thiosulfate import ATP-binding
           protein cysA;         EC=3.6.3.25;AltName:
           Full=Sulfate-transporting ATPase;
          Length = 357

 Score =  107 bits (266), Expect = 1e-25
 Identities = 68/240 (28%), Positives = 117/240 (48%), Gaps = 15/240 (6%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           ++I  +SK +G   A+ ++   + +G + +++GP+G+GKTTL  +I G+    +G I   
Sbjct: 3   IQIQGVSKQYGTFQALTDIHLDIPKGELVALLGPSGSGKTTLLRIIAGLEEADEGSISFE 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE    L    +  + +G  FQ+  +  +M   ENV  G             +R  SLR 
Sbjct: 63  GE---DLTDIHVKNRQVGFVFQHYALFKHMNVFENVAFG-----------LKVRKKSLRP 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
           +   + E   EL+  V ++ +     + +S G             +P+IL LDEP    +
Sbjct: 109 SAEAIEEKVTELLKLVKMDGFAKRYPAQLSGGXXXXXXXXXXXXVEPKILLLDEPFGALD 168

Query: 184 PKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
            K   E+   +RK+ D   IT V V HD +  ++++DRI+V+N GR    G+  +V +NP
Sbjct: 169 AKVRKELRRWLRKLHDEFQITSVFVTHDQEEALDVADRIVVMNEGRIEQMGTPEEVYENP 228


>ARAG_RHIEC RecName: Full=Arabinose import ATP-binding protein araG;
                   EC=3.6.3.17;
          Length = 501

 Score =  107 bits (266), Expect = 1e-25
 Identities = 66/234 (28%), Positives = 122/234 (52%), Gaps = 24/234 (10%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           MA LE +++SK + GV A+ NVSF+V++G+V+ ++G NGAGK+TL  +++G      G I
Sbjct: 1   MAFLEFNNVSKGYPGVQALANVSFTVEKGVVHGLMGENGAGKSTLIRVLSGDQAADGGNI 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            + GE     +       G+    Q LQ+   +T  EN+ +G              RFP+
Sbjct: 61  FIDGEEQKYTSVRDAFHAGIVVIHQELQLVPELTVAENLWLG--------------RFPA 106

Query: 121 ------LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILF 174
                 L+     +R    E    +G++   +++ S++S GA + +EIA+A+    R++ 
Sbjct: 107 KGGIIHLKTLIETVRAKLEE----IGIDVDPSTKVSSLSIGARQMIEIAKAVMLDARVIA 162

Query: 175 LDEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           LDEP +  + +E+  + +L+ ++   G  ++ V H +  +  + D + VL  G+
Sbjct: 163 LDEPTSSLSSRESEILFSLIARLKARGAVILYVSHRLDEIFRLCDSLTVLRDGK 216



 Score = 62.8 bits (151), Expect = 3e-12
 Identities = 59/235 (25%), Positives = 102/235 (43%), Gaps = 20/235 (8%)

Query: 22  VSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM- 80
           +SFSV QG +    G  GAG++ +  L+ G      GE+ + G  VS   P    + GM 
Sbjct: 271 ISFSVRQGEILGFFGLIGAGRSEMARLLYGADARHRGEVTIDGVAVSPNNPKVAIKAGMV 330

Query: 81  ----GRTFQNLQICMNMTAIENVMVGGHLSLDR-NLVKSMLRFPSLRRADAVLREHAAEL 135
                R F    I    +  EN+ +       R  ++K         R  A LR      
Sbjct: 331 LCPEDRKFDG--IVQGRSIEENIAISSRRHFSRFGILKPKTEAAQADRFIAKLRVRTPS- 387

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKP-RILFLDEPAAGFNPKETAEIDNLV 194
                       +   +S G  +++ + R L+ +  ++L +DEP  G +    +EI +++
Sbjct: 388 ---------RRQDIVNLSGGNQQKVILGRWLSEQGIKVLVIDEPTRGIDVGAKSEIYDIL 438

Query: 195 RKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYL 249
            ++A  G+ +V++  ++  VM I DRI+V+  GR +    AR   D   ++ A L
Sbjct: 439 YELAAGGVAIVVISSELPEVMGICDRIIVMCQGR-VAANVARPDFDERSILTAAL 492


>WTPC_PYRHO RecName: Full=Molybdate/tungstate import ATP-binding
           protein wtpC;         EC=3.6.3.-;
          Length = 345

 Score =  106 bits (265), Expect = 2e-25
 Identities = 71/251 (28%), Positives = 127/251 (50%), Gaps = 22/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L++  +SK +     ++ +SF V +G  + ++GP+G+GKT L  +I GI +P  G I L
Sbjct: 1   MLKVESISKDYRE-FKLREISFDVREGEHFIILGPSGSGKTVLLEIIAGIISPDRGRILL 59

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE ++GL P    ++      QN  +  +MT  +N+  G             L+   + 
Sbjct: 60  RGEDITGLPPE---KRNFSYIPQNYALFPHMTVFDNIAFG-------------LKLRKIP 103

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R +   +    E+   +G++  L+ +   +S G  +R+ IARAL  KP +L +DEP A  
Sbjct: 104 RKEVARK--VREVAESLGIDHLLHRKPRTLSGGEQQRVAIARALVVKPELLLMDEPFANL 161

Query: 183 NPKETAE-IDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + +  ++ I  + R   + G T + V H  +  +++ DR+ ++  GR +  G  RDV   
Sbjct: 162 DVQTKSKLIREMKRWRKEFGFTAIHVTHSFEEALSLGDRVGIMLRGRLVQVGDVRDVFSK 221

Query: 242 P--EVIAAYLG 250
           P  E +A +LG
Sbjct: 222 PKSEEVARFLG 232


>UGPC_PARDP RecName: Full=sn-glycerol-3-phosphate import ATP-binding
           protein ugpC;         EC=3.6.3.20;
          Length = 353

 Score =  106 bits (265), Expect = 2e-25
 Identities = 66/256 (25%), Positives = 129/256 (50%), Gaps = 21/256 (8%)

Query: 1   MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           MA + ++D+ K++ G   +  ++  +  G    ++GP+G GK+TL  ++ G+     G +
Sbjct: 1   MARILLNDVRKSYAGNQVIHGITMEIADGEFVVIVGPSGCGKSTLLRMVAGLEAISAGTV 60

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS 120
            +GG++V+ L P Q   + +   FQN  +  +M+  EN+  G             L+   
Sbjct: 61  EIGGKVVNDLEPRQ---RDIAMVFQNYALYPHMSVRENMAYG-------------LKIAK 104

Query: 121 LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
           L + +  +    A+    + LE YL+ +  A+S G  +R+ + RAL  +P  L LDEP +
Sbjct: 105 LPKTE--IEARVAKAATMLELEPYLDRKPRALSGGQRQRVAMGRALVREPAALLLDEPLS 162

Query: 181 GFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
             + K   ++   ++++   +G T + V HD    M ++DR++V+N G      +  +V 
Sbjct: 163 NLDAKLRVQMRLQIKEMHLRTGQTTLYVTHDQVEAMTLADRLIVMNKGVAEQIATPLEVY 222

Query: 240 DNP--EVIAAYLGTAA 253
           + P  E +A ++G+ A
Sbjct: 223 ERPASEFVAGFIGSPA 238


>UGPC1_AGRT5 RecName: Full=sn-glycerol-3-phosphate import
           ATP-binding protein ugpC 1;         EC=3.6.3.20;
          Length = 366

 Score =  106 bits (265), Expect = 2e-25
 Identities = 72/257 (28%), Positives = 124/257 (48%), Gaps = 22/257 (8%)

Query: 1   MALLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           MA +EIS + K + GGV AV +V   +  G    ++GP+G GK+TL  ++ G+    +G 
Sbjct: 1   MAAIEISQVCKDYHGGVRAVHHVDIDIRDGEFIVLVGPSGCGKSTLLRMVAGLEDISEGT 60

Query: 60  IRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           +++G  +V+   P   A + +   FQN  +  +M+  EN+  G                 
Sbjct: 61  VKIGDRVVNQTDP---ADRDIAMVFQNYALYPHMSVRENLEYG---------------LK 102

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
           + + A   +    AE    + LE YL  +  A+S G  +R+ + RA+  KP     DEP 
Sbjct: 103 NRKTAKTEIDARVAEAARMLQLEPYLERKPRALSGGQRQRVAMGRAIVRKPAAFLFDEPL 162

Query: 180 AGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +  + K    +   ++++    G T + V HD    M ++DR++VLN GR    G+  DV
Sbjct: 163 SNLDAKLRVSMRGEIKRLQKRLGTTSIYVTHDQLEAMTLADRLVVLNGGRIEQIGAPLDV 222

Query: 239 RDNP--EVIAAYLGTAA 253
              P    +A+++G+ A
Sbjct: 223 YHTPASTFVASFIGSPA 239


>RGMG1_RHIEC RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein 1;       
           EC=3.6.3.17;
          Length = 524

 Score =  106 bits (265), Expect = 2e-25
 Identities = 63/235 (26%), Positives = 118/235 (50%), Gaps = 6/235 (2%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +LE+  ++K F GVLA+  +S  V  G V+ ++G NGAGK+TL  +++GIY    GEI  
Sbjct: 28  VLEMRSITKAFPGVLALDGMSLKVRAGTVHVLVGENGAGKSTLMKILSGIYAIDGGEILF 87

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE +   +      +G+    Q L   ++MT  EN+ +G   +  R  V S  RF    
Sbjct: 88  RGEKLDHQSAAAALERGISMIHQELSPVLDMTIAENIFLGREPTYSRTGVLS--RFVDFD 145

