# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_24356.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABE38253.1  [L=540]
Description: rpal2 ABE38253.1 GIB00345CH01 "monooxygenase, FAD-binding"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.1e-57  196.9   0.0    3.9e-57  196.6   0.0    1.1  1  PF01494  FAD binding domain
    4.2e-10   41.7   0.5    6.5e-06   28.0   0.2    2.3  2  PF01266  FAD dependent oxidoreductase
    6.2e-06   28.5   0.0    1.1e-05   27.7   0.0    1.4  1  PF07992  Pyridine nucleotide-disulphide oxidoreductase
    2.2e-05   27.4   2.7     0.0012   21.8   0.1    2.6  2  PF00070  Pyridine nucleotide-disulphide oxidoreductase
    2.6e-05   25.6   0.0    0.00026   22.3   0.0    2.0  2  PF03486  HI0933-like protein
     0.0001   24.0   0.2     0.0015   20.1   0.0    2.2  2  PF00890  FAD binding domain
      0.002   19.8   0.3      0.025   16.2   0.4    2.5  1  PF05834  Lycopene cyclase protein
  ------ inclusion threshold ------
      0.012   17.4   0.0      0.019   16.7   0.0    1.3  1  PF01946  Thi4 family
       0.06   15.6   0.1       0.17   14.2   0.0    1.8  1  PF02737  3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
      0.061   15.4   0.1       0.13   14.3   0.0    1.5  1  PF03721  UDP-glucose/GDP-mannose dehydrogenase family, NAD b
      0.068   14.7   0.1       0.11   14.1   0.1    1.4  1  PF01134  Glucose inhibited division protein A
       0.14   14.5   0.0       0.35   13.2   0.0    1.6  1  PF01210  NAD-dependent glycerol-3-phosphate dehydrogenase N-
       0.19   14.3   0.1       0.39   13.4   0.0    1.5  1  PF02254  TrkA-N domain
       0.26   13.4   0.1       0.48   12.5   0.1    1.4  1  PF02558  Ketopantoate reductase PanE/ApbA
        2.7   10.7   0.0         23    7.7   0.0    2.2  1  PF01751  Toprim domain
        2.7    9.6   1.3    1.7e+02    3.7   0.0    2.6  2  PF01593  Flavin containing amine oxidoreductase
        3.2   10.6   0.0        6.4    9.6   0.0    1.5  1  PF12401  Protein of unknown function (DUF2662)
        6.8    9.2   0.2         13    8.3   0.1    1.4  1  PF00899  ThiF family
         11    8.5   0.0         28    7.3   0.0    1.6  1  PF07177  Neuralized
         13    8.9   0.0         34    7.5   0.0    1.7  1  PF03807  NADP oxidoreductase coenzyme F420-dependent
         17    7.9   0.0         39    6.7   0.0    1.6  1  PF00106  short chain dehydrogenase
         22    7.7   0.0         41    6.8   0.0    1.3  1  PF11985  Protein of unknown function (DUF3486)
         25    7.3   0.0         64    5.9   0.0    1.6  1  PF10727  Rossmann-like domain
         33    5.3   0.0         51    4.7   0.0    1.2  1  PF10100  Uncharacterized protein conserved in bacteria (DUF2
         36    6.5   0.0         68    5.6   0.0    1.3  1  PF00208  Glutamate/Leucine/Phenylalanine/Valine dehydrogenas
         42    6.4   0.0    1.1e+02    5.1   0.0    1.7  1  PF02080  TrkA-C domain
         71    5.9   0.0    1.9e+02    4.5   0.0    1.7  1  PF11619  Transcription factor P53 - C terminal domain
         73    5.7   0.0      2e+02    4.3   0.0    1.7  1  PF01206  SirA-like protein
         90    4.9   0.0    1.8e+02    3.9   0.0    1.5  1  PF00926  3,4-dihydroxy-2-butanone 4-phosphate synthase
    1.2e+02    5.0   0.1    2.1e+02    4.1   0.0    1.4  1  PF08659  KR domain
    1.4e+02    4.9   0.0    2.5e+02    4.1   0.0    1.4  1  PF03446  NAD binding domain of 6-phosphogluconate dehydrogen
    1.8e+02    3.5   0.1    2.5e+02    3.1   0.1    1.3  1  PF03435  Saccharopine dehydrogenase
    1.9e+02    4.8   0.0      1e+03    2.5   0.0    2.1  1  PF10829  Protein of unknown function (DUF2554)
    2.1e+02    4.0   0.0      7e+02    2.3   0.0    1.8  1  PF02188  GoLoco motif
    2.2e+02    3.7   0.2    1.2e+03    1.3   0.0    1.9  1  PF06564  YhjQ protein
    2.6e+02    2.7   0.0    3.9e+02    2.1   0.0    1.1  1  PF09659  CRISPR-associated protein (Cas_Csm6)
    2.9e+02    4.3   0.0      1e+03    2.5   0.0    1.8  1  PF09981  Uncharacterized protein conserved in bacteria (DUF2
    3.2e+02    3.0   0.0    4.8e+02    2.4   0.0    1.2  1  PF12430  Abscisic acid G-protein coupled receptor
    3.3e+02    3.2   0.0    5.3e+02    2.5   0.0    1.4  1  PF01656  CobQ/CobB/MinD/ParA nucleotide binding domain
    3.7e+02    3.2   0.0    5.8e+02    2.6   0.0    1.2  1  PF06391  CDK-activating kinase assembly factor MAT1
      4e+02    1.4   0.0    5.6e+02    0.9   0.0    1.1  1  PF07781  Reovirus minor core protein Mu-2
    4.7e+02    3.0   0.0    9.9e+02    2.0   0.0    1.4  1  PF07987  Domain of unkown function (DUF1775)
    4.9e+02    3.6   0.0    1.5e+03    2.0   0.0    1.7  1  PF01669  Myelin basic protein
    6.4e+02    2.8   0.2    1.2e+03    1.9   0.1    1.4  1  PF11377  Protein of unknown function (DUF3180)
    6.8e+02    2.0   0.2    1.2e+03    1.3   0.1    1.2  1  PF11286  Protein of unknown function (DUF3087)
    7.7e+02    2.4   0.0    1.4e+03    1.5   0.0    1.3  1  PF10463  Peptidase U49
    9.8e+02    2.0   2.5    1.7e+03    1.3   1.0    1.8  1  PF06904  Extensin-like protein C-terminus
    1.2e+03    1.6   0.2    2.2e+03    0.7   0.1    1.3  1  PF11206  Protein of unknown function (DUF2988)


