# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_24355.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABE38181.1  [L=219]
Description: rpal2 ABE38181.1 GIB00345CH01 "ABC transporter related"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.6e-19   72.3   0.0    3.6e-19   71.9   0.0    1.2  1  PF00005  ABC transporter
  ------ inclusion threshold ------
      0.019   16.8   0.0       0.17   13.8   0.0    2.0  1  PF02463  RecF/RecN/SMC N terminal domain
      0.087   14.7   0.0       0.12   14.2   0.0    1.2  1  PF03193  Protein of unknown function, DUF258
       0.28   13.0   0.0         53    5.5   0.0    2.1  2  PF01078  Magnesium chelatase, subunit ChlI
       0.31   12.8   0.0       0.47   12.2   0.0    1.2  1  PF06414  Zeta toxin
       0.32   13.9   0.0        1.7   11.5   0.0    2.1  1  PF00004  ATPase family associated with various cellular acti
       0.47   13.0   0.0       0.97   12.0   0.0    1.5  1  PF01371  Trp repressor protein
       0.63   12.4   0.0        1.5   11.1   0.0    1.7  1  PF01637  Archaeal ATPase
        1.3   10.4   0.0        2.8    9.3   0.0    1.6  1  PF03969  AFG1-like ATPase
        1.6   10.8   0.0        3.3    9.8   0.0    1.5  1  PF02492  CobW/HypB/UreG, nucleotide-binding domain
          2   10.7   0.0        3.8    9.8   0.0    1.4  1  PF02367  Uncharacterised P-loop hydrolase UPF0079
        3.1   10.0   0.0        4.9    9.4   0.0    1.3  1  PF05729  NACHT domain
        4.1    8.9   0.0        5.9    8.3   0.0    1.3  1  PF00437  Type II/IV secretion system protein
        7.4    8.3   0.0         12    7.6   0.0    1.3  1  PF04670  Gtr1/RagA G protein conserved region
        7.6    9.1   0.0         21    7.7   0.0    1.7  1  PF03873  Anti sigma-E protein RseA, C-terminal domain
        7.8    8.9   0.1         16    7.9   0.1    1.5  1  PF07728  AAA domain (dynein-related subfamily)
        8.1    8.5   0.1    1.2e+02    4.7   0.0    2.1  2  PF05707  Zonular occludens toxin (Zot)
         11    8.4   0.0         18    7.7   0.0    1.3  1  PF03266  Protein of unknown function, DUF265
         15    7.7   0.0         24    7.1   0.0    1.3  1  PF00485  Phosphoribulokinase / Uridine kinase family
         18    7.6   0.0         29    6.9   0.0    1.3  1  PF01583  Adenylylsulphate kinase
         18    7.2   0.1         29    6.5   0.0    1.3  1  PF04665  Poxvirus A32 protein
         20    7.2   0.0         42    6.1   0.0    1.5  1  PF01695  IstB-like ATP binding protein
         22    6.8   0.0         42    5.9   0.0    1.4  1  PF02562  PhoH-like protein
         26    7.2   0.0         63    6.0   0.0    1.6  1  PF03205  Molybdopterin guanine dinucleotide synthesis protei
         26    4.7   0.1         33    4.3   0.1    1.0  1  PF12128  Protein of unknown function (DUF3584)
         26    7.4   0.0         43    6.7   0.0    1.3  1  PF05359  Domain of Unknown Function (DUF748)
         28    7.6   0.0         51    6.7   0.0    1.4  1  PF00910  RNA helicase
         29    7.8   0.0         52    7.0   0.0    1.4  1  PF08477  Miro-like protein
         33    5.8   0.0         47    5.2   0.0    1.1  1  PF03215  Rad17 cell cycle checkpoint protein
         34    6.6   0.0         65    5.6   0.0    1.4  1  PF10662  Ethanolamine utilisation - propanediol utilisation
         34    6.0   0.0         60    5.2   0.0    1.3  1  PF11004  Protein of unknown function (DUF2843)
         47    5.8   0.1         75    5.1   0.0    1.3  1  PF09439  Signal recognition particle receptor beta subunit
         59    5.6   0.0    1.2e+02    4.6   0.0    1.4  1  PF00488  MutS domain V
         60    4.6   0.0         63    4.5   0.0    1.1  1  PF02516  Oligosaccharyl transferase STT3 subunit
         61    5.6   0.0         93    5.0   0.0    1.2  1  PF00625  Guanylate kinase
         63    5.1   0.0         77    4.8   0.0    1.1  1  PF09848  Uncharacterized conserved protein (DUF2075)
         73    4.9   0.0         63    5.1   0.0    1.2  1  PF07693  KAP family P-loop domain
         74    5.4   0.0    1.2e+02    4.7   0.0    1.3  1  PF00158  Sigma-54 interaction domain
         76    4.9   0.0    1.2e+02    4.2   0.0    1.2  1  PF01802  Herpesvirus VP23 like capsid protein
         83    5.2   0.0    1.2e+02    4.6   0.0    1.3  1  PF07181  VirC2 protein
         87    5.4   0.0    1.8e+02    4.4   0.0    1.5  1  PF02513  Spin/Ssty Family
         90    5.2   0.0    1.4e+02    4.6   0.0    1.2  1  PF01443  Viral (Superfamily 1) RNA helicase
         96    4.0   0.0    1.4e+02    3.4   0.0    1.1  1  PF10443  RNA12 protein
      1e+02    5.4   0.0      2e+02    4.5   0.0    1.5  1  PF09303  KCNMB2, ball and chain domain
    1.3e+02    5.4   0.0    5.6e+02    3.4   0.0    1.8  1  PF00169  PH domain
    1.5e+02    4.5   0.0    2.9e+02    3.5   0.0    1.4  1  PF03029  Conserved hypothetical ATP binding protein
    1.6e+02    3.9   0.0    3.4e+02    2.8   0.0    1.5  1  PF06745  KaiC
    1.8e+02    5.3   0.0    3.3e+02    4.5   0.0    1.4  1  PF10830  Protein of unknown function (DUF2553)
      2e+02    4.3   0.2    4.3e+02    3.2   0.1    1.6  1  PF11346  Protein of unknown function (DUF3149)
    2.2e+02    4.2   0.0    4.1e+02    3.3   0.0    1.4  1  PF08857  Putative ParB-like nuclease
    2.2e+02    4.9   0.0    3.9e+02    4.1   0.0    1.3  1  PF12200  Domain of unknown function (DUF3597)
    2.3e+02    4.5   0.1    3.6e+02    3.9   0.1    1.2  1  PF07046  Cytoplasmic repetitive antigen (CRA) like repeat
    2.4e+02    3.8   0.0    3.4e+02    3.4   0.0    1.2  1  PF07675  Cleaved Adhesin Domain
    2.9e+02    3.6   0.0    4.7e+02    2.9   0.0    1.3  1  PF07931  Chloramphenicol phosphotransferase-like protein
    3.6e+02    3.8   0.0    5.7e+02    3.2   0.0    1.2  1  PF12034  Domain of unknown function (DUF3520)
    4.4e+02    4.0   0.4      8e+02    3.2   0.3    1.4  1  PF07276  Apopolysialoglycoprotein (PSGP)
    2.4e+03    1.4   0.0    3.9e+03    0.7   0.0    1.2  1  PF00748  Calpain inhibitor