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           R    +      L+  +GL+    ++   +S   ++ +EI +A++ +  ++ +DEP +  
Sbjct: 146 R----MNSDTQTLLDRLGLKYSPQTKMRDLSIATMQLIEIVKAISREASLIIMDEPTSAI 201

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
           +  E A +   +  +  +G+ ++ + H M  +  I+D I V+  G+ +    A +
Sbjct: 202 SDTEVAMLFRQIADLKAAGVAIIYITHKMDEIFQIADDITVMRDGQFVAAAPASE 256



 Score = 53.9 bits (128), Expect = 1e-09
 Identities = 51/231 (22%), Positives = 99/231 (42%), Gaps = 20/231 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L + +LS+   GV    NV F V  G +  + G  GAG+T +  +I G+     G +RL
Sbjct: 286 VLSVENLSRD--GVF--DNVGFEVRAGEIVGLSGLIGAGRTEVARVIFGLDAADAGVVRL 341

Query: 63  GGELVSGLAPHQLARKGMG-----RTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR 117
            G+ +   +P      G+      R  + L +C +        VG ++SL      +   
Sbjct: 342 NGKPLKLTSPKDAIANGIAMVSEDRKAEGLVLCRS--------VGENISLANLKKFASGI 393

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           F S R+ +   +     L +     A +      +S G  +++                E
Sbjct: 394 FISERQEETASQRMIKMLQIKTPDTAMI---VENLSGGNQQKIVXXXXXXXXXXXXXXXE 450

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
           P  G +    +EI  L+ + A  G+ ++++  ++  ++ +SDR++V++ GR
Sbjct: 451 PTRGIDVGSKSEIHRLMTEFARQGLAIIMISSELPEILGMSDRVVVMSEGR 501


>RBSA_STRA5 RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 492

 Score =  106 bits (265), Expect = 2e-25
 Identities = 59/224 (26%), Positives = 113/224 (50%), Gaps = 11/224 (4%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +++ ++SK+FG    ++ +   +  G +++++G NGAGK+TL N++TG++    G I + 
Sbjct: 3   IDMRNISKSFGTNKVLEKIDLELQSGQIHALMGENGAGKSTLMNILTGLFPASTGTIYID 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           GE  +   P +    G+    Q +     MT +EN+ +G  +     L+   L       
Sbjct: 63  GEERTFSNPQEAEEFGISFIHQEMNTWPEMTVLENLFLGREIKTTFGLLNQKL------- 115

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
               +R+ A E    +G+   L+     +S G  + +EIA++L  +  IL +DEP A   
Sbjct: 116 ----MRQKALETFKRLGVTIPLDIPIGNLSVGQQQMIEIAKSLLNQLSILVMDEPTAALT 171

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
            +ET  +  ++R +   G+ VV + H M+ +  I+D + V+  G
Sbjct: 172 DRETENLFRVIRGLKQEGVGVVYISHRMEEIFKITDFVTVMRDG 215



 Score = 78.6 bits (192), Expect = 6e-17
 Identities = 54/218 (24%), Positives = 110/218 (50%), Gaps = 6/218 (2%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VSF V +G +    G  GAG+T +   I GI     G++++  + ++   P Q  ++G
Sbjct: 267 EDVSFYVRKGEILGFSGLMGAGRTEVMRTIFGIDKKKSGKVKIDDQEITITTPSQAIKQG 326

Query: 80  MGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYV 139
           +G   +N +   +   I +  +  +++L      S   F   + +   +++    L +  
Sbjct: 327 IGFLTENRK---DEGLILDFNIKDNMTLPSTKDFSKHGFFDEKTSTTFVQQLINRLYIKS 383

Query: 140 GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIAD 199
           G     + E   +S G  +++ +A+ +   P++L LDEP  G +     EI  L+ ++AD
Sbjct: 384 GRP---DLEVGNLSGGNQQKVVLAKWIGIAPKVLILDEPTRGVDVGAKREIYQLMNELAD 440

Query: 200 SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            G+ +V+V  D+  ++ +SDRI+V++ GR   E S ++
Sbjct: 441 RGVPIVMVSSDLPEILGVSDRIMVMHEGRISGELSRKE 478


>RBSA3_RHIEC RecName: Full=Ribose import ATP-binding protein rbsA 3;
                   EC=3.6.3.17;
          Length = 511

 Score =  106 bits (265), Expect = 2e-25
 Identities = 72/251 (28%), Positives = 125/251 (49%), Gaps = 16/251 (6%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           A+LE+  +S+ F GV A+ NVS ++  G V ++IG NGAGK+TL  ++TGIY P +GEI 
Sbjct: 19  AILEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTGIYRPNEGEIL 78

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           + G+  S  +       G+    Q   +   +T  EN+ + GH    R           L
Sbjct: 79  VDGQPTSFASAQAAIDAGVTAIHQETVLFDELTVAENIFL-GHAPRTR-----------L 126

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKR--LEIARALAAKPRILFLDEPA 179
           R  D       ++ ++   LE+ ++           +R  + IARAL+ + RI+ +DEP 
Sbjct: 127 RTIDWQTMNSRSKTLL-TALESNIDPTIRLKDLSIAQRHLVAIARALSIEARIVIMDEPT 185

Query: 180 AGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVR 239
           A  + KE  ++  +VR + D G  ++ + H    +  I+D  +V   GR + +G  ++  
Sbjct: 186 AALSRKEIDDLFRIVRGLKDQGKAILFISHKFDELYEIADDFVVFRDGRAVGQGRLKETP 245

Query: 240 DNPEVIAAYLG 250
            + E++   +G
Sbjct: 246 QD-EIVRMMVG 255



 Score = 73.9 bits (180), Expect = 1e-15
 Identities = 50/212 (23%), Positives = 101/212 (47%), Gaps = 14/212 (6%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VS ++ +G +  + G  GAG++ L   + G+  P  G + L G  +S  +PH   + G
Sbjct: 286 RDVSLTLRRGEILGIYGLIGAGRSELAQSLFGVTKPLSGRLTLEGREISINSPHDAIKAG 345

Query: 80  MGRTFQNLQ---ICMNMTAIENVMVGGHLSLDRN-LVKSMLRFPSLRRADAVLREHAAEL 135
           +    +      + + M   +N+ +       R   +K+   F   R+    L   AA L
Sbjct: 346 IVYVPEERGRHGLALPMPIYQNMTLPSLARTSRKGFLKAAEEFALARKYAERLDLRAAAL 405

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
            V VG           +S G  +++ I + LA  P+++ LDEP  G +    A +   + 
Sbjct: 406 SVPVG----------TLSGGNQQKVVIGKWLATMPKVIILDEPTKGIDIGSKAAVHGFIS 455

Query: 196 KIADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           ++A  G++++++  ++  ++ +SDR+LV+  G
Sbjct: 456 ELAAEGLSIIMISSELPEIIGMSDRVLVMKEG 487


>POTG_ECOLI RecName: Full=Putrescine transport ATP-binding protein
           potG;
          Length = 377

 Score =  106 bits (265), Expect = 2e-25
 Identities = 66/244 (27%), Positives = 132/244 (54%), Gaps = 25/244 (10%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLEI +L+K++ G  AV +VS ++ +G +++++G +G GK+TL  ++ G   P  G+I L
Sbjct: 19  LLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIML 78

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G  +S + P+    + +   FQ+  +  +MT  +N+  G             L+   L 
Sbjct: 79  DGVDLSQVPPY---LRPINMMFQSYALFPHMTVEQNIAFG-------------LKQDKLP 122

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           +A+   R +  E++  V ++ +   +   +S G  +R+ +AR+LA +P++L LDEP    
Sbjct: 123 KAEIASRVN--EMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGAL 180

Query: 183 NPK----ETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           + K       E+ +++ ++   G+T V+V HD +  M ++ RI ++N G+ +  G   ++
Sbjct: 181 DKKLRDRMQLEVVDILERV---GVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEI 237

Query: 239 RDNP 242
            ++P
Sbjct: 238 YEHP 241


>POTA_VIBCH RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 377

 Score =  106 bits (265), Expect = 2e-25
 Identities = 68/251 (27%), Positives = 131/251 (52%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++ +S +SK+F G   + N++  V+ G   +++GP+G GKTT+  +I G  T   G+I L
Sbjct: 17  VIRLSGISKSFDGKEIIGNLNLDVNHGEFLTILGPSGCGKTTVLRMIAGFETADQGQILL 76

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             + V+ +   Q   + +   FQ+  +  +MT  ENV  G             LR   + 
Sbjct: 77  DDQDVTQVPAEQ---RHVNTVFQSYALFPHMTVFENVAFG-------------LRMQKVP 120

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           +++  +     E +  V L      +   +S G  +R+ IARA+  KP++L LDE  +  
Sbjct: 121 QSE--IEPRVMEALRMVRLAEMAQRKPHQLSGGQQQRIAIARAVVNKPKVLLLDESLSAL 178

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++ + ++++    GIT + V HD +  +++SDRI+V+  G+   +GS R++ ++
Sbjct: 179 DYKLRKQMQSELKQLQRQLGITFIFVTHDQEEALSMSDRIIVMRSGKIEQDGSPREIYED 238

Query: 242 PE--VIAAYLG 250
           P+   +A ++G
Sbjct: 239 PKNLFVARFIG 249


>POTA_STRR6 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 385

 Score =  106 bits (265), Expect = 2e-25
 Identities = 70/255 (27%), Positives = 131/255 (51%), Gaps = 27/255 (10%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++E  ++SK F       +++++F +++G  Y+++G +G+GK+T+ N+I G+     G+I
Sbjct: 5   IIEFKNVSKVFEDSNTKVLKDINFELEEGKFYTLLGASGSGKSTILNIIAGLLDATTGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP- 119
            L G  ++ +  +   ++ +   FQ+  +  +M   ENV                  FP 
Sbjct: 65  MLDGVRINDIPTN---KRDVHTVFQSYALFPHMNVFENV-----------------AFPL 104