Domain and alignment annotation for each model:
>> PF01494  FAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  196.6   0.0   1.9e-60   3.9e-57       3     354 ..      28     364 ..      26     366 .. 0.88

  Alignments for each domain:
  == domain 1    score: 196.6 bits;  conditional E-value: 1.9e-60
                 CEEE--------HHHHHHHHH.HHEEEEESSSCCCH------EEHHHHHHHHH---HHHHHCT-.EEE--EEEEEEEHHTTSS-EE-SEEEEECCCHGG CS
     PF01494   3 dVlIVGaGpaGlmlallLseaGvrvvlvekhsttvvlprAdglnqrtmellrqlGledrilaegapnelmgealynelsdtrikverpkaradleless 101
                 +V++VGaGp+Gl+la  L+++G +vvl++  ++  + +rA  +++r +e+ + lG+ +r+ ++g+  ++ +++ + e           +     e   +
  ABE38253.1  28 PVVVVGAGPVGLSLAIDLAQRGENVVLLDDADRIGEGSRAICFSKRALEVWDRLGVGARMVEKGVVWQVGKIFRRDE--------MVYQFDLLPETGHK 118
                 8****************************************************************999977777777........22233333333456 PP

                 TT-CCE--ECCCCCCHHHHHHC--.EEETSECECCSCCCHHHHHHCCCCEEE---EEEEEECEEE-------HCHHHS-GGEEEEEEC-EE-EEEEEEC CS
     PF01494 102 pervtvypqteleriLvehaeerg.lqvrfktevlsleqdeegvtavvrdketgeeetvrakYlvGaDGgrStvrktlgiefegeetvyeagvldvlfd 199
                 +++   + q + e +Lve+ ++++ +++r+ + v++l q++++  av++ ++ +  +++ a+Y+v++DG+rS+ r  +g ef ge    ++ ++dv ++
  ABE38253.1 119 MPAFINLQQYYAEAYLVERVQQLPqIDLRWRNKVTALAQHNDH--AVLTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIADVRMN 215
                 77778889*******************************9998..****************************************99999********* PP

                 C-STTTTSESCEEEEC----E.EEEEECCTTEEEEEE-B-TT--GGGS.CCCHHHHHHHHHCHHHHCTT-EEEEEEEEEEEE-EEEEECSSEETTEE-- CS
     PF01494 200 adlsdivegvvlilsaesrgv.mviPlesanlerfyvqvearaekeer.sekfteeevkarlreavgektldveieevsawevaqrvaeryrkgrvfla 296
                 a+++   e +++   +  +g  +++ ++     + +++++++  ++ +   ++ +e+v+ r+++  g +++  ++e++s+++ + r ++r+ + rv  a
  ABE38253.1 216 AEFP--TERWFWFDPPFHSGQsALLHRQP----DNVWRIDLQIGADADaAVERLPENVRPRIERMLGNSDF--SFEWISIYKFQCRRMQRFLHERVIFA 306
                 ***9..66677776664444325555555....444555544444433388999*************9877..689*********************** PP