Domain and alignment annotation for each model:
>> PF00005  ABC transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   71.9   0.0     2e-22   3.6e-19       1     117 [.      42     165 ..      42     166 .. 0.94

  Alignments for each domain:
  == domain 1    score: 71.9 bits;  conditional E-value: 2e-22
                 HHHHHHHTTSS------EEE-...--BGGGB-HHHHH..EEEE-------.--BHHHHHH----S--.....-HHHHHHHHHH---HHHH--------- CS
                 xxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxx.....xxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF00005   1 STLlklltgelkptegeievd.ndrkdlesdkleklr..igyipqdpllfpeltvrenldmakeekk.....tdkrieevlekvgldelldksrvstLS 91 
                 ++Ll+ll   l+pt g +++  nd+  l +d++++lr  ig + qd +l  ++t  en++   + +       +k++ ++l+ vgl e++d   +  LS
  ABE38181.1  42 TSLLRLLFLSLRPTRGLVNLFgNDVSLLTKDEVSALRqrIGIVLQDFRLLDHMTTYENVALPFRVSGrdessYRKEVIDLLKWVGLGERMDA-LPPVLS 139
                 78*******************889989999*****************************7654444488888********************.****** PP

                 ---HHHHHHHHHHTT--SEEEEESTT CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF00005  92 gGqkqrvalArallkkpklllLDEPt 117
                 gG+kqr a+Ara++ +p+lll+DEPt
  ABE38181.1 140 GGEKQRAAIARAVIGRPQLLLADEPT 165
                 *************************9 PP

>> PF02463  RecF/RecN/SMC N terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.8   0.0   9.6e-05      0.17      24     205 ..      28     203 ..      22     215 .. 0.66

