BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE40088.1 rpal2 ABE40088.1 GIB00345CH01 "transcriptional
regulator, TetR family"
         (217 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SLMA_HAEDU RecName: Full=HTH-type protein slmA;                        40   2e-05
ACRR_SHIFL RecName: Full=HTH-type transcriptional regulator acrR...    39   4e-05
ACRR_ECOLI RecName: Full=HTH-type transcriptional regulator acrR...    39   4e-05
ACRR_ECOL6 RecName: Full=HTH-type transcriptional regulator acrR...    39   4e-05
Y1255_MYCTU RecName: Full=Uncharacterized HTH-type transcription...    39   6e-05
SLMA_ACTPJ RecName: Full=HTH-type protein slmA;                        38   7e-05
SLMA_ACTP7 RecName: Full=HTH-type protein slmA;                        38   7e-05
SLMA_ACTP2 RecName: Full=HTH-type protein slmA;                        38   7e-05
YCFQ_ECOLI RecName: Full=Uncharacterized HTH-type transcriptiona...    36   3e-04
SLMA_VIBFM RecName: Full=HTH-type protein slmA;                        36   3e-04
SLMA_VIBF1 RecName: Full=HTH-type protein slmA;                        35   5e-04
SLMA_VIBCH RecName: Full=HTH-type protein slmA;                        35   5e-04
YFIR_BACSU RecName: Full=Uncharacterized HTH-type transcriptiona...    35   6e-04
SLMA_VIBHB RecName: Full=HTH-type protein slmA;                        35   6e-04
SLMA_VIBPA RecName: Full=HTH-type protein slmA;                        35   8e-04

>SLMA_HAEDU RecName: Full=HTH-type protein slmA;
          Length = 202

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 51  QGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIMERMTQEVRDYFDAA---PSHTGL 107
           QG    T   +AKAVG+S  AL + F  K+ +   ++ER+ Q +  Y +A+    + T L
Sbjct: 32  QGMQRVTTERLAKAVGVSEGALYRYFPSKSKMFEALIERIEQTLTSYINASKRKENSTAL 91

Query: 108 AP---LWTMLKDLIGGMGSGEDAAGHLLLY 134
           A    L+T+++      G      GH L++
Sbjct: 92  AVKAILYTVIEFARKNPGVTRILTGHALMF 121


>ACRR_SHIFL RecName: Full=HTH-type transcriptional regulator
          acrR;AltName: Full=Potential acrAB operon repressor;
          Length = 215

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 40 ILDTAQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIME 88
          ILD A  +  +QG S  +L ++AKA G++R A+   F DK+ L   I E
Sbjct: 16 ILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWE 64


>ACRR_ECOLI RecName: Full=HTH-type transcriptional regulator
          acrR;AltName: Full=Potential acrAB operon repressor;
          Length = 215

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 40 ILDTAQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIME 88
          ILD A  +  +QG S  +L ++AKA G++R A+   F DK+ L   I E
Sbjct: 16 ILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWE 64


>ACRR_ECOL6 RecName: Full=HTH-type transcriptional regulator
          acrR;AltName: Full=Potential acrAB operon repressor;
          Length = 215

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 40 ILDTAQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIME 88
          ILD A  +  +QG S  +L ++AKA G++R A+   F DK+ L   I E
Sbjct: 16 ILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWE 64


>Y1255_MYCTU RecName: Full=Uncharacterized HTH-type
          transcriptional regulator Rv1255c/MT1294;
          Length = 202

 Score = 38.5 bits (88), Expect = 6e-05
 Identities = 18/57 (31%), Positives = 33/57 (57%)

Query: 38 DDILDTAQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIMERMTQEV 94
          D ILD A+ +  ++ P+   ++++AKA G SRA L + F  +  L+   + R T+ +
Sbjct: 17 DRILDAAERLFTQRDPASIGMNEIAKAAGCSRATLYRYFDSREALRTAYVHRETRRL 73


>SLMA_ACTPJ RecName: Full=HTH-type protein slmA;
          Length = 202

 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 52  GPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIMERMTQEVRDYFDAA------PSHT 105
           G    T   +AKAVG+S  AL + F  K  +   ++ER+ Q +  Y +A+       + T
Sbjct: 33  GMQRVTTERLAKAVGVSEGALYRYFPSKTKMFEALIERIEQTLTGYINASKRKENTTAST 92

Query: 106 GLAPLWTMLKDLIGGMGSGEDAAGHLLLYWGD 137
             A L+T+++      G      GH L++  D
Sbjct: 93  VKAILYTVIEFARKNPGVTRILTGHALMFEDD 124