                 ---SEE--S------HHHHHHHHHHHHHHHHHHH--B-GGGGHHHHHHHHHHHHHHHH CS
     PF01494 297 GDAaHihpPtgGqGlNtaiqDaynLawkLaavlkGeAkeelLdtYeeerrpvaqavvd 354
                 GD+aH ++P g+ G N++++D  n+awkLa+vl+G+A  +lLd+Ye er++ a + ++
  ABE38253.1 307 GDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAADDNIR 364
                 ****************************************************998876 PP

>> PF01266  FAD dependent oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.0   0.2   3.1e-09   6.5e-06       2      36 ..      29      64 ..      28      68 .. 0.92
   2 !   11.6   0.0   0.00029       0.6     162     227 ..     144     211 ..     125     320 .. 0.64

  Alignments for each domain:
  == domain 1    score: 28.0 bits;  conditional E-value: 3.1e-09
                EEEE-------HHHHHHHHTT-EEEEEESS.STTSS CS
     PF01266  2 vviiGgGivGlstAyeLarrglkVtllekg.diasg 36
                vv++G+G vGls A++La+rg +V+ll+   +i++g
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLDDAdRIGEG 64
                8***************************99788876 PP

  == domain 2    score: 11.6 bits;  conditional E-value: 0.00029
                 -EEEESEEEEEEEEETTE.EEEEEEEETT..EEEEEEEE----THHHHHHGCTCCTTEEEEEEEEEEEE CS
     PF01266 162 veiiegtkVtglereggr.vsgvrtedgs..iradkvvlAaGawsskllkllgldlpirpvrgqvlvte 227
                  +++ + kVt l +++++ v +++t+dgs  + ad vv + Ga s + ++++g+++  +    q l+ +
  ABE38253.1 144 IDLRWRNKVTALAQHNDHaVLTIETPDGSyrLAADYVVACDGARSAL-RGMVGAEFAGEVFEDQFLIAD 211
                 56777779***98888887667******733556*********9999.999999885555555554444 PP

>> PF07992  Pyridine nucleotide-disulphide oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.7   0.0   5.4e-09   1.1e-05       2     121 ..      29     200 ..      28     217 .. 0.78

  Alignments for each domain:
  == domain 1    score: 27.7 bits;  conditional E-value: 5.4e-09
                 EEEE----HHHHHHHHHHHCTSEEEEESSS.GSSSTTTSGGHHHHHHHHHHHHH.................................CCCHHHHHHHHH CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxx.................................xxxxxxxxxxxx RF
     PF07992   2 vviIGgGpaGlaaakrlarlglkvaliere.pggtclnrgcipkkllleaaeee.................................eldlkeleerkd 66 
                 vv++G+Gp Gl+ a++la+ g +v+l+++    g +    c +k++l+  ++ +                                  +++  ++  ++
  ABE38253.1  29 VVVVGAGPVGLSLAIDLAQRGENVVLLDDAdRIGEGSRAICFSKRALEVWDRLGvgarmvekgvvwqvgkifrrdemvyqfdllpetGHKMPAFINLQQ 127
                 9**************************6665466677777888888886666668888899999***********************666666666666 PP

                 HHHEEEHCHHEEEEE....CTHTTEEE.ETEEE..............EEEEEEEEE----B----TCCTBTCTT CS
                 xxxxxxxxxxxxxxx....xxxxxxxx.xxxxx..............xxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF07992  67 egievllntgvtdid....kakkkvel.adgka..............evkydklviAtGakprtlgipGvelag 121
                 + +e +l ++v+++     + ++kv++ a+  +              ++ +d++v   Ga++   g+ G+e+ag
  ABE38253.1 128 YYAEAYLVERVQQLPqidlRWRNKVTAlAQH-NdhavltietpdgsyRLAADYVVACDGARSALRGMVGAEFAG 200
                 6666666666666553334345567774322.346789999999999***************999999998765 PP

>> PF00070  Pyridine nucleotide-disulphide oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   21.8   0.1   5.6e-07    0.0012       2      35 ..      29      62 ..      28      90 .. 0.86
   2 ?    5.2   0.0     0.084   1.8e+02      42      76 ..     130     165 ..     117     172 .. 0.81

  Alignments for each domain:
  == domain 1    score: 21.8 bits;  conditional E-value: 5.6e-07
                EEEE-E-HHHHHHHHHHHHTTSEEEEEESSSSSS CS
     PF00070  2 vvvvGgGyiGlElAaalaklgkkVtvierrdrll 35
                vvvvG+G +Gl lA+ la+ g +V +++ +dr+ 
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLDDADRIG 62
                8*******************************98 PP

  == domain 2    score: 5.2 bits;  conditional E-value: 0.084
                 HHHHHHHHHHHT.TEEEEESEEEEEEEESEEE.EEEE CS
     PF00070  42 iakilqkklekn.gievllntkveeiegsadg.vevk 76 
                 ++++l ++++++  i++++ +kv+++ +++d+ v ++
  ABE38253.1 130 AEAYLVERVQQLpQIDLRWRNKVTALAQHNDHaV-LT 165
                 7889999999999****************99844.33 PP