  Alignments for each domain:
  == domain 1    score: 13.8 bits;  conditional E-value: 9.6e-05
                 -SEEEE--------HHHHHHHHHH------.-------TTSS----------EEEEEEEEE----E........EEEEEEEE----EEEEE---EE-HH CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF02463  24 ksftaivGpNGSGKsnvldAilFvLGeksakklrseklsdlihkskskakvksaeveitfdnedke.lvieeeevsitrrvkrkgeseykingkevtkk 121
                 +sf++++Gp G+GK+++l  +   L+ + ++ l +   +d+   +k++ ++ + ++ i++++      +++ e+v +  rv+  +es+y+        k
  ABE38181.1  28 HSFQFLTGPSGAGKTSLLRLL--FLSLRPTRGLVNLFGNDVSLLTKDEVSALRQRIGIVLQDFRLLdHMTTYENVALPFRVSGRDESSYR--------K 116
                 679***************988..6888888888877777765555666666667777766444333233666667777777777777765........4 PP

                 HHHHHHHCTT--TT......G-----HHHHHHHHHHHHHTSS--SEEEESSTTTT--HHHHHHHHHHHHHH-BT.BEEEEE-S-HHHHTT- CS
                 xxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxx RF
     PF02463 122 evaellesagiske......lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn.aQfivislreemleka 205
                 ev +ll+ +g+ +       +LSgGek+ +a+a       + +  l l De   + D +  +++ +l+ e +k+ + +++ +++ +++ + 
  ABE38181.1 117 EVIDLLKWVGLGERmdalppVLSGGEKQRAAIARA----VIGRPQLLLADEPTGNVDPTLGRRLLRLFVELNKSgTAVVIATHDINLMDQY 203
                 555555555554444444449******99998743....3445557777888888888887777777777776635555555666666555 PP

>> PF03193  Protein of unknown function, DUF258
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.2   0.0   6.6e-05      0.12      27      59 ..      19      52 ..       9     101 .. 0.80

  Alignments for each domain:
  == domain 1    score: 14.2 bits;  conditional E-value: 6.6e-05
                HHHHHHCTT.SBEEEE-------HHHHHHH---- CS
     PF03193 27 eelaellkd.ktsvlvGqSGvGKSsLinallpel 59
                ++l++ +   ++++l+G+SG+GK+sL+  l  +l
  ABE38181.1 19 RDLNFAIPAhSFQFLTGPSGAGKTSLLRLLFLSL 52
                56666666657899*************9987665 PP

>> PF01078  Magnesium chelatase, subunit ChlI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0      0.03        53      23      42 ..      28      48 ..      18      73 .. 0.81
   2 ?    5.5   0.0     0.031        55       6      65 ..     139     199 ..     136     212 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.03
     PF01078 23 Hnl.llvGppGsGKtmlakrl 42
                H++ +l+Gp+G+GKt l + l
  ABE38181.1 28 HSFqFLTGPSGAGKTSLLRLL 48
                5543789********998766 PP

  == domain 2    score: 5.5 bits;  conditional E-value: 0.031
     PF01078   6 kGqeeakraleiaaaGgHnlllvG.ppGsGKtmlakrlpsllpplseeealevakiasvag 65 
                  G e+++ a+  a++G+ +lll+  p G     l +rl  l+ +l+++ +  v + + ++ 
  ABE38181.1 139 SGGEKQRAAIARAVIGRPQLLLADePTGNVDPTLGRRLLRLFVELNKSGTAVVIATHDINL 199
                 688999****************9725699999************99988777777666654 PP

>> PF06414  Zeta toxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.2   0.0   0.00027      0.47      20      49 ..      32      62 ..      27      79 .. 0.87

  Alignments for each domain:
  == domain 1    score: 12.2 bits;  conditional E-value: 0.00027
     PF06414 20 llgGqpGAGKtslaellleela.agnivrid 49
                +l G+ GAGKtsl++ll  +l+ +++ v++ 
  ABE38181.1 32 FLTGPSGAGKTSLLRLLFLSLRpTRGLVNLF 62
                899*************999988888888775 PP

>> PF00004  ATPase family associated with various cellular activities (AAA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.5   0.0   0.00096       1.7       3      51 ..      33      86 ..      31      99 .. 0.74