Query: 120 SLRRAD-AVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
            LR+ D   + +  AE++  V LE Y       +S G  +R+ IARA+  +PR++ LDEP
Sbjct: 105 RLRKIDKKEIEQRVAEVLKMVQLEGYEKRSIRKLSGGQRQRVAIARAIINQPRVVLLDEP 164

Query: 179 AAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            +  + K   ++   +R++    GIT V V HD +  + +SD I V+N G  +  G+  D
Sbjct: 165 LSALDLKLRTDMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNDGEIVQSGTPVD 224

Query: 238 VRDNP--EVIAAYLG 250
           + D P    +A ++G
Sbjct: 225 IYDEPINHFVATFIG 239


>POTA_STRPN RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 385

 Score =  106 bits (265), Expect = 2e-25
 Identities = 70/255 (27%), Positives = 131/255 (51%), Gaps = 27/255 (10%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++E  ++SK F       +++++F +++G  Y+++G +G+GK+T+ N+I G+     G+I
Sbjct: 5   IIEFKNVSKVFEDSNTKVLKDINFELEEGKFYTLLGASGSGKSTILNIIAGLLDATTGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP- 119
            L G  ++ +  +   ++ +   FQ+  +  +M   ENV                  FP 
Sbjct: 65  MLDGVRINDIPTN---KRDVHTVFQSYALFPHMNVFENV-----------------AFPL 104

Query: 120 SLRRAD-AVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
            LR+ D   + +  AE++  V LE Y       +S G  +R+ IARA+  +PR++ LDEP
Sbjct: 105 RLRKIDKKEIEQRVAEVLKMVQLEGYEKRSIRKLSGGQRQRVAIARAIINQPRVVLLDEP 164

Query: 179 AAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            +  + K   ++   +R++    GIT V V HD +  + +SD I V+N G  +  G+  D
Sbjct: 165 LSALDLKLRTDMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNDGEIVQSGTPVD 224

Query: 238 VRDNP--EVIAAYLG 250
           + D P    +A ++G
Sbjct: 225 IYDEPINHFVATFIG 239


>POTA_STRP2 RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 385

 Score =  106 bits (265), Expect = 2e-25
 Identities = 70/255 (27%), Positives = 131/255 (51%), Gaps = 27/255 (10%)

Query: 3   LLEISDLSKTF--GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI 60
           ++E  ++SK F       +++++F +++G  Y+++G +G+GK+T+ N+I G+     G+I
Sbjct: 5   IIEFKNVSKVFEDSNTKVLKDINFELEEGKFYTLLGASGSGKSTILNIIAGLLDATTGDI 64

Query: 61  RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP- 119
            L G  ++ +  +   ++ +   FQ+  +  +M   ENV                  FP 
Sbjct: 65  MLDGVRINDIPTN---KRDVHTVFQSYALFPHMNVFENV-----------------AFPL 104

Query: 120 SLRRAD-AVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
            LR+ D   + +  AE++  V LE Y       +S G  +R+ IARA+  +PR++ LDEP
Sbjct: 105 RLRKIDKKEIEQRVAEVLKMVQLEGYEKRSIRKLSGGQRQRVAIARAIINQPRVVLLDEP 164

Query: 179 AAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            +  + K   ++   +R++    GIT V V HD +  + +SD I V+N G  +  G+  D
Sbjct: 165 LSALDLKLRTDMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNDGEIVQSGTPVD 224

Query: 238 VRDNP--EVIAAYLG 250
           + D P    +A ++G
Sbjct: 225 IYDEPINHFVATFIG 239


>POTA_LISIN RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 366

 Score =  106 bits (265), Expect = 2e-25
 Identities = 67/235 (28%), Positives = 115/235 (48%), Gaps = 21/235 (8%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           + NVSF +++G  Y+++GP+G GKTT+  LI G     +G+I LG ++++ +  +   ++
Sbjct: 24  LDNVSFEIEKGKFYTLLGPSGCGKTTILRLIAGFLEASEGQIYLGDKVINQIPAN---KR 80

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
            +   FQ+  +  ++   ENV  G                               E + +
Sbjct: 81  PVNTVFQDYALFPHLNVYENVAFG---------------LRXXXXXXXXXXXXVQEALRF 125

Query: 139 VGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIA 198
           V L+ Y   E S MS G  +R+ IARA+  +P ++ LDEP +  + K   E+   +R + 
Sbjct: 126 VNLKGYEKREISEMSGGQRQRVAIARAIVNEPEVILLDEPLSALDLKLRTEMQYELRDLQ 185

Query: 199 DS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EVIAAYLG 250
              GIT + V HD +  + +SD I VLN G     G+  D+ D P  + +A ++G
Sbjct: 186 KRLGITFIFVTHDQEEALAMSDEIFVLNKGEIQQSGTPIDIYDEPINKFVADFIG 240


>METN_SHIFL RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  106 bits (265), Expect = 2e-25
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSRHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K  +
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALP--LELD-NTPKDEI 117

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           +                EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 118 K------------RRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN_SHIF8 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 343

 Score =  106 bits (265), Expect = 2e-25
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++++S+++K F      + A+ NVS  V  G +Y VIG +GAGK+TL   +  +  P +G
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSRHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + + G+ ++ L+  +L  AR+ +G  FQ+  +  + T   NV +   L LD N  K  +
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALP--LELD-NTPKDEI 117

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           +                EL+  VGL    +S  S +S G  +R+ IARALA+ P++L  D
Sbjct: 118 K------------RRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  I  L++ I    G+T++L+ H+M +V  I D + V++ G  + + + 
Sbjct: 166 EATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTV 225

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 226 SEVFSHPK 233


>METN2_LISMF RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 340

 Score =  106 bits (265), Expect = 2e-25
 Identities = 70/231 (30%), Positives = 120/231 (51%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V   ++QG ++ V+G +GAGK+TL  +  G+  P  G + +   L+S +   +L
Sbjct: 18  VLAVDHVDLEIEQGEIFGVVGYSGAGKSTLIRMFNGLELPSAGTVEVDNLLISQIRGSKL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
             AR+ +G  FQ+  +  + T  EN+       L+   V+   R           R    
Sbjct: 78  RKARQQIGMIFQHFNLLWSRTVAENIA----FPLEIAGVRGEKR-----------RFRVN 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGLE   N+  S +S G  +R+ IARALA  P++L  DE  +  +P+ T E+  L
Sbjct: 123 ELIRLVGLEGKENAYPSELSGGQKQRVGIARALANNPKVLLCDEATSALDPQTTDEVLEL 182

Query: 194 VRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           +  I     +T++++ H+M ++  I +R+ V+  G+ +  G   DV  +P+
Sbjct: 183 LLDINKRLHLTIIVITHEMHVIRKICNRVAVMENGKVVELGDVLDVFRHPQ 233


>METN1_PSEPK RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 335

 Score =  106 bits (265), Expect = 2e-25
 Identities = 71/248 (28%), Positives = 130/248 (52%), Gaps = 21/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E   + KT+      + A+   S +++ G V+ +IG +GAGK+T+  LI  +  P  G
Sbjct: 1   MIEFQQVHKTYRVAGREIPALNPTSLTIEDGQVFGLIGHSGAGKSTMLRLINRLEEPSGG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I + GE V+     QL   R+ +G  FQ+  +  + T  +NV +   L+L   L +S +
Sbjct: 61  TIIVDGEDVTAFNASQLRGFRQQVGMIFQHFNLLASKTVADNVALP--LALAGELSRSEI 118

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
                        +   EL+  VGL  +     + +S G  +R+ IARAL+  P+IL  D
Sbjct: 119 D------------KRVTELLARVGLSDHAKKYPAQLSGGQKQRVGIARALSTNPKILLCD 166

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ TA +  L+ +I  +  +T+VL+ H+M ++  + DR+ V++ G+ + +GS 
Sbjct: 167 EATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAGQIVEQGSV 226

Query: 236 RDVRDNPE 243
            +V  +P+
Sbjct: 227 AEVFLHPQ 234


>LSRA_YERP3 RecName: Full=Autoinducer 2 import ATP-binding protein
           lsrA;         Short=AI-2 import ATP-binding protein
           lsrA;         EC=3.6.3.-;
          Length = 527

 Score =  106 bits (265), Expect = 2e-25
 Identities = 66/235 (28%), Positives = 116/235 (49%), Gaps = 19/235 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL++  +SK F GV+ ++++ F++  G V++++G NGAGK+TL  +I GI  P  G I +
Sbjct: 11  LLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGGNGAGKSTLMKIIAGILPPDTGVIEM 70

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+    L P +  + G+    Q   +  N++  EN+               + R P   
Sbjct: 71  NGQPCFNLTPAKAHQLGIYLVPQEPMLFANLSVQENI---------------LFRLPK-H 114

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
           +AD   ++  A+L+  +G    L+  A ++     + +EI R L    RIL LDEP A  
Sbjct: 115 QAD---KKKMAQLLKNLGCHLDLSVSAGSLEVADQQLVEIMRGLMRDSRILILDEPTASL 171

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
            P ET  + + +R +   G+ VV + H +  +  ++D + V+  G     G+  D
Sbjct: 172 TPAETHRLFSQIRILLQQGVGVVFISHKLPEIRQLADWVSVMRDGGIALSGATAD 226



 Score = 65.1 bits (157), Expect = 6e-13
 Identities = 51/210 (24%), Positives = 99/210 (47%), Gaps = 14/210 (6%)

Query: 21  NVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGM 80
           ++SF V  G +  + G  GAG+T L   + G+     G + L    ++ +        G+
Sbjct: 284 HISFHVQAGEILGLAGVVGAGRTELAETLYGLRPASTGNVILEEVNITAMKTANRLAAGL 343