>> PF03486  HI0933-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.3   0.0   1.3e-07   0.00026       3      37 ..      29      63 ..      27      66 .. 0.95
   2 ?    0.9   0.0      0.39   8.2e+02     122     167 ..     142     189 ..     132     213 .. 0.76

  Alignments for each domain:
  == domain 1    score: 22.3 bits;  conditional E-value: 1.3e-07
                EEEE-------HHHHHHHH----EEEE-------- CS
     PF03486  3 viviGgGaAGlmaAisaakrgakVllldkakklgr 37
                v+v+G+G+ Gl  Ai +a+rg++V+lld a+++g+
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLDDADRIGE 63
                9******************************9996 PP

  == domain 2    score: 0.9 bits;  conditional E-value: 0.39
                 ---EEE-S--EEEE-S-S.S--EEEEE..TTEEEEESEEEE------- CS
     PF03486 122 agvkirletevksvekee.dgafrvkt.kseeeleadklvlAtGGkSi 167
                  ++++r +++v+++++++ + +++++t +++ +l+ad++v   G  S+
  ABE38253.1 142 PQIDLRWRNKVTALAQHNdHAVLTIETpDGSYRLAADYVVACDGARSA 189
                 578999999**9996655056688999888889999999988888885 PP

>> PF00890  FAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   20.1   0.0   7.4e-07    0.0015       2      36 ..      29      63 ..      28      80 .. 0.89
   2 ?    1.6   0.0      0.31   6.5e+02     145     203 ..     133     186 ..     115     202 .. 0.76

  Alignments for each domain:
  == domain 1    score: 20.1 bits;  conditional E-value: 7.4e-07
                EEEE-------HHHHHHHCHTT-EEEEESS-CCGS CS
     PF00890  2 vvViGsGlAGlaAAleaaeaglkvavvekeqetgg 36
                vvV+G+G  Gl+ A+ +a++g +v++++ +++ g 
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLDDADRIGE 63
                9***************************9988776 PP

  == domain 2    score: 1.6 bits;  conditional E-value: 0.31
                 HHHHHHHC-TTEEEEESEEEEE--BG--.BB---EEEETTTTCEEEEEES.EEEE----- CS
     PF00890 145 rllesareagkvdfqerhradeLivedg.rvtGvvvenprsgrevrirakaavvlatgGf 203
                  l+e++++ +++d++ r ++++L ++++  v +++       +  r++a+   v+a+ G+
  ABE38253.1 133 YLVERVQQLPQIDLRWRNKVTALAQHNDhAVLTIET----PDGSYRLAAD--YVVACDGA 186
                 6899*********************87746666543....4445556666..44444444 PP

>> PF05834  Lycopene cyclase protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   16.2   0.4   1.2e-05     0.025       2      53 ..      29      77 ..      28     206 .. 0.66

  Alignments for each domain:
  == domain 1    score: 16.2 bits;  conditional E-value: 1.2e-05
     PF05834  2 lvivGaGlAglllAlrlreakpglrvllidagpkllfgnnytWsfeeedlge 53
                +v+vGaG+ gl+lA  l  a+ g +v+l+d ++ +   + +  +f +++l+ 
  ABE38253.1 29 VVVVGAGPVGLSLAIDL--AQRGENVVLLDDADRI-GEGSRAICFSKRALEV 77
                89***************..88889*****999988.3344466776666664 PP

>> PF01946  Thi4 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   16.7   0.0   9.2e-06     0.019      17      56 ..      26      65 ..      18      94 .. 0.88

  Alignments for each domain:
  == domain 1    score: 16.7 bits;  conditional E-value: 9.2e-06
                EECEEEE-------HHHHHHHCCTS-EEEEESSS------ CS
     PF01946 17 esDvvivGaGssGltaayylakkdlkvailerklsiGGGa 56
                   vv+vGaG+ Gl+ a  la+++ +v++l+    iG G+
  ABE38253.1 26 RHPVVVVGAGPVGLSLAIDLAQRGENVVLLDDADRIGEGS 65
                5679**************************9988888775 PP

>> PF02737  3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.2   0.0     8e-05      0.17       2      34 ..      29      61 ..      28      76 .. 0.87

  Alignments for each domain:
  == domain 1    score: 14.2 bits;  conditional E-value: 8e-05
                EEEE---------HHHHHTT.SEEEEE-S-HHH CS
     PF02737  2 vaVvGaGtmGagiAavfaragleVvlvdiseea 34
                v VvGaG +G ++A  +a++g +Vvl+d ++  
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLDDADRI 61
                89*************************987655 PP