  Alignments for each domain:
  == domain 1    score: 11.5 bits;  conditional E-value: 0.00096
                EE-------HHHHHHHHHHTT.....CEEEEEETTSSSSST.HCHHHHHHHHHH CS
     PF00004  3 lyGppGtGKTllakavakelg.....vefleisgsellskyvgesekkirelfk 51
                l+Gp G GKT+l + +  +l      v+++  ++s l+++ v++  ++i  +++
  ABE38181.1 33 LTGPSGAGKTSLLRLLFLSLRptrglVNLFGNDVSLLTKDEVSALRQRIGIVLQ 86
                89**************99985444456666666666666666666666666655 PP

>> PF01371  Trp repressor protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.0   0.0   0.00055      0.97      26      61 ..      68     106 ..      56     108 .. 0.85

  Alignments for each domain:
  == domain 1    score: 12.0 bits;  conditional E-value: 0.00055
     PF01371  26 llTpdErealaqRlrvvke...LLkeelsqreiaeelgv 61 
                 llT dE++al qR+ +v +   LL++  +++++a    v
  ABE38181.1  68 LLTKDEVSALRQRIGIVLQdfrLLDHMTTYENVALPFRV 106
                 89**************96444499999999999866555 PP

>> PF01637  Archaeal ATPase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.1   0.0   0.00085       1.5      21      40 ..      29      48 ..      18     119 .. 0.81

  Alignments for each domain:
  == domain 1    score: 11.1 bits;  conditional E-value: 0.00085
                SEEEEE--TT---HHHHHHH CS
     PF01637 21 siiviyGprrsGKTaLlkei 40
                s++++ Gp + GKT+Ll+ +
  ABE38181.1 29 SFQFLTGPSGAGKTSLLRLL 48
                789**************965 PP

>> PF03969  AFG1-like ATPase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.0    0.0016       2.8      66     111 ..      32      78 ..      24     206 .. 0.72

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.0016
     PF03969  66 YlwGgvGrGKtyLldlffesl.pvekkrrvhfhafmarvhdeltklr 111
                 +l G+ G GKt Ll l f sl p++   ++  +++ + + de+ +lr
  ABE38181.1  32 FLTGPSGAGKTSLLRLLFLSLrPTRGLVNLFGNDVSLLTKDEVSALR 78 
                 799*************9999835555566666888888888888888 PP

>> PF02492  CobW/HypB/UreG, nucleotide-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.8   0.0    0.0019       3.3       5      21 ..      33      49 ..      30      84 .. 0.80

  Alignments for each domain:
  == domain 1    score: 9.8 bits;  conditional E-value: 0.0019
                EE-------HHHHHHHH CS
     PF02492  5 ltGflGsGKTtLlekll 21
                ltG+ G+GKT+Ll+ l 
  ABE38181.1 33 LTGPSGAGKTSLLRLLF 49
                89***********9776 PP

>> PF02367  Uncharacterised P-loop hydrolase UPF0079
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.8   0.0    0.0021       3.8      17      39 ..      30      52 ..      15      61 .. 0.81

  Alignments for each domain:
  == domain 1    score: 9.8 bits;  conditional E-value: 0.0021
                EEEEE-------HHHH------- CS
     PF02367 17 vvlLsGdlGaGKTtlvkglakgl 39
                  +L+G+ GaGKT+l++ l   l
  ABE38181.1 30 FQFLTGPSGAGKTSLLRLLFLSL 52
                5679*************988776 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.4   0.0    0.0028       4.9       4      24 ..      32      52 ..      29      58 .. 0.86

  Alignments for each domain:
  == domain 1    score: 9.4 bits;  conditional E-value: 0.0028
     PF05729  4 ilqGeaGsGKTtLlqklasaw 24
                +l+G++G GKT Ll+ l   +
  ABE38181.1 32 FLTGPSGAGKTSLLRLLFLSL 52
                699***********9887665 PP

>> PF00437  Type II/IV secretion system protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.3   0.0    0.0034       5.9     124     161 ..      14      51 ..       1      61 [. 0.79

  Alignments for each domain:
  == domain 1    score: 8.3 bits;  conditional E-value: 0.0034
     PF00437 124 kkklaevlrqavqargnilvsGgTgSGKttllnallae 161
                   ++ + l+ a+ a+    ++G+ g GKt ll  l   
  ABE38181.1  14 GPEILRDLNFAIPAHSFQFLTGPSGAGKTSLLRLLFLS 51 
                 5677888999999******************9877655 PP

>> PF04670  Gtr1/RagA G protein conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0    0.0067        12       4      25 ..      33      54 ..      31      64 .. 0.88