Query: 81  GRTFQNLQ---ICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMV 137
               ++ Q   + ++     NV    H   DR   + +   P+  +  AVL  +   L +
Sbjct: 344 VYLPEDRQASGLYLDAPLSWNVCALAH---DR---QGLWTQPA--QEAAVLERYRRALNI 395

Query: 138 YVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKI 197
                ++L      +S G  ++L IA+ L A P +L +DEP  G +    ++I  L+R I
Sbjct: 396 KF---SHLEQPVRTLSGGNQQKLLIAKCLEANPLLLIIDEPTRGVDVSARSDIYQLIRSI 452

Query: 198 ADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           A+  + ++ +  D++ V+ ++DR+LV++ G
Sbjct: 453 AEQQVAIIFISSDLEEVVQMADRVLVMHQG 482


>GLNQ_ECOLI RecName: Full=Glutamine transport ATP-binding protein
           glnQ;
          Length = 240

 Score =  106 bits (265), Expect = 2e-25
 Identities = 66/241 (27%), Positives = 120/241 (49%), Gaps = 15/241 (6%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++E  ++SK FG    + N+  ++ QG V  +IGP+G+GK+TL   I  +     G++ +
Sbjct: 1   MIEFKNVSKHFGPTQVLHNIDLNIAQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIV 60

Query: 63  GGELVSG-LAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
            G  V+      +L R+  G  FQ   +  ++TA+ENVM G       N           
Sbjct: 61  DGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGANXXXXXXXXXXX 120

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
                            VGL    +   S +S G  +R+ IARALA KP+++  DEP + 
Sbjct: 121 XXX--------------VGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSA 166

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
            +P+   E+  +++ +A+ G+T+V+V H++     ++ R++ ++ GR   +G+ + +  N
Sbjct: 167 LDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGNPQVLIKN 226

Query: 242 P 242
           P
Sbjct: 227 P 227


>ZNUC_PSEPK RecName: Full=Zinc import ATP-binding protein znuC;     
              EC=3.6.3.-;
          Length = 257

 Score =  106 bits (264), Expect = 3e-25
 Identities = 74/252 (29%), Positives = 120/252 (47%), Gaps = 34/252 (13%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           AL+ +  +  TFGG   + ++  SV  G + ++IGPNGAGKTTL   + G+  P  G++ 
Sbjct: 4   ALIRLDQVGVTFGGEAVLDSIDLSVAPGQIVTLIGPNGAGKTTLVRAVLGLLKPHRGKVW 63

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
              +L  G  P +                              + +D  L  S+LRF  L
Sbjct: 64  RKPKLRIGYMPQK------------------------------IQVDATLPLSVLRF--L 91

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
           R    V R  A   +  VG E  ++S    +S G ++R+ +ARAL  +P++L LDEP  G
Sbjct: 92  RLVPGVDRAAALSALQEVGAEQVIDSPIQTISGGEMQRVLLARALLREPQLLVLDEPVQG 151

Query: 182 FNPKETAEIDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
            +     E+ NL+ ++ D  G  V++V HD+ +VM+ +D+++ LN       G    V  
Sbjct: 152 VDVVGQTELYNLITRLRDRHGCGVLMVSHDLHLVMSATDQVVCLN-RHVCCSGHPEQVSG 210

Query: 241 NPEVIAAYLGTA 252
           +P  +  +  TA
Sbjct: 211 DPAFVELFGKTA 222


>TCYC_BACSU RecName: Full=L-cystine import ATP-binding protein tcyC;
                   EC=3.6.3.-;
          Length = 247

 Score =  106 bits (264), Expect = 3e-25
 Identities = 64/246 (26%), Positives = 125/246 (50%), Gaps = 19/246 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           +L +  L+K+FG    ++ +   +++G V +++GP+G+GKTTL   +  +  P  GE+  
Sbjct: 1   MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLRCLNALEIPNRGELAF 60

Query: 63  GGELVSGLAPHQLA-----RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR 117
               +      + A     R+  G  FQ   +  + TA+ENVM G      RN  +    
Sbjct: 61  DDFSIDFSKKVKQADILKLRRKSGMVFQAYHLFPHRTALENVMEGPVQVQKRNKEE---- 116

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
                     +R+ A +L+  VGL+  ++     +S G  +R+ IARALA +P ++  DE
Sbjct: 117 ----------VRKEAIQLLDKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPELMLFDE 166

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
           P +  +P+   E+  +++ +A+ G T+V+V H++K    ++D ++ ++ G  + +G    
Sbjct: 167 PTSALDPELVGEVLKVIKDLANEGWTMVVVTHEIKFAQEVADEVIFIDGGVIVEQGPPEQ 226

Query: 238 VRDNPE 243
           +   P+
Sbjct: 227 IFSAPK 232


>OPPF_STRMU RecName: Full=Oligopeptide transport ATP-binding protein
           oppF;
          Length = 308

 Score =  106 bits (264), Expect = 3e-25
 Identities = 79/249 (31%), Positives = 134/249 (53%), Gaps = 20/249 (8%)

Query: 3   LLEISDLSKTFGG-----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCD 57
           L+E+ ++S TF       V A+ NVSF++ +G V+ ++G +G+GKTT+   I  +Y    
Sbjct: 8   LVEVKNVSLTFNKGKANQVKAIDNVSFNIYEGEVFGLVGESGSGKTTIGRAILKLYNIDK 67

Query: 58  GEIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSM 115
           GEI   GE +S L    L   RK     FQ+ Q  +N       ++   L + + LVK+ 
Sbjct: 68  GEIDFEGETISKLKGKSLFNFRKKAQMIFQDPQASLNSRMKVRDIIAEGLDVHK-LVKN- 125

Query: 116 LRFPSLRRADAVLREHAAELMVYVGL-EAYLNSEASAMSYGALKRLEIARALAAKPRILF 174
                  +AD   +    +L+  VGL + +L       S G  +R+ IARALA +P+ + 
Sbjct: 126 -------KADRDAK--VQDLLDLVGLNKDHLTRYPHEFSGGQRQRIGIARALAVEPKFII 176

Query: 175 LDEPAAGFNPKETAEIDNLVRKIA-DSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEG 233
            DEP +  +    A++ NL++K+  + G+T + + HD+ MV  ISDRI V+++G+ +  G
Sbjct: 177 ADEPISALDVSIQAQVVNLMQKLQHEQGLTYLFIAHDLSMVKYISDRIGVMHWGKIVEIG 236

Query: 234 SARDVRDNP 242
           ++ +V  +P
Sbjct: 237 TSDEVYHHP 245


>METN_STRT1 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 355

 Score =  106 bits (264), Expect = 3e-25
 Identities = 75/248 (30%), Positives = 126/248 (50%), Gaps = 25/248 (10%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           + AV++VS  +++G +Y ++G +GAGK+TL   I  +  P  G+I +G ++       QL
Sbjct: 22  IQAVKDVSIQIEKGDIYGIVGYSGAGKSTLVRAINLLQVPTAGKITIGEDVTFENGQVQL 81

Query: 76  A-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
                   R+ +G  FQ+  +    TA ENV                LR   L   +   
Sbjct: 82  TTKELRQKRQTIGMIFQHFNLMAQKTAYENVAFA-------------LRHSKLSNEEK-- 126

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
            +    L+  V L     +  + +S G  +R+ IARALA  P IL  DE  +  +PK T 
Sbjct: 127 DKKIRGLLELVDLADRAENYPAQLSGGQKQRVAIARALANDPEILISDESTSALDPKTTK 186

Query: 189 EIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EVI 245
           +I +L++ +    G+TVV++ H+M++V +I +R+ V+  G+ L EGS  D+  NP  ++ 
Sbjct: 187 QILSLLQDLNKKLGLTVVMITHEMQIVKDICNRVAVMQNGQLLEEGSVLDIFSNPQEDLT 246

Query: 246 AAYLGTAA 253
             ++ TAA
Sbjct: 247 QEFIETAA 254


>METN_FUSNN RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 335

 Score =  106 bits (264), Expect = 3e-25
 Identities = 70/245 (28%), Positives = 127/245 (51%), Gaps = 19/245 (7%)

Query: 3   LLEISDLSKTFGGVL-AVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           ++ + +++K +   L AV++V+  V++G ++ +IG +GAGK++L  LI  +  P  G+I 
Sbjct: 1   MITLENVNKIYSNNLHAVKDVNLKVNEGDIFGIIGLSGAGKSSLIRLINRLEEPTSGKIF 60

Query: 62  LGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           + GE +  L   +L   RK +G  FQ+  +  + T  ENV                L   
Sbjct: 61  INGENILNLNKTELLERRKKIGMIFQHFNLLSSRTVEENVAFA-------------LEIA 107

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
           +  + D  + +  +EL+  VGL        S +S G  +R+ IARALA  P IL  DE  
Sbjct: 108 NWNKKD--IGKRVSELLEIVGLSDKAKYYPSQLSGGQKQRVSIARALANNPDILLSDEAT 165

Query: 180 AGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +  +PK T  I  L+++I     +TV+++ H M++V  I +++ +++ GR + +G    +
Sbjct: 166 SALDPKTTKSILELIKEIQQKFSLTVLMITHQMEVVKEICNKVAIMSDGRIVEQGGVHHI 225

Query: 239 RDNPE 243
              P+
Sbjct: 226 FAEPK 230


>METN2_LISMO RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 340

 Score =  106 bits (264), Expect = 3e-25
 Identities = 69/231 (29%), Positives = 120/231 (51%), Gaps = 18/231 (7%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV +V   ++QG ++ V+G +GAGK+TL  +  G+  P  G + +   L+S +   +L
Sbjct: 18  VLAVDHVDLEIEQGEIFGVVGYSGAGKSTLIRMFNGLELPSAGTVEVDNLLISQIRGSKL 77