>SLMA_ACTP7 RecName: Full=HTH-type protein slmA;
          Length = 202

 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 52  GPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIMERMTQEVRDYFDAA------PSHT 105
           G    T   +AKAVG+S  AL + F  K  +   ++ER+ Q +  Y +A+       + T
Sbjct: 33  GMQRVTTERLAKAVGVSEGALYRYFPSKTKMFEALIERIEQTLTGYINASKRKENTTAST 92

Query: 106 GLAPLWTMLKDLIGGMGSGEDAAGHLLLYWGD 137
             A L+T+++      G      GH L++  D
Sbjct: 93  VKAILYTVIEFARKNPGVTRILTGHALMFEDD 124


>SLMA_ACTP2 RecName: Full=HTH-type protein slmA;
          Length = 202

 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 52  GPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIMERMTQEVRDYFDAA------PSHT 105
           G    T   +AKAVG+S  AL + F  K  +   ++ER+ Q +  Y +A+       + T
Sbjct: 33  GMQRVTTERLAKAVGVSEGALYRYFPSKTKMFEALIERIEQTLTGYINASKRKENTTAST 92

Query: 106 GLAPLWTMLKDLIGGMGSGEDAAGHLLLYWGD 137
             A L+T+++      G      GH L++  D
Sbjct: 93  VKAILYTVIEFARKNPGVTRILTGHALMFEDD 124


>YCFQ_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
          regulator ycfQ;
          Length = 210

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 19/59 (32%), Positives = 30/59 (50%)

Query: 31 RPKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIMER 89
          RPK+   D  LD A  +  + G    +L+D+ +A G     L   FT+K  L R +++R
Sbjct: 15 RPKVFDRDAALDKAMKLFWQHGYEATSLADLVEATGAKAPTLYAEFTNKEGLFRAVLDR 73


>SLMA_VIBFM RecName: Full=HTH-type protein slmA;
          Length = 196

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 18/65 (27%), Positives = 35/65 (53%)

Query: 30 PRPKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIMER 89
          PR     D+ +   A+++   +G +  T + +AK VG+S AAL + F  KA +   ++E 
Sbjct: 4  PRKPNRRDEILQALAEMLESNEGAARITTAKLAKQVGVSEAALYRHFPSKAKMFEGLIEF 63

Query: 90 MTQEV 94
          + + +
Sbjct: 64 IEESI 68


>SLMA_VIBF1 RecName: Full=HTH-type protein slmA;
          Length = 196

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 18/59 (30%), Positives = 32/59 (54%)

Query: 30 PRPKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIME 88
          PR     D+ +   A+++   +G +  T + +AK VG+S AAL + F  KA +   ++E
Sbjct: 4  PRKPNRRDEILQALAEMLESNEGAARITTAKLAKQVGVSEAALYRHFPSKAKMFEGLIE 62


>SLMA_VIBCH RecName: Full=HTH-type protein slmA;
          Length = 196

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 33 KLHSDDDILDT-AQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIME 88
          K++  ++IL   A+++   +G S  T + +AK VG+S AAL + F  KA +   ++E
Sbjct: 6  KINRREEILQALAEMLESNEGASRITTAKLAKQVGVSEAALYRHFPSKARMFEGLIE 62


>YFIR_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
           regulator yfiR;
          Length = 205

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 33  KLHSDD---DILDTAQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIMER 89
           K H D    +IL+ A+ V  R+G    T+ DV +  G SR  +   F+    + RRI+E 
Sbjct: 7   KEHKDKRQAEILEAAKTVFKRKGFELTTMKDVVEESGFSRGGVYLYFSSTEEMFRRIIET 66

Query: 90  MTQEVRDYFDAAPSHTGL-APLWTMLKDLIGGM 121
              E     D +  H  + A + + L +L  G+
Sbjct: 67  GLDEGLRKLDKSAEHQSVWASISSYLDELTEGL 99


>SLMA_VIBHB RecName: Full=HTH-type protein slmA;
          Length = 196

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 33 KLHSDDDILDT-AQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIME 88
          K +  ++IL   AQ++   +G S  T + +AK VG+S AAL + F  KA +   ++E
Sbjct: 6  KTNRREEILQALAQMLESTEGASRITTAKLAKQVGVSEAALYRHFPSKARMFEGLIE 62


>SLMA_VIBPA RecName: Full=HTH-type protein slmA;
          Length = 196

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 33 KLHSDDDILDT-AQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIME 88
          K +  ++IL   AQ++   +G S  T + +AK VG+S AAL + F  KA +   ++E
Sbjct: 6  KSNRREEILQALAQMLESAEGASRITTAKLAKQVGVSEAALYRHFPSKARMFEGLIE 62


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.308    0.126    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 10,089,259,657
Number of extensions: 399909186
Number of successful extensions: 1093908
Number of sequences better than 1.0e-03: 32073
Number of HSP's gapped: 1029620
Number of HSP's successfully gapped: 41714
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.2 bits)