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0067
     PF04670  4 LmGksgsGKtSmrsiiFsnyla 25
                L G+sg+GKtS+   +F  + +
  ABE38181.1 33 LTGPSGAGKTSLLRLLFLSLRP 54
                89***********999988776 PP

>> PF03873  Anti sigma-E protein RseA, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0     0.012        21      29      49 ..      70      90 ..      64      91 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.012
     PF03873 29 teeqveeqrrRinamLqdhel 49
                t++ v+  r+Ri+  Lqd+ l
  ABE38181.1 70 TKDEVSALRQRIGIVLQDFRL 90
                67788889**********976 PP

>> PF07728  AAA domain (dynein-related subfamily)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.9   0.1     0.009        16       3      19 ..      32      48 ..      31      64 .. 0.88

  Alignments for each domain:
  == domain 1    score: 7.9 bits;  conditional E-value: 0.009
     PF07728  3 lLvGppGtgKselaerl 19
                +L Gp+G gK++l ++l
  ABE38181.1 32 FLTGPSGAGKTSLLRLL 48
                79***********9987 PP

>> PF05707  Zonular occludens toxin (Zot)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.49   8.6e+02       3      15 ..      31      43 ..      29      45 .. 0.88
   2 ?    4.7   0.0      0.07   1.2e+02     104     140 ..     175     212 ..     106     217 .. 0.84

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.49
     PF05707  3 ylvtGkpGsGKtl 15
                ++ tG  G+GKt+
  ABE38181.1 31 QFLTGPSGAGKTS 43
                699*********7 PP

  == domain 2    score: 4.7 bits;  conditional E-value: 0.07
     PF05707 104 evleafsehRhlgwdivlltqdiskidk.eiRalvela 140
                  +l  f e+ ++g  +v+ t di+ +d+ e+R++v ++
  ABE38181.1 175 RLLRLFVELNKSGTAVVIATHDINLMDQyEARRMVLHQ 212
                 4567899999****************984688887665 PP

>> PF03266  Protein of unknown function, DUF265
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0      0.01        18       3      20 ..      32      49 ..      30      60 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.01
                EEE-------HHHHHHHH CS
     PF03266  3 fiTGppgvGKtTlvkkvl 20
                f+TGp+g GKt l++ + 
  ABE38181.1 32 FLTGPSGAGKTSLLRLLF 49
                89**********998665 PP

>> PF00485  Phosphoribulokinase / Uridine kinase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0     0.014        24       4      22 ..      33      51 ..      32      80 .. 0.82

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.014
                E---------THHHHHHHH CS
     PF00485  4 vagsSGaGkttvarklesi 22
                ++g SGaGkt++ r l  +
  ABE38181.1 33 LTGPSGAGKTSLLRLLFLS 51
                69**********9987655 PP

>> PF01583  Adenylylsulphate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.017        29       6      28 ..      32      54 ..      28      75 .. 0.79

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.017
                EEE-ETT---HHHHHHHHHHHHH CS
     PF01583  6 wltGlsgsGKstiavalekkLve 28
                +ltG sg+GK+++   l  +L+ 
  ABE38181.1 32 FLTGPSGAGKTSLLRLLFLSLRP 54
                89**********98887766654 PP

>> PF04665  Poxvirus A32 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.016        29      18      38 ..      33      53 ..      24      71 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.016
     PF04665 18 lvggsGsGKttyLlsllktlv 38
                l+g sG GKt +L+ l+  l 
  ABE38181.1 33 LTGPSGAGKTSLLRLLFLSLR 53
                7899*************9886 PP

>> PF01695  IstB-like ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.024        42      50      63 ..      31      44 ..      16      49 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.024
     PF01695 50 lvllGpsGvGKthl 63
                  l+GpsG+GKt l
  ABE38181.1 31 QFLTGPSGAGKTSL 44
                4799********76 PP

>> PF02562  PhoH-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.024        42      16      35 ..      25      44 ..      19      53 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.024
     PF02562 16 lkkndivfaiGpaGtGKTyl 35
                + ++++ f++Gp+G+GKT l
  ABE38181.1 25 IPAHSFQFLTGPSGAGKTSL 44
                5578999***********77 PP

>> PF03205  Molybdopterin guanine dinucleotide synthesis protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.036        63       5      20 ..      33      48 ..      31      58 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.036
                EE-E-----HHHHHHH CS
     PF03205  5 vvGpkdsGKTTliekl 20
                 +Gp++ GKT+l++ l
  ABE38181.1 33 LTGPSGAGKTSLLRLL 48
                58***********987 PP