Query: 76  --ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAA 133
             AR+ +G  FQ+  +  + T  EN+       L+   V+   R           R    
Sbjct: 78  RKARQQIGMIFQHFNLLWSRTVAENIA----FPLEIAGVRGEKR-----------RFRVN 122

Query: 134 ELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNL 193
           EL+  VGLE   N+  + +S G  +R+ IARALA  P++L  DE  +  +P+ T E+  L
Sbjct: 123 ELIRLVGLEGKENAYPAELSGGQKQRVGIARALANNPKVLLCDEATSALDPQTTDEVLEL 182

Query: 194 VRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           +  I     +T++++ H+M ++  I +R+ V+  G+ +  G   DV  +P+
Sbjct: 183 LLDINKRLNLTIIVITHEMHVIRKICNRVAVMENGKVVELGDVLDVFRHPQ 233


>METN1_BACCR RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 346

 Score =  106 bits (264), Expect = 3e-25
 Identities = 68/248 (27%), Positives = 131/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFG----GVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ ++SK F      V A+++ S  V +G V+ +IG +GAGK+TL   +  +  P  G
Sbjct: 1   MIELKNVSKVFTTKKVNVEALKSTSLQVKKGEVFGIIGYSGAGKSTLIRCVNLLEKPTTG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            I +  + ++ L+  +LA  R+ +G  FQ   +   +T  EN+ +              L
Sbjct: 61  NIIVNNQDLTTLSAKELAKARQKIGMIFQGFNLLKTVTVYENIALP-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           R   + + +  + +   + +  V L    ++  S +S G  +R+ IARAL+ +P +L  D
Sbjct: 108 RLAGIPKTE--IEKRVEKYLRIVDLFNRKDAYPSELSGGQKQRVAIARALSHEPEVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I +L+ KI +  GIT++L+ H+M ++  I DR+ V+ +G  +  G+ 
Sbjct: 166 EATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVIESGTV 225

Query: 236 RDVRDNPE 243
           +++  NP+
Sbjct: 226 KEIFTNPQ 233


>ZNUC_HALHL RecName: Full=Zinc import ATP-binding protein znuC;     
              EC=3.6.3.-;
          Length = 260

 Score =  105 bits (263), Expect = 3e-25
 Identities = 71/243 (29%), Positives = 117/243 (48%), Gaps = 35/243 (14%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           L+ + +++ TFGG   +Q+V   V  G + +++G NGAGKTTL  ++ G+     G +  
Sbjct: 17  LIRLQEVAVTFGGRSILQDVRLEVVPGRITTLVGNNGAGKTTLLRVVVGLTHTAAGRVWR 76

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             ++  G  P                               H S+D NL  +  RF +L 
Sbjct: 77  APQVRIGYVPQ------------------------------HFSVDANLPITARRFMALS 106

Query: 123 -RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
            RA+A   +   E++   G+E  L+     +S G ++R+ +ARAL   P +L LDEPAAG
Sbjct: 107 GRANAARWQ---EVVADTGVEELLDQPLQGLSGGEMRRILLARALLQHPSVLALDEPAAG 163

Query: 182 FNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD 240
            + +    +  L+  +    G  VV++ HD+ +VM  SD +L L +GR    G+   V +
Sbjct: 164 LDGRSQGALYRLIGTLRQRYGCAVVIISHDLNLVMAASDEVLCLEHGRIACRGAPASVIE 223

Query: 241 NPE 243
           +PE
Sbjct: 224 HPE 226


>YXEO_BACSU RecName: Full=Probable amino-acid import ATP-binding
           protein yxeO;         EC=3.6.3.-;
          Length = 249

 Score =  105 bits (263), Expect = 3e-25
 Identities = 63/246 (25%), Positives = 125/246 (50%), Gaps = 20/246 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG---- 58
           ++ + ++ K F  ++ +  +   V +G V ++IGP+G+GK+TL   +  +  P  G    
Sbjct: 1   MITVKNIRKAFKDLVVLDGIDLEVKRGEVVAIIGPSGSGKSTLLRCLNLLERPDQGLIEI 60

Query: 59  -EIRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLR 117
            E +L  E  +    H+L R+     FQN  +  N TA++N+             ++++ 
Sbjct: 61  GEAKLNAEKFTRKEAHRL-RQQTAMVFQNYNLFKNKTALQNI------------TEALIV 107

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
                R +A  +    E++  VGLE   +S    MS G  +R+ IARALA  P  + LDE
Sbjct: 108 AQHKPRDEA--KRIGMEILKQVGLEHKADSYPITMSGGQQQRIGIARALAVNPHAILLDE 165

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
           P +  +P+    +  +++ IA+   T+++V H+M     ++D+++ +  G  + +G+  +
Sbjct: 166 PTSALDPELVTGVLQVIKSIAEKQTTMIIVTHEMAFAKEVADQVIFMADGHIIEQGTPEE 225

Query: 238 VRDNPE 243
           + D+P+
Sbjct: 226 LFDHPK 231


>UGPC_RHIME RecName: Full=sn-glycerol-3-phosphate import ATP-binding
           protein ugpC;         EC=3.6.3.20;
          Length = 349

 Score =  105 bits (263), Expect = 3e-25
 Identities = 69/255 (27%), Positives = 130/255 (50%), Gaps = 22/255 (8%)

Query: 1   MALLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGE 59
           MA + + D+ KT+ G + A++ VS ++  G    ++GP+G GK+TL  +I G+ +   GE
Sbjct: 1   MATITLKDVHKTYHGDIAAIRGVSLAIADGEFIVLVGPSGCGKSTLLRMIAGLESITSGE 60

Query: 60  IRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFP 119
           I +G  +V+GL P   + + +   FQN  +  +MT  +N+  G     +RN  K      
Sbjct: 61  ISIGDRVVNGLEP---SERDIAMVFQNYALYPHMTVRQNLSYG---LKNRNTPKE----- 109

Query: 120 SLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPA 179
                   +    A+    + +E +L+ +   +S G  +R+ + RA+  +P     DEP 
Sbjct: 110 -------EIERRIAKAAKSLEIEPFLDRKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPL 162

Query: 180 AGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
           +  + K   ++   ++++  + G T V V HD    M ++DR++VLN GR    G+  ++
Sbjct: 163 SNLDAKLRVQMRVEIKRLQRALGTTSVYVTHDQLEAMTLADRLVVLNGGRIEQVGTPIEL 222

Query: 239 RDNPEV--IAAYLGT 251
            +NP    +A ++G+
Sbjct: 223 YENPATAFVATFIGS 237


>RBSA_VIBVU RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 501

 Score =  105 bits (263), Expect = 3e-25
 Identities = 67/228 (29%), Positives = 117/228 (51%), Gaps = 13/228 (5%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           A+L++S++ K F GV A+   S +V  G V +++G NGAGK+TL  ++TGIY+   GEI 
Sbjct: 4   AILQLSEIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSRDAGEIV 63

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
             G+      P    + G+    Q L +   +T  EN+ +G  ++         + +P +
Sbjct: 64  YQGQSAQFKGPRDSQQAGISIIHQELNLIRELTIAENIFLGREIT----SAFGRIDWPQM 119

Query: 122 -RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
              AD +L    A L V    +  L      +S G  + +EIA+AL+ + +++ +DEP  
Sbjct: 120 YAEADKLL----ARLKVKHSSKTLLGQ----LSLGEQQMVEIAKALSFESKVIIMDEPTD 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
                ET  + +++R++ + G  +V + H +K +  I D I VL  G+
Sbjct: 172 ALTDTETEALFSVIRELREQGCGIVYISHRLKEIFEICDDITVLRDGK 219



 Score = 79.0 bits (193), Expect = 4e-17
 Identities = 61/239 (25%), Positives = 111/239 (46%), Gaps = 21/239 (8%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V +VSF++ +G +  + G  GAG+T L  +I G      G I L    ++ ++P      
Sbjct: 269 VHDVSFTLKRGEILGISGLMGAGRTELMKVIYGALPSERGVINLDNRTINPISPQDGLAN 328

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
           G+    ++ +             G  L L  ++ ++M      + +  V  +H  E++  
Sbjct: 329 GIAYISEDRK-------------GDGLVLGLSVKENMSLCALDKLSKGVQIQHQDEVVAV 375

Query: 139 VGLEAYLNSEASA-------MSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEID 191
                  N +  +       +S G  +++ IA+ L  KP++L LDEP  G +     EI 
Sbjct: 376 DDFIQLFNIKTPSREQIIGNLSGGNQQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIY 435

Query: 192 NLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYLG 250
            L+ K    G++++LV  +M  V+ +SDRILV++ GR   E  A+   D  +++A  +G
Sbjct: 436 QLINKFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRITGEFEAKHA-DQEKLMACAVG 493


>PSTB1_THETN RecName: Full=Phosphate import ATP-binding protein pstB
           1;         EC=3.6.3.27;AltName:
           Full=Phosphate-transporting ATPase 1;
          Length = 239

 Score =  105 bits (263), Expect = 3e-25
 Identities = 71/239 (29%), Positives = 118/239 (49%), Gaps = 20/239 (8%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           +E+ +++    G   ++NV F  ++  +Y+V+GP+GAGK+T+  LI  +  P +G I + 
Sbjct: 3   IELKNVNYFRDGKYILKNVYFKFEKNGIYTVVGPSGAGKSTMLKLINRLIEPTEGAIFIN 62

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G     +    L RK +G  FQ        T  EN+ +G  L  ++N+            
Sbjct: 63  GVEYKNIDVILLRRK-IGMVFQR-PFLFEGTVKENIELGPSLRGEKNI------------ 108