>> PF03721  UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.3   0.0   6.2e-05      0.13       3      31 ..      29      57 ..      27      68 .. 0.89

  Alignments for each domain:
  == domain 1    score: 14.3 bits;  conditional E-value: 6.2e-05
                EEEE--------HHHHCCCCSSEEEEE-S CS
     PF03721  3 iaviGlGYvGlptavvlaekghevvgvDi 31
                + v+G+G vGl++a+ la++g +vv++D 
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLDD 57
                78***********************9995 PP

>> PF01134  Glucose inhibited division protein A
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.1   0.1   5.1e-05      0.11       2      37 ..      29      63 ..      28     186 .. 0.90

  Alignments for each domain:
  == domain 1    score: 14.1 bits;  conditional E-value: 5.1e-05
                EEEE-------HHHHHHHH----EEEEES-GGGTT- CS
     PF01134  2 viViGgGhAGceAAlaaarlGakvlLithkldtiae 37
                v+V+G+G  G+  A+ +a++G +v+L+  + d+i+e
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLL-DDADRIGE 63
                9*************************9.77777776 PP

>> PF01210  NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.2   0.0   0.00017      0.35       2      29 ..      28      55 ..      27      63 .. 0.91

  Alignments for each domain:
  == domain 1    score: 13.2 bits;  conditional E-value: 0.00017
                EEEEE-------HHHHHHCCTEEEEEEE CS
     PF01210  2 kvavlGaGswGtalAkvlaenghevrlW 29
                 v+v+GaG +G +lA+ la++g++v+l 
  ABE38253.1 28 PVVVVGAGPVGLSLAIDLAQRGENVVLL 55
                589*********************9985 PP

>> PF02254  TrkA-N domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.4   0.0   0.00019      0.39       1      32 [.      29      60 ..      29      84 .. 0.80

  Alignments for each domain:
  == domain 1    score: 13.4 bits;  conditional E-value: 0.00019
                EEEE---HHHHHHHHHHHHTCEEEEEEESSHH CS
     PF02254  1 iiiiGlGrvGrslaeeLsegekdvvvidkdee 32
                ++++G+G vG sla  L +++++vv++d+ ++
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLDDADR 60
                79*****************5557999998763 PP

>> PF02558  Ketopantoate reductase PanE/ApbA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.5   0.1   0.00023      0.48       1      31 [.      29      59 ..      29      69 .. 0.91

  Alignments for each domain:
  == domain 1    score: 12.5 bits;  conditional E-value: 0.00023
                EEEE-------HHHHHHTCHHHEEEEE-S-H CS
     PF02558  1 iailGaGaiGsllaakLakagadvtlilrsr 31
                ++++GaG +G  la  La+ g++v+l++  +
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLDDAD 59
                689***********************99776 PP

>> PF01751  Toprim domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0     0.011        23      48      88 ..     291     344 ..     274     356 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.011
                 HHHHHHHHHHCCSEEEEE--SS--...............--HHHHHHHHHCTH-HH CS
     PF01751  48 vlkllkelakeadeviiatDpDre...............Gekiawellellkpknk 88 
                 + + +++ ++e   vi+a D  +                Ge+iaw+l+ +l++ ++
  ABE38253.1 291 QCRRMQRFLHE--RVIFAGDSAHQvspfgargansgledGENIAWKLAMVLRGDAP 344
                 56677788888..89999999999999999999999999**********9998765 PP

>> PF01593  Flavin containing amine oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.1     0.083   1.7e+02       3      27 ..      38      62 ..      38      62 .. 0.99
   2 ?    3.7   0.0      0.08   1.7e+02     216     262 ..     136     185 ..     131     206 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.083
                --HHHHHHHH---EEEEEESSS--- CS
     PF01593  3 GLaAArqLlqaGfdVtvlEArdrvG 27
                GL+ A  L+q+G +V++l   dr+G
  ABE38253.1 38 GLSLAIDLAQRGENVVLLDDADRIG 62
                9***********************9 PP

  == domain 2    score: 3.7 bits;  conditional E-value: 0.08
                 HHCCCCEGTTEETTEEEEEEEEETSCEEEEEECSS...EEEESEEEE-S- CS
     PF01593 216 alaegldggvvrlnkrVksitkegdgvtvttedge...tykaDaVvvTlp 262
                 ++ + l++ ++r++++V+ + + +d + +t+e+ +    + aD+Vv +  
  ABE38253.1 136 ERVQQLPQIDLRWRNKVTALAQHNDHAVLTIETPDgsyRLAADYVVACDG 185
                 5678889999**************99999888888889999999998865 PP

>> PF12401  Protein of unknown function (DUF2662)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.6   0.0    0.0031       6.4      27      68 ..     384     425 ..     366     438 .. 0.88