>> PF12128  Protein of unknown function (DUF3584)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.1     0.019        33      23      37 ..      34      48 ..      31      56 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.019
     PF12128 23 eGtNaaGKTtLlRLi 37
                 G  +aGKT+LlRL+
  ABE38181.1 34 TGPSGAGKTSLLRLL 48
                6778**********7 PP

>> PF05359  Domain of Unknown Function (DUF748)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.025        43      96     140 ..      49      96 ..      48     104 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.025
     PF05359  96 ylglelesGkLsl...dlnldlakgdk.kltakgklvledLelgdrvds 140
                 +l l+ ++G ++l   d++l   k++  +l+++ ++vl+d++l d  + 
  ABE38181.1  49 FLSLRPTRGLVNLfgnDVSLL-TKDEVsALRQRIGIVLQDFRLLDHMTT 96 
                 57788999*****97777776.677778****************98765 PP

>> PF00910  RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.029        51       2      20 ..      32      50 ..      31      71 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.029
     PF00910  2 wlyGpsgeGKStlakeLak 20
                +l+Gpsg GK++l + L  
  ABE38181.1 32 FLTGPSGAGKTSLLRLLFL 50
                689**********998765 PP

>> PF08477  Miro-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0      0.03        52       4      20 ..      33      49 ..      32      81 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.03
                EE--TT---HHHHHHHH CS
     PF08477  4 vvGdkgvGKssllsqlv 20
                + G +g+GK+sll+ l+
  ABE38181.1 33 LTGPSGAGKTSLLRLLF 49
                6799*********9776 PP

>> PF03215  Rad17 cell cycle checkpoint protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.027        47      48      65 ..      31      48 ..      23      56 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.027
     PF03215 48 llltGPsGcgKsTtvkvl 65
                 +ltGPsG+gK+  ++ l
  ABE38181.1 31 QFLTGPSGAGKTSLLRLL 48
                589*********998877 PP

>> PF10662  Ethanolamine utilisation - propanediol utilisation
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.037        65       5      21 ..      32      48 ..      30      51 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.037
     PF10662  5 lliGkvgaGKTtLtqal 21
                +l G++gaGKT+L + l
  ABE38181.1 32 FLTGPSGAGKTSLLRLL 48
                689**********9865 PP

>> PF11004  Protein of unknown function (DUF2843)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.034        60     135     153 ..     169     187 ..     162     194 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.034
     PF11004 135 rptqGeriLRvFtNinPeg 153
                  pt G+r+LR+F  +n +g
  ABE38181.1 169 DPTLGRRLLRLFVELNKSG 187
                 69***********999776 PP

>> PF09439  Signal recognition particle receptor beta subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.043        75       8      24 ..      33      49 ..      28      69 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.043
                EE--TT---HHHHHHHH CS
     PF09439  8 lvGlsdsGKTslftrLt 24
                l G+s +GKTsl+ +L 
  ABE38181.1 33 LTGPSGAGKTSLLRLLF 49
                78***********9986 PP

>> PF00488  MutS domain V
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.067   1.2e+02      41      61 ..      27      47 ..      15      52 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.067
                SS.EEEEE--TT---HHHHHH CS
     PF00488 41 ksrlllitGpNmgGKStylrq 61
                 ++++ +tGp  +GK ++lr 
  ABE38181.1 27 AHSFQFLTGPSGAGKTSLLRL 47
                467999*************96 PP

>> PF02516  Oligosaccharyl transferase STT3 subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.036        63     447     483 ..     180     216 ..     130     219 .] 0.80

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.036
     PF02516 447 wlkkntnkdsvviswwdlghflayiadrpvtfdGgsa 483
                 ++  n++   vvi+ +d++++  y+a+r+v+ +G+++
  ABE38181.1 180 FVELNKSGTAVVIATHDINLMDQYEARRMVLHQGRLH 216
                 5566788899************************997 PP

>> PF00625  Guanylate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.053        93       7      25 ..      33      51 ..      29      62 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.053
                EE------HHHHHHHHHHH CS
     PF00625  7 lvGpsgvGkstlkkaLlde 25
                l+Gpsg+Gk++l   L+ +
  ABE38181.1 33 LTGPSGAGKTSLLRLLFLS 51
                89**********9998865 PP

>> PF09848  Uncharacterized conserved protein (DUF2075)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.044        77       4      25 ..      31      52 ..      28      87 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.044
     PF09848  4 ilvtGvaGtGKtvvalnllael 25
                 + tG +G+GKt ++  l+  l
  ABE38181.1 31 QFLTGPSGAGKTSLLRLLFLSL 52
                5899*********999999887 PP