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
            DA+    A  L      + YL  + + +S G  +R+ IARALA  P +L LDEP +  +
Sbjct: 109 -DALFYLEAVGLS-----KDYLFKDVNNLSGGEAQRVSIARALANSPEVLLLDEPTSSLD 162

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
           P  T+ I+ L++++   GI V+LV H+M+    I D  L L  G  +      +  +NP
Sbjct: 163 PTSTSIIEELIKRLNREGIMVILVTHNMEQAKRIGDYTLFLYKGELIEARKTWEFFENP 221


>POTA_VIBVY RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 377

 Score =  105 bits (263), Expect = 3e-25
 Identities = 67/251 (26%), Positives = 131/251 (52%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++ +S +SK+F G   + N++  V+ G   +++GP+G GKTT+  +I G  T  +G+I +
Sbjct: 17  VIRLSGISKSFDGKEIIGNLNLDVNHGEFLTILGPSGCGKTTVLRMIAGFETADNGQITI 76

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             + V+ +   Q   + +   FQ+  +  +MT  +NV  G             LR   + 
Sbjct: 77  DNQDVTNVPAEQ---RHVNTVFQSYALFPHMTVFDNVAFG-------------LRMQKVP 120

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            A+  +     + +  V LE+    +   +S G  +R+ IARA+  KP++L LDE  +  
Sbjct: 121 AAE--IEPRVMDALKMVRLESMAQRKPHQLSGGQQQRIAIARAVVNKPKVLLLDESLSAL 178

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   ++++    GIT + V HD +  +++SDRI+V+  G    +GS R++ ++
Sbjct: 179 DYKLRKQMQIELKQLQRQLGITFIFVTHDQEEALSMSDRIIVMRSGVIEQDGSPREIYED 238

Query: 242 PE--VIAAYLG 250
           P+   +A ++G
Sbjct: 239 PKNLFVARFIG 249


>POTA_VIBVU RecName: Full=Spermidine/putrescine import ATP-binding
           protein potA;         EC=3.6.3.31;
          Length = 377

 Score =  105 bits (263), Expect = 3e-25
 Identities = 67/251 (26%), Positives = 131/251 (52%), Gaps = 21/251 (8%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           ++ +S +SK+F G   + N++  V+ G   +++GP+G GKTT+  +I G  T  +G+I +
Sbjct: 17  VIRLSGISKSFDGKEIIGNLNLDVNHGEFLTILGPSGCGKTTVLRMIAGFETADNGQITI 76

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
             + V+ +   Q   + +   FQ+  +  +MT  +NV  G             LR   + 
Sbjct: 77  DNQDVTNVPAEQ---RHVNTVFQSYALFPHMTVFDNVAFG-------------LRMQKVP 120

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
            A+  +     + +  V LE+    +   +S G  +R+ IARA+  KP++L LDE  +  
Sbjct: 121 AAE--IEPRVMDALKMVRLESMAQRKPHQLSGGQQQRIAIARAVVNKPKVLLLDESLSAL 178

Query: 183 NPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDN 241
           + K   ++   ++++    GIT + V HD +  +++SDRI+V+  G    +GS R++ ++
Sbjct: 179 DYKLRKQMQIELKQLQRQLGITFIFVTHDQEEALSMSDRIIVMRSGVIEQDGSPREIYED 238

Query: 242 PE--VIAAYLG 250
           P+   +A ++G
Sbjct: 239 PKNLFVARFIG 249


>PHNC_WOLSU RecName: Full=Phosphonates import ATP-binding protein
           phnC;         EC=3.6.3.28;
          Length = 275

 Score =  105 bits (263), Expect = 3e-25
 Identities = 75/242 (30%), Positives = 124/242 (51%), Gaps = 15/242 (6%)

Query: 3   LLEISDLSKTF-GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           +L+I +L+K + G  +A++ VS  + +G V  +IGP+GAGK+TL   I  +  P  GE+ 
Sbjct: 1   MLKIENLTKRYKGDEIALKGVSLEIKKGQVVGLIGPSGAGKSTLIRCINRLIEPSSGEVW 60

Query: 62  LGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVG--GHLSLDRNLVKSMLR 117
           L G  +  L+  +L  AR+ MG  FQ   +   ++ +ENV+ G  G+ S  R   +   R
Sbjct: 61  LEGVNLPSLSRTKLKEARREMGMIFQEYALIERLSVMENVLSGRLGYHSFWRTFWR---R 117

Query: 118 FPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDE 177
           FP          E A   +  VGL  + N  A  +S G  +R+ IARALA +P++L +DE
Sbjct: 118 FPEAEV------ERAFYYLERVGLIEHYNKRADQLSGGQRQRVGIARALAQEPKVLLVDE 171

Query: 178 PAAGFNPKETAEIDNLVRKIADSGITVVLVE-HDMKMVMNISDRILVLNYGRKLTEGSAR 236
           P A  +PK + ++               +V  HD+ +     +RI+ L  G  + +G+  
Sbjct: 172 PTASLDPKTSRQVMXXXXXXXXXXXXXAIVNIHDVPLAQAFMERIVGLRAGEVVFDGAPS 231

Query: 237 DV 238
           ++
Sbjct: 232 EL 233


>NODI_BURXL RecName: Full=Nod factor export ATP-binding protein I;  
                 EC=3.6.3.-;AltName: Full=Nodulation ATP-binding
           protein I;
          Length = 304

 Score =  105 bits (263), Expect = 3e-25
 Identities = 71/233 (30%), Positives = 109/233 (46%), Gaps = 17/233 (7%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           A +E   + K++G    V  +SF V  G  + ++GPNGAGKTT   ++ GI  P  G IR
Sbjct: 4   AAIEFDKVKKSYGEKTVVDGLSFHVAPGECFGLLGPNGAGKTTTLRMLLGIAAPDAGTIR 63

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
           L GE +                F NL    + T  EN++V G             R+  +
Sbjct: 64  LCGEPIPXXXXXXXXXXXXXPQFDNLD--PDFTVRENLLVFG-------------RYFGM 108

Query: 122 RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
             A    R     L+ +  LE+  ++  S +S G  +RL +ARAL   P +L +DEP  G
Sbjct: 109 SAAQC--RAMVPPLLEFARLESKADARVSELSGGMKRRLTLARALVNDPDVLIMDEPTTG 166

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGS 234
            +P+    I   +R +   G T++L  H M+    +  R+ V+  GRK+ EG+
Sbjct: 167 LDPQARHLIWERLRSLLARGKTILLTTHFMEEAERLCHRLCVIEEGRKIAEGA 219


>NASD_KLEOX RecName: Full=Nitrate transport protein nasD;
          Length = 262

 Score =  105 bits (263), Expect = 3e-25
 Identities = 75/241 (31%), Positives = 121/241 (50%), Gaps = 23/241 (9%)

Query: 3   LLEISDLSKTF----GGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           L+++  +S+ F    G  LA+QNVSF + +G   S+IG +G GK+TL NLI GI  P +G
Sbjct: 4   LIQVQGVSQRFSTASGEFLALQNVSFDIYEGETISLIGHSGCGKSTLLNLIAGIALPTEG 63

Query: 59  EIRLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRF 118
            +      ++G  P +         FQN  +   +T  +NV     L++D+   +SM   
Sbjct: 64  GLLCDNREIAGPGPERAV------VFQNHSLLPWLTCFDNVA----LAVDQVFRRSM--- 110

Query: 119 PSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
                +    +E     +  V +   L+     +S G  +R+ IARALA KP++L LDEP
Sbjct: 111 -----SKGERKEWIEHNLERVQMGHALHKRPGEISGGMKQRVGIARALAMKPKVLLLDEP 165

Query: 179 AAGFNPKETAEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARD 237
               +    A + + V +I  S   T+V++ HD+   + +SDR+L++  G   T G   D
Sbjct: 166 FGALDALTRAHLQDAVMQIQQSLNTTIVMITHDVDEAVLLSDRVLMMTNGPAATVGEILD 225

Query: 238 V 238
           V
Sbjct: 226 V 226


>METN_SYMTH RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 332

 Score =  105 bits (263), Expect = 3e-25
 Identities = 69/247 (27%), Positives = 127/247 (51%), Gaps = 22/247 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+  L+K F      ++A+ +V+  V +G ++ ++G +GAGK+TL   +  +  P  G
Sbjct: 1   MIELKGLTKVFRQNGQEIVALSDVNLHVPRGQIFGILGQSGAGKSTLIRCVNLLERPTAG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           E+ + G  ++ L+P +L  AR+ MG  FQ   +  + T   NV     ++          
Sbjct: 61  EVWVDGREITRLSPGELRAARREMGMIFQQFNLFDSRTVFGNVAYPLEVA---------- 110

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
            +P  R     +RE   EL+  VGL     +  + +S G  +R+ IARALA  P++L  D
Sbjct: 111 GWPRAR-----IRERVEELLALVGLADKAGAYPNQLSGGQKQRVGIARALAPGPKLLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P  T  +  L+R+I    G+T++L+ H M++V  + D + +L  G+ + +G  
Sbjct: 166 EATSALDPDTTRSVLALLREINRRLGLTILLITHQMEVVKQVCDSVAILEEGKVVEQGGV 225

Query: 236 RDVRDNP 242
            ++   P
Sbjct: 226 LELIGRP 232


>METN_STRT2 RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 355

 Score =  105 bits (263), Expect = 3e-25
 Identities = 75/248 (30%), Positives = 126/248 (50%), Gaps = 25/248 (10%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           + AV++VS  +++G +Y ++G +GAGK+TL   I  +  P  G+I +G ++       QL
Sbjct: 22  IQAVKDVSIQIEKGDIYGIVGYSGAGKSTLVRAINLLQVPTAGKITIGEDVTFEDGKVQL 81