  Alignments for each domain:
  == domain 1    score: 9.6 bits;  conditional E-value: 0.0031
     PF12401  27 vEiakaLrremddnarevsrgrtlaPneYtvelspeDferla 68 
                  ++a aL+r ++   r+v++gr+  P++Y+  ls+ D ++ +
  ABE38253.1 384 RDVALALARDVEFAKRMVNAGRLSTPTAYDTPLSTPDADAWS 425
                 58999********************************99866 PP

>> PF00899  ThiF family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.3   0.1    0.0063        13       5      37 ..      29      61 ..      25      70 .. 0.91

  Alignments for each domain:
  == domain 1    score: 8.3 bits;  conditional E-value: 0.0063
     PF00899  5 vlvvGaGglGseaaeaLaraGvgkltlvDkDtv 37
                v+vvGaG +G  +a  La  G   + l D D++
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLDDADRI 61
                89*******************999999898987 PP

>> PF07177  Neuralized
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.3   0.0     0.013        28       9      53 ..      48      91 ..      43      99 .. 0.79

  Alignments for each domain:
  == domain 1    score: 7.3 bits;  conditional E-value: 0.013
                ----EEE------EEE-S-SS--EEEBSS---SS--EEE..E----- CS
     PF07177  9 kGsnvrlskdrtvakRresFcdaltFsaRPvrigekvlv..kvlkie 53
                +G+nv+l +d   a R  +  +a+ Fs+R +++ +++ v  ++++++
  ABE38253.1 48 RGENVVLLDD---ADRIGEGSRAICFSKRALEVWDRLGVgaRMVEKG 91
                7999999998...67999999**************998733444444 PP

>> PF03807  NADP oxidoreductase coenzyme F420-dependent
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0     0.016        34       2      30 ..      29      54 ..      28      67 .. 0.86

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.016
                EEEE----HHHHHHHHHHH--..GGCEE- CS
     PF03807  2 igiiGaGnigealakglaaagaqkhevii 30
                + ++GaG +g +la  la++g   ++v++
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRG---ENVVL 54
                5689*****************...99985 PP

>> PF00106  short chain dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.019        39       3      33 ..      29      58 ..      27      80 .. 0.79

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.019
                EEEE--------HHHHHHHHH.-EEEEEESS CS
     PF00106  3 vliTGGlgglGlalArwLveegarhlvlvsr 33
                v+++G +g +Gl lA  L+++g ++++l + 
  ABE38253.1 29 VVVVG-AGPVGLSLAIDLAQRGENVVLLDDA 58
                45555.9**************7777766654 PP

>> PF11985  Protein of unknown function (DUF3486)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0      0.02        41       7      28 ..     260     281 ..     257     285 .. 0.91

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.02
     PF11985   7 vdlLPeevrewLerlLrekgfs 28 
                 v++LPe+vr  +er+L ++ fs
  ABE38253.1 260 VERLPENVRPRIERMLGNSDFS 281
                 9***************999987 PP

>> PF10727  Rossmann-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.031        64       6      39 ..      22      55 ..      14      68 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.031
                ....--EE--EE-----S-HHHHHHH---EE--- CS
     PF10727  6 ersarLsvGiisaGrvgvalgealeraghvvvav 39
                + +ar  v ++ aG vg +l+ +l++ g  vv +
  ABE38253.1 22 NDPARHPVVVVGAGPVGLSLAIDLAQRGENVVLL 55
                3789*********************999998865 PP

>> PF10100  Uncharacterized protein conserved in bacteria (DUF2338)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.025        51       3      29 ..      28      54 ..      26      77 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.025
     PF10100  3 kvLllGtGpvaiqlavdlkahgdarlg 29
                +v+++G+Gpv + la+dl ++g+  + 
  ABE38253.1 28 PVVVVGAGPVGLSLAIDLAQRGENVVL 54
                689******************998764 PP

>> PF00208  Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.033        68      31      64 ..      25      58 ..      16      61 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.033
                CC-EEEEE----HHHHHHHHHHHCT-EEEEE--- CS
     PF00208 31 egkrvaiqGsGnvgsyaaelltelgakvvavsDs 64
                +   v++ G G vg  +a  l ++g++vv + D 
  ABE38253.1 25 ARHPVVVVGAGPVGLSLAIDLAQRGENVVLLDDA 58
                556799***********************99775 PP

>> PF02080  TrkA-C domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.055   1.1e+02      17      64 ..     141     191 ..     139     194 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.055
     PF02080  17 lkelnlrerygvlvvairRg...geviiprgdtvLepGDvllvvgspedla 64 
                 l +++lr r +v+ +a + +     ++ p+g+++L ++ v+   g +++l+
  ABE38253.1 141 LPQIDLRWRNKVTALAQHNDhavLTIETPDGSYRLAADYVVACDGARSALR 191
                 6678899999999999988888999*********************99986 PP

>> PF11619  Transcription factor P53 - C terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.093   1.9e+02      11      21 ..     167     177 ..     161     205 .. 0.75