>> PF07693  KAP family P-loop domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.036        63      25      41 ..      33      49 ..      27     194 .. 0.92

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.036
     PF07693 25 lyGkWGsGKssllnlle 41
                l+G+ G+GK+sll ll 
  ABE38181.1 33 LTGPSGAGKTSLLRLLF 49
                78888********9996 PP

>> PF00158  Sigma-54 interaction domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.071   1.2e+02      18      44 ..      24      50 ..      15      64 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.071
                HHTS-S-EEEE-------HHHHHHHHH CS
     PF00158 18 vaktdltvlitGesGtGKellAraihe 44
                +++ ++  ++tG sG+GK+ l r+++ 
  ABE38181.1 24 AIPAHSFQFLTGPSGAGKTSLLRLLFL 50
                5566666789*********99998875 PP

>> PF01802  Herpesvirus VP23 like capsid protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.067   1.2e+02      11      28 ..      69      86 ..      66     114 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.067
     PF01802 11 LsaddvakLqkleGavvp 28
                L++d+v++L++ +G v+ 
  ABE38181.1 69 LTKDEVSALRQRIGIVLQ 86
                99************9984 PP

>> PF07181  VirC2 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.071   1.2e+02       6      31 ..     136     161 ..     131     175 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.071
                 -------------------------- CS
     PF07181   6 palsvsearrlaaarpeivhpsltls 31 
                 p ls +e +r a+ar+ i  p+l l+
  ABE38181.1 136 PVLSGGEKQRAAIARAVIGRPQLLLA 161
                 99****************99998655 PP

>> PF02513  Spin/Ssty Family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0       0.1   1.8e+02       2      25 ..      63      86 ..      62      92 .. 0.93

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.1
     PF02513  2 GkrVehtweegdgskskwkGtVLa 25
                G+ V+ +++++ ++  ++ G+VL+
  ABE38181.1 63 GNDVSLLTKDEVSALRQRIGIVLQ 86
                889999****************97 PP

>> PF01443  Viral (Superfamily 1) RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.077   1.4e+02       5      51 ..      35      78 ..      32     105 .. 0.63

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.077
     PF01443  5 GvpGcGKStlirkllrtltvnrptaelrtegkpklpnlsvrtvdsfl 51
                G  G+GK++l+r l+ +    rpt  l++   +++  l+   v ++ 
  ABE38181.1 35 GPSGAGKTSLLRLLFLS---LRPTRGLVNLFGNDVSLLTKDEVSALR 78
                667*********99998...666655555555555555444444444 PP

>> PF10443  RNA12 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0     0.082   1.4e+02      15      34 ..      26      45 ..      19      53 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.082
     PF10443 15 nvntfivvkgPrGSGkkeLv 34
                 +++f  ++gP G Gk++L+
  ABE38181.1 26 PAHSFQFLTGPSGAGKTSLL 45
                6789999***********97 PP

>> PF09303  KCNMB2, ball and chain domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.11     2e+02       3      15 ..     104     116 ..     102     117 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.11
                 -S-------SSSS CS
     PF09303   3 iwtSGRtssSyrh 15 
                 + +SGR  sSyr+
  ABE38181.1 104 FRVSGRDESSYRK 116
                 679********96 PP

>> PF00169  PH domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.32   5.6e+02      15      34 ..     200     219 .]     183     219 .] 0.83

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.32
                 SSSEEEEEEEEETTEEEEEE CS
     PF00169  15 lktwkkryfvLtsnyLllfk 34 
                   +++ r +vL++++L++++
  ABE38181.1 200 MDQYEARRMVLHQGRLHIYE 219
                 568999************96 PP

>> PF03029  Conserved hypothetical ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.16   2.9e+02       2      16 ..      34      48 ..      33      61 .. 0.75

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.16
     PF03029  2 vGpaGsGKttfvgal 16
                +Gp G+GKt++++ l
  ABE38181.1 34 TGPSGAGKTSLLRLL 48
                7*********99876 PP

>> PF06745  KaiC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.19   3.4e+02      16      35 ..      25      44 ..      19      53 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.19
     PF06745 16 ipegrvvlitGepGtGKtif 35
                ip  ++  +tG +G+GKt +
  ABE38181.1 25 IPAHSFQFLTGPSGAGKTSL 44
                78899999*********954 PP