Query: 76  A-------RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVL 128
                   R+ +G  FQ+  +    TA ENV                LR   L   +   
Sbjct: 82  TTKELRQKRQTIGMIFQHFNLMAQKTAYENVAFA-------------LRHSKLSNEEK-- 126

Query: 129 REHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETA 188
            +    L+  V L     +  + +S G  +R+ IARALA  P IL  DE  +  +PK T 
Sbjct: 127 DKKIRGLLELVDLADRAENYPAQLSGGQKQRVAIARALANDPEILISDESTSALDPKTTK 186

Query: 189 EIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EVI 245
           +I +L++ +    G+TVV++ H+M++V +I +R+ V+  G+ L EGS  D+  NP  ++ 
Sbjct: 187 QILSLLQDLNKKLGLTVVMITHEMQIVKDICNRVAVMQNGQLLEEGSVLDIFSNPQEDLT 246

Query: 246 AAYLGTAA 253
             ++ TAA
Sbjct: 247 QEFIETAA 254


>METN_STAHJ RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 341

 Score =  105 bits (263), Expect = 3e-25
 Identities = 68/235 (28%), Positives = 115/235 (48%), Gaps = 26/235 (11%)

Query: 16  VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL 75
           VLAV NV+ +++ G ++ VIG +GAGK+TL  +   +  P              L+  +L
Sbjct: 18  VLAVDNVNLNIETGSIFGVIGFSGAGKSTLIRMFNNLEEPTSXXXXXXXXXXXKLSKAEL 77

Query: 76  ARKG--MGRTFQNLQICMNMTAIENVM----VGGHLSLDRNLVKSMLRFPSLRRADAVLR 129
            RK   +   FQ+  +  + T + N+     + G+     N                   
Sbjct: 78  RRKRQKVSMVFQHFNLLWSRTVLRNITFPLEIAGYSKTKAN------------------- 118

Query: 130 EHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAE 189
           E A EL+  VGL    N+  S +S G  +R+ IARALA +P +L  DE  +  +P+ T E
Sbjct: 119 ERAKELIDLVGLNGRENAYPSELSGGQKQRVGIARALANEPDVLLCDEATSALDPQTTDE 178

Query: 190 IDNLVRKIAD-SGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           I +L+ KI +   +T+V++ H+M ++  + D + V+  GR + +G    V +NP+
Sbjct: 179 ILDLLLKIKERENLTIVIITHEMHVIRRVCDEVAVMESGRVIEQGKVTQVFENPQ 233


>METN_POLSJ RecName: Full=Methionine import ATP-binding protein
           metN;         EC=3.6.3.-;
          Length = 359

 Score =  105 bits (263), Expect = 3e-25
 Identities = 70/248 (28%), Positives = 129/248 (52%), Gaps = 22/248 (8%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+  + +T+ G    V A++ V   ++ G VY +IG +GAGK++L  +I  +  P  G
Sbjct: 1   MIELKSIFQTYKGPTGPVEALRGVDLQINPGEVYGIIGRSGAGKSSLVRVINLLNRPTAG 60

Query: 59  EIRLGGELVSGLAPHQL--ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
           ++ + G  ++ L    L  AR+ +G  FQ+  +  + T   NV +              L
Sbjct: 61  QVLVDGRELTSLNGDALRVARRDIGIIFQHFNLLSSRTVYGNVALP-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
               L   +  ++     L+  VGL A  +   + +S G  +R+ IARALA +P++L  D
Sbjct: 108 EIAGLSAGE--IKARVEPLLDLVGLSALADRYPAQISGGQKQRVGIARALANRPKVLLSD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSA 235
           E  +  +P+ T  I  L+++I  + G+T+VL+ H M+++  ++DR+ V++ GR +  G  
Sbjct: 166 EATSALDPETTRSILGLLQQINKEFGLTIVLITHQMQVIKQVADRVAVIDAGRIVESGPV 225

Query: 236 RDVRDNPE 243
            DV   P+
Sbjct: 226 IDVFTRPQ 233


>METN2_SALTY RecName: Full=Methionine import ATP-binding protein
           metN 2;         EC=3.6.3.-;
          Length = 338

 Score =  105 bits (263), Expect = 3e-25
 Identities = 70/229 (30%), Positives = 116/229 (50%), Gaps = 18/229 (7%)

Query: 18  AVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQL-- 75
           AV +VS  +  G ++ ++G +GAGK+TL   +  +  P  G + + G  +S L    L  
Sbjct: 21  AVDDVSLHIAAGEIFGIVGTSGAGKSTLLRTLNALTRPSQGRVNVNGVEISALDGKALRQ 80

Query: 76  ARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAEL 135
           AR+ +G  FQ+  +    T  +NV                L+     R+    R   AE+
Sbjct: 81  ARQRIGMIFQHFNLMHTRTVAQNVAFS-------------LKAAGWERSKIAPR--VAEI 125

Query: 136 MVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVR 195
           +  VGL    N     +S G  +R+ IARA+A  P +L  DEP +  + + +A I  L+R
Sbjct: 126 LTLVGLADKANRFPVQLSGGQKQRVGIARAIANHPDVLLCDEPTSALDLETSATILALLR 185

Query: 196 KI-ADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPE 243
           +I A  GIT+VL+ H+M ++ +I DR+ V++ G+ +  G   DV  +P+
Sbjct: 186 QINAQLGITIVLITHEMNVIKSICDRVAVMSGGKVVESGEVFDVFAHPQ 234


>METN1_ENTFA RecName: Full=Methionine import ATP-binding protein
           metN 1;         EC=3.6.3.-;
          Length = 356

 Score =  105 bits (263), Expect = 3e-25
 Identities = 68/232 (29%), Positives = 124/232 (53%), Gaps = 22/232 (9%)

Query: 3   LLEISDLSKTFGG----VLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDG 58
           ++E+ ++S TF      + AVQ+VS ++D+G +Y ++G +GAGK+TL  +I  +  P  G
Sbjct: 1   MIELKNISVTFQQKKQEIQAVQDVSLTIDKGDIYGIVGYSGAGKSTLVRVINLLQRPTAG 60

Query: 59  EIRLGGELVSGLAPHQLA--RKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSML 116
            + +  E +   +  +L   RK +G  FQ+  +    T   N+                L
Sbjct: 61  TVIINKENILTFSKKELRQQRKKIGMIFQHFNLMKERTIFSNIDFS-------------L 107

Query: 117 RFPSLRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLD 176
           ++  L +++   R+  + L+  VGL    ++  S +S G  +R+ IARALA  P IL  D
Sbjct: 108 KYSGLSKSER--RQKISHLLELVGLSEKRDAYPSQLSGGQKQRVAIARALANDPEILLCD 165

Query: 177 EPAAGFNPKETAEIDNLVRKI-ADSGITVVLVEHDMKMVMNISDRILVLNYG 227
           E  +  +PK T +I  L++K+  +  +T+VL+ H+M++V  I +++ V+  G
Sbjct: 166 EATSALDPKTTGQILALLKKLNQELNLTIVLITHEMQVVKEICNKVAVMENG 217


>FBPC_BRUSU RecName: Full=Fe(3+) ions import ATP-binding protein
           fbpC;         EC=3.6.3.30;
          Length = 353

 Score =  105 bits (263), Expect = 3e-25
 Identities = 73/248 (29%), Positives = 123/248 (49%), Gaps = 21/248 (8%)

Query: 8   DLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELV 67
           +++K FG   A+ N+S +V+ G + +++GP+G GKTT   L+ G+  P  G I +GG+ V
Sbjct: 13  NVTKKFGNFTALPNLSLTVEPGTLVTLLGPSGCGKTTTLRLLAGLEHPTSGRILVGGKDV 72

Query: 68  SGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAV 127
           + L  ++   + +   FQ+  +  +MT++ENV  G             L     ++ +A 
Sbjct: 73  TNLPANE---RDVSMVFQSYALFPHMTSLENVAYG-------------LESSGFKKNEA- 115

Query: 128 LREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKET 187
            RE A E +  VGL    +   + +S G  +R+ +ARAL  +P++L LDEP +  +    
Sbjct: 116 -RERAEEGLKLVGLGGMGHRLPAELSGGQQQRVAVARALVLEPQVLLLDEPLSNLDAXXX 174

Query: 188 AEIDNLVRKIADS-GITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP--EV 244
                         G T   V HD    + +SD I+V+  G    +GS RD+ + P    
Sbjct: 175 XXXXXXXXXXQQRLGFTADYVTHDQDEALAVSDTIIVMKEGGIAQKGSPRDLYEAPASAF 234

Query: 245 IAAYLGTA 252
           IA ++G A
Sbjct: 235 IADFMGEA 242


>ARAG_ERWCT RecName: Full=Arabinose import ATP-binding protein araG;
                   EC=3.6.3.17;
          Length = 507

 Score =  105 bits (263), Expect = 3e-25
 Identities = 65/225 (28%), Positives = 113/225 (50%), Gaps = 12/225 (5%)

Query: 4   LEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLG 63
           L    + K F GV A+ ++SFS   G +++++G NGAGK+TL  +++G Y+P  GEI + 
Sbjct: 8   LSFHGIGKEFPGVKALSDISFSCHAGQIHALMGENGAGKSTLLKILSGNYSPSAGEIHIQ 67

Query: 64  GELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRR 123
           G+ V           G+   +Q L +   MT  EN+ + G L     +V   L       
Sbjct: 68  GKPVQFSNTMDALNAGVAIIYQELHLVPEMTVAENIYL-GQLPHKYGMVNYSL------- 119

Query: 124 ADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFN 183
               LR  A   + ++GL+   ++    +S G  + +EIA+ALA   +I+  DEP +  +
Sbjct: 120 ----LRYEAKLQLQHLGLDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLS 175