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.093
                 E-----EEEEE CS
     PF11619  11 rtpdGdyrlai 21 
                  tpdG yrla 
  ABE38253.1 167 ETPDGSYRLAA 177
                 59*******95 PP

>> PF01206  SirA-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.097     2e+02      42      66 ..     151     175 ..     148     176 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.097
     PF01206  42 dipafakklghelleveeedgeyri 66 
                  + a+a+++ h++l +e  dg yr+
  ABE38253.1 151 KVTALAQHNDHAVLTIETPDGSYRL 175
                 68999***********9999*9986 PP

>> PF00926  3,4-dihydroxy-2-butanone 4-phosphate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.086   1.8e+02       4      27 ..      42      65 ..      39      74 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.086
     PF00926  4 aiealkaGklvivvDdedrEnegd 27
                ai+  ++G+ v+++Dd+dr +eg 
  ABE38253.1 42 AIDLAQRGENVVLLDDADRIGEGS 65
                6788899************99875 PP

>> PF08659  KR domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0       0.1   2.1e+02       5      30 ..      30      55 ..      28      91 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.1
     PF08659  5 vtGGlgglGlelarwLaergarhlvl 30
                v+ G+g +Gl+la  La+rg + ++l
  ABE38253.1 30 VVVGAGPVGLSLAIDLAQRGENVVLL 55
                55579*************99876665 PP

>> PF03446  NAD binding domain of 6-phosphogluconate dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0      0.12   2.5e+02       4      31 ..      29      56 ..      26      67 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.12
                BEEB-------HHHHHHHH---EEEE-- CS
     PF03446  4 igfiGlGvMGsnmarnllkagykvavyd 31
                + ++G G  G ++a  l+++g +v++ d
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGENVVLLD 56
                679*********************9988 PP

>> PF03435  Saccharopine dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.1      0.12   2.5e+02       1      32 [.      29      58 ..      29     111 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.12
                EEEE----THHHHHHHHHTTTC..EEEEEESS CS
     PF03435  1 vlvlGaGsvGqavaellarhgdvdeitvadrt 32
                v+v+GaG vG ++a +la++g+  ++++ d  
  ABE38253.1 29 VVVVGAGPVGLSLAIDLAQRGE--NVVLLDDA 58
                89******************97..58887755 PP

>> PF10829  Protein of unknown function (DUF2554)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.49     1e+03      21      44 ..     155     178 ..     152     190 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.49
     PF10829  21 laghkghefvwvknvdhqlrhead 44 
                 la+h++h+ + +++ d   r  ad
  ABE38253.1 155 LAQHNDHAVLTIETPDGSYRLAAD 178
                 89************9999998888 PP

>> PF02188  GoLoco motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.33     7e+02      10      16 ..     289     295 ..     287     295 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.33
     PF02188  10 raQssRl 16 
                 ++Q++R+
  ABE38253.1 289 KFQCRRM 295
                 89****9 PP

>> PF06564  YhjQ protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0      0.57   1.2e+03      93     141 ..     136     184 ..     118     191 .. 0.87

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.57
     PF06564  93 enlealqedlsaiaealqklkaseryrWvLlDlPagesaltrellelad 141
                 e++++l +    +++++++l +++ +  + ++ P g+  l+ + +  +d
  ABE38253.1 136 ERVQQLPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVACD 184
                 567778888899*********9999**999******9999999998888 PP

>> PF09659  CRISPR-associated protein (Cas_Csm6)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.19   3.9e+02     288     324 ..     118     153 ..     110     165 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.19
     PF09659 288 nlleflaileilepdsqllkavnvlrslegkvRNkvA 324
                 ++++f+++ + ++ +  l+++v+ l +++ + RNkv 
  ABE38253.1 118 KMPAFINLQQYYA-EAYLVERVQQLPQIDLRWRNKVT 153
                 6899999766665.555*****************984 PP

>> PF09981  Uncharacterized protein conserved in bacteria (DUF2218)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0       0.5     1e+03      52      88 ..     248     284 ..     230     285 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.5
                 EEEEEEESSHHHHHHHHHHHHHHHHHTSTTSS---B- CS
     PF09981  52 LtlrleaedeeelarlrkvvadHlerfafreelkleW 88 
                 ++l++ a+ +++++rl + v+  +er+  + ++++eW
  ABE38253.1 248 IDLQIGADADAAVERLPENVRPRIERMLGNSDFSFEW 284
                 68899999****************************9 PP

>> PF12430  Abscisic acid G-protein coupled receptor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.23   4.8e+02     145     168 ..     262     284 ..     259     290 .. 0.80

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.23
     PF12430 145 nLPeevssslselLgeksalefef 168
                  LPe+v+ +++++Lg +s++ fe 
  ABE38253.1 262 RLPENVRPRIERMLG-NSDFSFEW 284
                 7**************.66666654 PP