>> PF10830  Protein of unknown function (DUF2553)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.19   3.3e+02       7      48 ..     165     206 ..     163     215 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.19
     PF10830   7 TdkVtgrlkngkleLYheneliGrlimteedqyelkegysfe 48 
                 T +V   l  + l L+ e ++ G+++++++ + +l + y+ +
  ABE38181.1 165 TGNVDPTLGRRLLRLFVELNKSGTAVVIATHDINLMDQYEAR 206
                 667888888999**************************9976 PP

>> PF11346  Protein of unknown function (DUF3149)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1      0.24   4.3e+02       5      14 ..      60      69 ..      58      70 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.24
     PF11346  5 dLFgnsiGLm 14
                +LFgn++ L+
  ABE38181.1 60 NLFGNDVSLL 69
                8******997 PP

>> PF08857  Putative ParB-like nuclease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0      0.24   4.1e+02      64     107 ..     176     219 .]     171     219 .] 0.91

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.24
     PF08857  64 llrallelgvkeavlvrvvedlsnldadafwnklendgwvylyd 107
                 llr ++el+++++ +v  ++d++ +d+ +  +++ ++g+++ y+
  ABE38181.1 176 LLRLFVELNKSGTAVVIATHDINLMDQYEARRMVLHQGRLHIYE 219
                 678899******9999999999999****************985 PP

>> PF12200  Domain of unknown function (DUF3597)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0      0.22   3.9e+02      63      82 ..     109     128 ..      96     133 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.22
                 -----TTT-HHHHHHHT--- CS
     PF12200  63 geklnwrtSiVDllKlldlD 82 
                  ++  +r+ ++DllK ++l 
  ABE38181.1 109 RDESSYRKEVIDLLKWVGLG 128
                 56778***********9985 PP

>> PF07046  Cytoplasmic repetitive antigen (CRA) like repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.1       0.2   3.6e+02      17      24 ..     142     149 ..     139     153 .. 0.73

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.2
     PF07046  17 EKqrAAEA 24 
                 EKqrAA A
  ABE38181.1 142 EKQRAAIA 149
                 88888865 PP

>> PF07675  Cleaved Adhesin Domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.19   3.4e+02     103     141 ..      84     121 ..      65     126 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.19
     PF07675 103 aaadFvvlfeetltakavkssekirgkaqgawlertvdL 141
                   +dF  l++  +t+++v  + ++ g+ ++ +++  +dL
  ABE38181.1  84 VLQDFR-LLDHMTTYENVALPFRVSGRDESSYRKEVIDL 121
                 566775.6789999999******************9998 PP

>> PF07931  Chloramphenicol phosphotransferase-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.27   4.7e+02       5      21 ..      32      48 ..      29      55 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.27
                EE-----------HHHH CS
     PF07931  5 lLnGgsssGKsslaral 21
                +L G s +GK+sl r l
  ABE38181.1 32 FLTGPSGAGKTSLLRLL 48
                799**********9876 PP

>> PF12034  Domain of unknown function (DUF3520)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.32   5.7e+02     138     177 ..      84     123 ..      72     127 .. 0.78

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.32
     PF12034 138 lLrgskyleklslakvielaeaakgedelgyraefveLve 177
                  L++ ++l++++  +  +l  +  g+de +yr+e+++L++
  ABE38181.1  84 VLQDFRLLDHMTTYENVALPFRVSGRDESSYRKEVIDLLK 123
                 56666667666666666777788999***********987 PP

>> PF07276  Apopolysialoglycoprotein (PSGP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.3      0.46     8e+02       9      13 .]      34      38 ..      33      38 .. 0.95

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.46
     PF07276  9 TGPSg 13
                TGPSg
  ABE38181.1 34 TGPSG 38
                9***9 PP

>> PF00748  Calpain inhibitor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.7   0.0       2.2   3.9e+03     101     111 ..     126     136 ..     116     138 .. 0.89

  Alignments for each domain:
  == domain 1    score: 0.7 bits;  conditional E-value: 2.2
     PF00748 101 klGeredTiPP 111
                  lGer+d +PP
  ABE38181.1 126 GLGERMDALPP 136
                 59********9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (219 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       219  (0.0183848); expected 238.2 (0.02)
Passed bias filter:                      217  (0.0182169); expected 238.2 (0.02)
Passed Vit filter:                        57  (0.00478509); expected 11.9 (0.001)
Passed Fwd filter:                        57  (0.00478509); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              57  [number of targets reported over threshold]
# CPU time: 0.21u 0.05s 00:00:00.26 Elapsed: 00:00:00
# Mc/sec: 2251.43
//