Query: 184 PKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
            +E  ++  ++ ++   G  ++ V H M+ +  +SD I V   GR
Sbjct: 176 AREIEQLFRVITELRSEGRIILYVSHRMEEIFALSDAITVFKDGR 220



 Score = 58.9 bits (141), Expect = 5e-11
 Identities = 48/207 (23%), Positives = 100/207 (48%), Gaps = 7/207 (3%)

Query: 22  VSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKGMG 81
           +S +V QG +  + G  GAG++ L   + G      G++ L G+ +   +P    R+G+ 
Sbjct: 275 ISLNVKQGEIVGLFGLVGAGRSELMKGLFGATKITSGQVLLDGKPLVVNSPIDAIRQGVM 334

Query: 82  RTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRAD-AVLREHAAELMVYVG 140
              ++ +    +  + +V    ++S  R  +K+     +   AD A  R  A  +     
Sbjct: 335 LCPEDRK-ADGIIPVHSVRDNINISARRKSLKAGFIINNQWEADNAAQRIDALNIKTPSD 393

Query: 141 LEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIADS 200
            +  +N     +S G  +++ + R L+ + +++ LDEP  G +     EI +++ ++A+ 
Sbjct: 394 EQLIMN-----LSGGNQQKVILGRWLSEEMKVILLDEPTRGIDVGAKHEIYHVIYELANQ 448

Query: 201 GITVVLVEHDMKMVMNISDRILVLNYG 227
           GI V+    D+  V+ ++DRI+V+  G
Sbjct: 449 GIAVLFASSDLPEVLGLADRIIVMREG 475


>RGMG_PSEU2 RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein;       
           EC=3.6.3.17;
          Length = 525

 Score =  105 bits (262), Expect = 4e-25
 Identities = 72/248 (29%), Positives = 117/248 (47%), Gaps = 12/248 (4%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLEIS +SK F GV+A+ +V   V  G V +++G NGAGK+TL  +I GIY P  GEIRL
Sbjct: 32  LLEISHVSKGFPGVVALNDVQLRVRPGSVLALMGENGAGKSTLMKIIAGIYQPDAGEIRL 91

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ VS   P    + G+    Q L +   M+  EN+ +G       ++V          
Sbjct: 92  RGKPVSFDTPLSALQAGIAMIHQELNLMPFMSIAENIWIGREQLNGLHMVD--------- 142

Query: 123 RADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGF 182
                +    AEL+  + ++         +S    + +EIA+A++    +L +DEP +  
Sbjct: 143 --HREMHRCTAELLERLRIKLDPEELVGTLSIAERQMVEIAKAVSYNSDVLIMDEPTSAI 200

Query: 183 NPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNP 242
              E A + +++  +   G  ++ + H M  V  I+D + V   G  +    A D  D  
Sbjct: 201 TETEVAHLFSIISDLRAQGKGIIYITHKMNEVFEIADEVAVFRDGAYIGLQRA-DSMDGD 259

Query: 243 EVIAAYLG 250
            +I   +G
Sbjct: 260 SLITMMVG 267



 Score = 70.5 bits (171), Expect = 2e-14
 Identities = 57/229 (24%), Positives = 109/229 (47%), Gaps = 12/229 (5%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LL ++ LS    G+   ++VSF +  G V  + G  G+G+T +   + GI     GE+R 
Sbjct: 285 LLSVNRLS--LNGIF--KDVSFDLRAGEVLGIAGLMGSGRTNVAETLFGITPSDSGEVRF 340

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            G+ V    PHQ    G     ++ ++      + +VM    +++  N   +   F   +
Sbjct: 341 DGKTVHIGDPHQAIELGFALLTEDRKLTGLFPCL-SVMENMEMAVLANYAGN--GFVQQK 397

Query: 123 RADAVLREHAAELMVYV-GLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAG 181
              +   +   +L V    LE  +++    +S G  ++  +AR L   P++L LDEP  G
Sbjct: 398 ALRSQCEDMCKKLRVKTPSLEQCIDT----LSGGNQQKALLARWLMTNPKVLILDEPTRG 453

Query: 182 FNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKL 230
            +     EI  L+  +A  G+ V+++  ++  V+ +SDR++V++ G  +
Sbjct: 454 IDVGAKVEIYRLISLLASEGMAVIMISSELPEVLGMSDRVMVMHEGEMM 502


>RGMG_BACHD RecName: Full=Putative ribose/galactose/methyl
           galactoside import ATP-binding protein;       
           EC=3.6.3.17;
          Length = 522

 Score =  105 bits (262), Expect = 4e-25
 Identities = 64/240 (26%), Positives = 120/240 (50%), Gaps = 18/240 (7%)

Query: 3   LLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRL 62
           LLE+ D++K F GV A+  V   V +G V++++G NGAGK+TL  ++ G+Y P +G+I  
Sbjct: 6   LLEMVDITKEFPGVKALDRVQLKVRKGSVHALMGENGAGKSTLMKILIGMYKPNEGKIIF 65

Query: 63  GGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLR 122
            GE V+  + +    KG+    Q L     MT  EN+ +G              R P+  
Sbjct: 66  DGEEVTFNSINDALDKGISMIHQELSPIPEMTVAENIFLG--------------REPTFG 111

Query: 123 RADAV----LREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEP 178
           ++  V    L E    L+  + +      +   +S    + +EIA+A++   +++ +DEP
Sbjct: 112 KSGLVDNKKLIEMTRNLLESLEINIDPRKKMGELSIANTQMIEIAKAISFHSKLVIMDEP 171

Query: 179 AAGFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDV 238
            +    KE A++  ++  +   G+ ++ + H M  +  I+D I V   G+ +   +A+++
Sbjct: 172 TSAITEKEVAQLFKMIESLKKKGVGIIYITHKMSELDEIADDISVFRDGKYIGTDTAKNL 231



 Score = 72.8 bits (177), Expect = 3e-15
 Identities = 56/236 (23%), Positives = 115/236 (48%), Gaps = 13/236 (5%)

Query: 20  QNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARKG 79
           ++VSF V +G +    G  G+G+T +   I G+     GEI + G+     +P    +  
Sbjct: 273 EDVSFEVRKGEIVGFAGLMGSGRTEVLETIFGVKEAESGEIFVNGQKARIKSPQDAVKNN 332

Query: 80  MGRTFQNLQIC---MNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELM 136
           MG   ++ ++    + ++  EN++    +++D+ +    L    +++     ++      
Sbjct: 333 MGFLTEDRKLTGLFLPLSVRENMIT---VNIDKYINMGWLNGKRVKKDCEQQKQK----- 384

Query: 137 VYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRK 196
           +Y+   + +      +S G  +++ +AR L   P ILFLDEP  G +    +E  NL+ +
Sbjct: 385 LYIKTPS-IEQIVENLSGGNQQKVLLARWLLKNPDILFLDEPTRGIDVGAKSEFYNLIFE 443

Query: 197 IADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYLGTA 252
           +A  G  +V+V  +M  ++ + DRILV++ G K+T    R+  +  +++    G A
Sbjct: 444 LASQGKAIVVVSSEMAEILGLCDRILVMHEG-KVTGELTREEANQEKIMQYATGQA 498


>RBSA_VIBVY RecName: Full=Ribose import ATP-binding protein rbsA;   
                EC=3.6.3.17;
          Length = 501

 Score =  105 bits (262), Expect = 4e-25
 Identities = 67/228 (29%), Positives = 117/228 (51%), Gaps = 13/228 (5%)

Query: 2   ALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIR 61
           A+L++S++ K F GV A+   S +V  G V +++G NGAGK+TL  ++TGIY+   GEI 
Sbjct: 4   AILQLSEIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSRDAGEIV 63

Query: 62  LGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSL 121
             G+      P    + G+    Q L +   +T  EN+ +G  ++         + +P +
Sbjct: 64  YQGQPAQFKGPRDSQQAGISIIHQELNLIRELTIAENIFLGREIT----SAFGRIDWPQM 119

Query: 122 -RRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA 180
              AD +L    A L V    +  L      +S G  + +EIA+AL+ + +++ +DEP  
Sbjct: 120 YAEADKLL----ARLKVKHSSKTLLGQ----LSLGEQQMVEIAKALSFESKVIIMDEPTD 171

Query: 181 GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGR 228
                ET  + +++R++ + G  +V + H +K +  I D I VL  G+
Sbjct: 172 ALTDTETEALFSVIRELREQGCGIVYISHRLKEIFEICDDITVLRDGK 219



 Score = 78.6 bits (192), Expect = 6e-17
 Identities = 61/239 (25%), Positives = 111/239 (46%), Gaps = 21/239 (8%)

Query: 19  VQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGLAPHQLARK 78
           V +VSF++ +G +  + G  GAG+T L  +I G      G I L    ++ ++P      
Sbjct: 269 VHDVSFTLKRGEILGISGLMGAGRTELMKVIYGALPSERGVINLDNRTINPVSPQDGLAN 328

Query: 79  GMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVY 138
           G+    ++ +             G  L L  ++ ++M      + +  V  +H  E++  
Sbjct: 329 GIAYISEDRK-------------GDGLVLGLSVKENMSLCALDKLSKGVQIQHQDEVVAV 375

Query: 139 VGLEAYLNSEASA-------MSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEID 191
                  N +  +       +S G  +++ IA+ L  KP++L LDEP  G +     EI 
Sbjct: 376 DDFIQLFNIKTPSREQIIGNLSGGNQQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIY 435

Query: 192 NLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYLG 250
            L+ K    G++++LV  +M  V+ +SDRILV++ GR   E  A+   D  +++A  +G
Sbjct: 436 QLINKFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRITGEFEAKHA-DQEKLMACAVG 493


>RBSA3_RHIME RecName: Full=Ribose import ATP-binding protein rbsA 3;
                   EC=3.6.3.17;
          Length = 504

 Score =  105 bits (262)