>> PF01656  CobQ/CobB/MinD/ParA nucleotide binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.26   5.3e+02      18      34 ..      40      56 ..      37     186 .. 0.70

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.26
                HHHHHHHH----EEEEE CS
                xxxxxxxxxxxxxxxxx RF
     PF01656 18 nLaralakrglrVlliD 34
                +La +la+rg +V+l+D
  ABE38253.1 40 SLAIDLAQRGENVVLLD 56
                89**********99997 PP

>> PF06391  CDK-activating kinase assembly factor MAT1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.28   5.8e+02      47     107 ..     325     385 ..     319     403 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.28
                 ------------------------------------------------------------- CS
     PF06391  47 lEevEeivfnLvneidveeTeekvkayekenkdsIqkNkerlaaeqeeleealklekeeke 107
                 lE+ E+i ++L+     ++    ++ ye e  +  + N +++++    ++ + k+e++ + 
  ABE38253.1 325 LEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAADDNIRHSTRSTDFIAPHSKQERRLRD 385
                 899999*******9999*************************************9998665 PP

>> PF07781  Reovirus minor core protein Mu-2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.0      0.27   5.6e+02     331     349 ..     479     497 ..     476     499 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.27
     PF07781 331 ditlsdeyplRqesGmfvd 349
                 +++++++ plR+e+G+f++
  ABE38253.1 479 SLRIGKDAPLRDEEGLFTK 497
                 6899*************85 PP

>> PF07987  Domain of unkown function (DUF1775)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.48   9.9e+02      30      68 ..     366     404 ..     355     406 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.48
     PF07987  30 syekatlrVPhecdgkaTtkvrvklPeGviaakpepkpG 68 
                 s+   ++  Ph +       v ++l  +v++ak +  +G
  ABE38253.1 366 STRSTDFIAPHSKQERRLRDVALALARDVEFAKRMVNAG 404
                 66677788899999999999*************998877 PP

>> PF01669  Myelin basic protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.74   1.5e+03      11      36 ..      80     105 ..      78     111 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.74
     PF01669  11 rhglgaRkrdsGlLDslGkfFgGdrk 36 
                 r g+gaR  + G++ ++Gk+F  d  
  ABE38253.1  80 RLGVGARMVEKGVVWQVGKIFRRDEM 105
                 67999****************87765 PP

>> PF11377  Protein of unknown function (DUF3180)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.1      0.59   1.2e+03      65      83 ..     521     539 ..     510     540 .] 0.90

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.59
     PF11377  65 dPltaarllvlAkAsalvG 83 
                 +P++aa  ++lA+As  +G
  ABE38253.1 521 HPTQAALDAALARASGRAG 539
                 8**************9887 PP

>> PF11286  Protein of unknown function (DUF3087)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.1      0.56   1.2e+03      72     113 ..     125     166 ..     118     168 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.56
     PF11286  72 ekpflaevvYvwrLkqllnkiyrklkkikaaakqgdenAlii 113
                  +++ ae++ v r++ql +   r  +k++a a+++d++ l+i
  ABE38253.1 125 LQQYYAEAYLVERVQQLPQIDLRWRNKVTALAQHNDHAVLTI 166
                 57999*********999988899999****999999998876 PP

>> PF10463  Peptidase U49
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.68   1.4e+03     180     203 ..     142     165 ..     133     167 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.68
     PF10463 180 PalqdRienkisaleleeddevle 203
                 P+++ R++nk+ al + +d+ vl+
  ABE38253.1 142 PQIDLRWRNKVTALAQHNDHAVLT 165
                 99999***********99999876 PP

>> PF06904  Extensin-like protein C-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   1.0      0.82   1.7e+03     159     171 ..       3      15 ..       2      20 .. 0.79

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.82
     PF06904 159 aHadHfHldlaer 171
                 +H++HfH+  +++
  ABE38253.1   3 LHQEHFHFGYRRH 15 
                 6*******99544 PP

>> PF11206  Protein of unknown function (DUF2988)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.7   0.1       1.1   2.2e+03      16      21 ..     365     370 ..     364     371 .. 0.91

  Alignments for each domain:
  == domain 1    score: 0.7 bits;  conditional E-value: 1.1
     PF11206  16 lSTlST 21 
                 +ST+ST
  ABE38253.1 365 HSTRST 370
                 8****9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (540 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       295  (0.0247649); expected 238.2 (0.02)
Passed bias filter:                      269  (0.0225823); expected 238.2 (0.02)
Passed Vit filter:                        48  (0.00402955); expected 11.9 (0.001)
Passed Fwd filter:                        48  (0.00402955); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              48  [number of targets reported over threshold]
# CPU time: 0.37u 0.04s 00:00:00.41 Elapsed: 00:00:00
# Mc/sec: 3150.83
//